Citrus Sinensis ID: 004698


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730------
MMMKFFGKGKDSSPYNSLQPSTSPSSSRLPLNSTPVTGPARPIRLVYCDEKGKFRMDPEAVAALQLVKEPIGVVSVCGRARQGKSFILNQLLGRSSGFQVASTHRPCTKGLWLWSAPLKRTALDGTEYNLLLLDSEGIDAYDQTGTYSTQIFSLAVLLSSMFIYNQMGGIDESAIDRLSLVTQMTKHIRIRASGGKTTPSELGQFSPIFVWLLRDFYLDLVEDNRKITPRDYLEIALRPVQGSGRDIAAKNEIRDSIRALFPDRECFTLVRPLSNENELQRLDQISLDRLRPEFRAGLDALTKFVFERTRPKQVGATVLTGPVLIGITESYLDAINNGAVPTISSSWQSVEEAECRRAYDSATETYMSTFDRSKPPEEVALGEAHEAAVQKALAVYNAGAVGVGLARKKYEGLLQKFFRKAFEDHKKNVYMEADIRCSSAIQSMERKLRAACHSSDASIDNVVKVLDGLISEYETSCHGPGKWQKLATFLQQSSEGPILDLVKRLIDQIGSERSSLMLKYRSIEDNMKLLKKQLEDSERYKSEYLKRYDDAINDKKKLADDYTSRINNLQGENISLREKSSSLSKTVDSLKNEISDWKRKYDQVLTKQKAMEDQVCSEIEVLKSRSTAAEARLAAAREQALSAQEEVEEWKRKYGVAVREAKAALEKAAIVQERTSKEMQQREDVLREEFSSTLAEKEEEMKEKATKIEHAEQCLTTLRLELKVSFFDIYSNKFYL
ccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccEEEcHHHHHHHHcccccEEEEEEEccccccHHHHHHHHHccccccccccccccccccEEEEcccccccccccccEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEEEccccccccccccccHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHccccccccccHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc
cHHHHHccccccccccccccccccccccccccccccccccccEEEEEEccccEEEEcHHHHHHHHHccccEEEEEEEEcccccHHHHHHHHHccccccccccccccccccEEEEEccccccccccccEEEEEEcccccccccccccccHHHHHHHHHHHHHEEEcccccHcHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHcccEEEEEEHEEEEEEcccccccHHHHHHHHHcccccccHHHHHcccHHHHHHHHccccEEEEEccccccHHHHHHHHHccHHHccHHHHHHHHHHHHHHHHcccccEcccEEEccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc
mmmkffgkgkdsspynslqpstspsssrlplnstpvtgparpirlvycdekgkfrmdPEAVAALQLVkepigvvsvcgrarqgkSFILNQllgrssgfqvasthrpctkglwlwsaplkrtaldgteyNLLLldsegidaydqtgtystQIFSLAVLLSSMFIYnqmggidesAIDRLSLVTQMTKHIRirasggkttpselgqfsPIFVWLLRDFYLDLvednrkitprDYLEIAlrpvqgsgrdiaAKNEIRDSIralfpdrecftlvrplsnenelqrldqISLDRLRPEFRAGLDALTKFVFertrpkqvgatvltgpVLIGITESYLdainngavptissswQSVEEAECRRAYDSATETYmstfdrskppeevalGEAHEAAVQKALAVYNAGAVGVGLARKKYEGLLQKFFRKAFEDHKKNVYMEADIRCSSAIQSMERKLRAachssdasIDNVVKVLDGLISeyetschgpgkwQKLATFLQQSSEGPILDLVKRLIDQIGSERSSLMLKYRSIEDNMKLLKKQLEDSERYKSEYLKRYDDAINDKKKLADDYTSRINNLqgenislrekSSSLSKTVDSLKNEISDWKRKYDQVLTKQKAMEDQVCSEIEVLKSRSTAAEARLAAAREQALSAQEEVEEWKRKYGVAVREAKAALEKAAIVQERTSKEMQQREDVLREEFSSTLAEKEEEMKEKATKIEHAEQCLTTLRLELKVSFFDIYSNKFYL
MMMKFFgkgkdsspynslqpstspsssrlplnstpvtgparpiRLVYCDEKGKFRMDPEAVAALQLVKEPIGVVSVCGRARQGKSFILNQLLGRSSGFQVASTHRPCTKGLWLWSAPLKRTALDGTEYNLLLLDSEGIDAYDQTGTYSTQIFSLAVLLSSMFIYNQMGGIDESAIDRLSLVTQMTKHIRirasggkttpselgQFSPIFVWLLRDFYLDLVEDNRKITPRDYLEialrpvqgsgrdiaAKNEIRDSIRALFPDRECFTlvrplsnenelqrldqislDRLRPEFRAGLDALTKfvfertrpkqvgatvltgpvLIGITESYLDAINNGAVPtissswqsvEEAECRRAYDSATETYMSTFDRSKPPEEVALGEAHEAAVQKALAVYNAGAVGVGLARKKYEGLLQKFFRKAFEDHKKNVYMEADIRCSSAIQSMERKLRAachssdasiDNVVKVLDGLISEYETSCHGPGKWQKLATFLQQSSEGPILDLVKRLIDQIGSERSSLMLKYRSIEDNMKLLKKQLEDSERYKSeylkryddaindKKKLADDYTSRinnlqgenislrekssslsKTVDSLkneisdwkrKYDQVLTKQKAMEDQVCSEIEVLKSRSTAAEARLAAAREQALSAQEEVEEWKRKYGVAVREAKAALEKAAIvqertskemqqredVLREEFSSTLAEKEEEMKEKATKIEHAEQCLTTLRLELKVSFFDIYSNKFYL
MMMKFFGKGKDSSPYnslqpstspsssrlplnstpVTGPARPIRLVYCDEKGKFRMDPEAVAALQLVKEPIGVVSVCGRARQGKSFILNQLLGRSSGFQVASTHRPCTKGLWLWSAPLKRTALDGTEYNLLLLDSEGIDAYDQTGTYSTQIFSLAVLLSSMFIYNQMGGIDESAIDRLSLVTQMTKHIRIRASGGKTTPSELGQFSPIFVWLLRDFYLDLVEDNRKITPRDYLEIALRPVQGSGRDIAAKNEIRDSIRALFPDRECFTLVRPLSNENELQRLDQISLDRLRPEFRAGLDALTKFVFERTRPKQVGATVLTGPVLIGITESYLDAINNGAVPTISSSWQSVEEAECRRAYDSATETYMSTFDRSKPPEEVALGEAHEAAVQKALAVYNAGAVGVGLARKKYEGLLQKFFRKAFEDHKKNVYMEADIRCSSAIQSMERKLRAACHSSDASIDNVVKVLDGLISEYETSCHGPGKWQKLATFLQQSSEGPILDLVKRLIDQIGSERSSLMLKYRSIEDNMKLLKKQLEDSERYKSEYLKRYDDAINDKKKLADDYTSRINNLQGENISLREKSSSLSKTVDSLKNEISDWKRKYDQVLTKQKAMEDQVCSEIEVLKSRSTaaearlaaareqalsaqeeVEEWKRKYGVAVREAKAALEKAAIVQERTSKEMQQREDVLREEFSSTLAekeeemkekatkieHAEQCLTTLRLELKVSFFDIYSNKFYL
*****************************************PIRLVYCDEKGKFRMDPEAVAALQLVKEPIGVVSVCGRARQGKSFILNQLLGRSSGFQVASTHRPCTKGLWLWSAPLKRTALDGTEYNLLLLDSEGIDAYDQTGTYSTQIFSLAVLLSSMFIYNQMGGIDESAIDRLSLVTQMTKHIRIRASGG****SELGQFSPIFVWLLRDFYLDLVEDNRKITPRDYLEIALRPVQGSGRDIAAKNEIRDSIRALFPDRECFTLVRPLSNENELQRLDQISLDRLRPEFRAGLDALTKFVFERTRPKQVGATVLTGPVLIGITESYLDAINNGAVPTISSSWQSV**********************************HEAAVQKALAVYNAGAVGVGLARKKYEGLLQKFFRKAFEDHKKNVYMEADIRCSSAIQSMERKLRAACHSSDASIDNVVKVLDGLISEYETSCHGPGKWQKLATFLQQSSEGPILDLVKRLIDQIGSE**SLMLKYR********************************************************************************************************************************WKRKYGVAVRE*************************************************HAEQCLTTLRLELKVSFFDIYSNKFY*
******************************************IRLVYCDEKGKFRMDPEAVAALQLVKEPIGVVSVCGRARQGKSFILNQLL**************CTKGLWLWSAPLKRTALDGTEYNLLLLDSEGIDAYDQTGTYSTQIFSLAVLLSSMFIYNQMGGIDESAIDRLSLVTQMTKHI**************GQFSPIFVWLLRDFYLDLVEDNRKITPRDYLEIALR*************EIRDSIRALFPDRECFTLVRPLSNENELQRLDQISLDRLRPEFRAGLDALTKFVFERTRPKQVGATVLTGPVLIGITESYLDAINNGAVPTISSSWQSVEEAECRRAYDSATETYMSTFDRSKPPEEVALGEAHEAAVQKALAVYNAGAVGVGLARKKYEGLLQKFFRKAFEDHKKNVYMEADIRCSSA********************NVVKVLDGLISE**********WQKLATFLQQSSEGPILDLVKRLIDQIGS*********************************************************************************************************************************************************************************************************************************
***********************************VTGPARPIRLVYCDEKGKFRMDPEAVAALQLVKEPIGVVSVCGRARQGKSFILNQLLGRSSGFQVASTHRPCTKGLWLWSAPLKRTALDGTEYNLLLLDSEGIDAYDQTGTYSTQIFSLAVLLSSMFIYNQMGGIDESAIDRLSLVTQMTKHIRIRASGGKTTPSELGQFSPIFVWLLRDFYLDLVEDNRKITPRDYLEIALRPVQGSGRDIAAKNEIRDSIRALFPDRECFTLVRPLSNENELQRLDQISLDRLRPEFRAGLDALTKFVFERTRPKQVGATVLTGPVLIGITESYLDAINNGAVPTIS************RAYDSATETYMSTFDRSKPPEEVALGEAHEAAVQKALAVYNAGAVGVGLARKKYEGLLQKFFRKAFEDHKKNVYMEADIRCSSAIQSMERKLRAACHSSDASIDNVVKVLDGLISEYETSCHGPGKWQKLATFLQQSSEGPILDLVKRLIDQIGSERSSLMLKYRSIEDNMKLLKKQLEDSERYKSEYLKRYDDAINDKKKLADDYTSRINNLQGENISLR*************KNEISDWKRKYDQVLTKQKAMEDQVCSEIEVLKSRSTA**********************KRKYGVAVREAKAALEKAAIVQER*************EEFSSTL************KIEHAEQCLTTLRLELKVSFFDIYSNKFYL
************************************TGPARPIRLVYCDEKGKFRMDPEAVAALQLVKEPIGVVSVCGRARQGKSFILNQLLGRSSGFQVASTHRPCTKGLWLWSAPLKRTALDGTEYNLLLLDSEGIDAYDQTGTYSTQIFSLAVLLSSMFIYNQMGGIDESAIDRLSLVTQMTKHIRIRAS**KTTPSELGQFSPIFVWLLRDFYLDLVEDNRKITPRDYLEIALRPVQGSGRDIAAKNEIRDSIRALFPDRECFTLVRPLSNENELQRLDQISLDRLRPEFRAGLDALTKFVFERTRPKQVGATVLTGPVLIGITESYLDAINNGAVPTISSSWQSVEEAECRRAYDSATETYMSTFDRSKPPEEVALGEAHEAAVQKALAVYNAGAVGVGLARKKYEGLLQKFFRKAFEDHKKNVYMEADIRCSSAIQSMERKLRAACHSSDASIDNVVKVLDGLISEYETSCHGPGKWQKLATFLQQSSEGPILDLVKRLIDQIGSERSSLMLKYRSIEDNMKLLKKQLEDSERYKSEYLKRYDDAINDKKKLADDYTSRINNLQGENISLREKSSSLSKTVDSLKNEISDWKRKYDQVLTKQKAMEDQVCSEIEVLKSRSTAAEARLAAARE*ALSAQEEVEEWKRKYGVAVREAKAALEKAAIVQERTSKEMQQREDVLREEFSSTLAEKEEEMKEKATKIEHAEQCLTTLRLELKVSFFDIYSNKFYL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMMKFFGKGKDSSPYNSLQPSTSPSSSRLPLNSTPVTGPARPIRLVYCDEKGKFRMDPEAVAALQLVKEPIGVVSVCGRARQGKSFILNQLLGRSSGFQVASTHRPCTKGLWLWSAPLKRTALDGTEYNLLLLDSEGIDAYDQTGTYSTQIFSLAVLLSSMFIYNQMGGIDESAIDRLSLVTQMTKHIRIRASGGKTTPSELGQFSPIFVWLLRDFYLDLVEDNRKITPRDYLEIALRPVQGSGRDIAAKNEIRDSIRALFPDRECFTLVRPLSNENELQRLDQISLDRLRPEFRAGLDALTKFVFERTRPKQVGATVLTGPVLIGITESYLDAINNGAVPTISSSWQSVEEAECRRAYDSATETYMSTFDRSKPPEEVALGEAHEAAVQKALAVYNAGAVGVGLARKKYEGLLQKFFRKAFEDHKKNVYMEADIRCSSAIQSMERKLRAACHSSDASIDNVVKVLDGLISEYETSCHGPGKWQKLATFLQQSSEGPILDLVKRLIDQIGSExxxxxxxxxxxxxxxxxxxxxxxxxxxxKSEYLKRYDDAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQKAMEDQVCSExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxYGVAVREAKAALEKAAIVQERTSKEMQQREDVLxxxxxxxxxxxxxxxxxxxxxxxxxxxxLTTLRLELKVSFFDIYSNKFYL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query736 2.2.26 [Sep-21-2011]
Q61107620 Guanylate-binding protein no no 0.475 0.564 0.330 6e-52
Q9H0R5595 Guanylate-binding protein yes no 0.627 0.776 0.304 1e-51
P32456591 Interferon-induced guanyl no no 0.433 0.539 0.333 2e-51
P32455592 Interferon-induced guanyl no no 0.736 0.915 0.285 3e-51
Q8N8V2638 Guanylate-binding protein no no 0.460 0.531 0.326 6e-51
Q5R9T9633 Guanylate-binding protein yes no 0.482 0.560 0.318 7e-51
Q5D1D6590 Interferon-induced guanyl N/A no 0.740 0.923 0.28 9e-51
Q5RBE1592 Interferon-induced guanyl no no 0.736 0.915 0.285 1e-50
Q6ZN66633 Guanylate-binding protein no no 0.480 0.559 0.323 2e-50
Q01514589 Interferon-induced guanyl no no 0.476 0.595 0.326 6e-50
>sp|Q61107|GBP4_MOUSE Guanylate-binding protein 4 OS=Mus musculus GN=Gbp4 PE=1 SV=1 Back     alignment and function desciption
 Score =  206 bits (524), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 120/363 (33%), Positives = 203/363 (55%), Gaps = 13/363 (3%)

Query: 42  PIRLVYCDEKGKFRMDPEAVAALQLVKEPIGVVSVCGRARQGKSFILNQLLGRSSGFQVA 101
           PI LV  + K +  ++ EA+  L+ + +P+ VV++ G  R GKS+++N+L GR+ GF + 
Sbjct: 4   PICLVE-NWKNQLTVNLEAIRILEQIAQPLVVVAIVGLYRTGKSYLMNRLAGRNHGFSLG 62

Query: 102 STHRPCTKGLWLWSAPLKRTALDGTEYNLLLLDSEGI-DAYDQTGTYSTQIFSLAVLLSS 160
           ST +  TKG+W+W  P          + L+LLD+EG+ D         + IF+LAVLLSS
Sbjct: 63  STVQSETKGIWMWCVPHPTKPT----HTLVLLDTEGLGDVEKGDPKNDSWIFALAVLLSS 118

Query: 161 MFIYNQMGGIDESAIDRLSLVTQMTKHIRIRASGGKTT---PSELGQFSPIFVWLLRDFY 217
            F+YN M  I++ A+++L  VT++T+ IR ++S  +      SE   F P F+W +RDF 
Sbjct: 119 TFVYNSMSTINQQALEQLHFVTELTQLIRAKSSPREDKVKDSSEFVGFFPDFIWAVRDFA 178

Query: 218 LDLVEDNRKITPRDYLEIALRPVQGSGRDIAAKNEIRDSIRALFPDRECFTLVRPLSNEN 277
           L+L  + R IT  +YLE AL+ +QG    +   N  R+ IR  FP R+CF   RP S++ 
Sbjct: 179 LELKLNGRPITEDEYLENALKLIQGDNLKVQQSNMTRECIRYFFPVRKCFVFDRPTSDKR 238

Query: 278 ELQRLDQISLDRLRPEFRAGLDALTKFVFERTRPKQV-GATVLTGPVLIGITESYLDAIN 336
            L +++ +  ++L   F+   +    ++F   + K + G  ++TG  L  + ++Y++AIN
Sbjct: 239 LLLQIENVPENQLERNFQVESEKFCSYIFTNGKTKTLRGGVIVTGNRLGTLVQTYVNAIN 298

Query: 337 NGAVPTISSSWQSVEEAECRRAYDSATETYMSTF-DRSKPPEEV--ALGEAHEAAVQKAL 393
           +G VP + ++  ++ + E   A   A + Y      R + P +    L   H A  ++A+
Sbjct: 299 SGTVPCLENAVTTLAQRENSIAVQKAADHYSEQMAQRMRLPTDTLQELLTVHAACEKEAI 358

Query: 394 AVY 396
           AV+
Sbjct: 359 AVF 361




Binds GTP, GDP and GMP. Hydrolyzes GTP very efficiently; GDP rather than GMP is the major reaction product. Plays a role in erythroid differentiation.
Mus musculus (taxid: 10090)
>sp|Q9H0R5|GBP3_HUMAN Guanylate-binding protein 3 OS=Homo sapiens GN=GBP3 PE=2 SV=3 Back     alignment and function description
>sp|P32456|GBP2_HUMAN Interferon-induced guanylate-binding protein 2 OS=Homo sapiens GN=GBP2 PE=1 SV=3 Back     alignment and function description
>sp|P32455|GBP1_HUMAN Interferon-induced guanylate-binding protein 1 OS=Homo sapiens GN=GBP1 PE=1 SV=2 Back     alignment and function description
>sp|Q8N8V2|GBP7_HUMAN Guanylate-binding protein 7 OS=Homo sapiens GN=GBP7 PE=2 SV=2 Back     alignment and function description
>sp|Q5R9T9|GBP6_PONAB Guanylate-binding protein 6 OS=Pongo abelii GN=GBP6 PE=2 SV=1 Back     alignment and function description
>sp|Q5D1D6|GBP1_CHLAE Interferon-induced guanylate-binding protein 1 OS=Chlorocebus aethiops GN=GBP1 PE=2 SV=1 Back     alignment and function description
>sp|Q5RBE1|GBP1_PONAB Interferon-induced guanylate-binding protein 1 OS=Pongo abelii GN=GBP1 PE=2 SV=1 Back     alignment and function description
>sp|Q6ZN66|GBP6_HUMAN Guanylate-binding protein 6 OS=Homo sapiens GN=GBP6 PE=2 SV=1 Back     alignment and function description
>sp|Q01514|GBP1_MOUSE Interferon-induced guanylate-binding protein 1 OS=Mus musculus GN=Gbp1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query736
224077052 1070 predicted protein [Populus trichocarpa] 0.937 0.644 0.811 0.0
255536707 1065 interferon-induced guanylate-binding pro 0.978 0.676 0.773 0.0
356548658 1060 PREDICTED: uncharacterized protein LOC10 0.991 0.688 0.764 0.0
356521418 1060 PREDICTED: uncharacterized protein LOC10 0.991 0.688 0.763 0.0
145358912 1082 Guanylate-binding protein [Arabidopsis t 0.983 0.669 0.744 0.0
449433796 1062 PREDICTED: uncharacterized protein LOC10 0.975 0.676 0.776 0.0
356546617 1059 PREDICTED: uncharacterized protein LOC10 0.971 0.675 0.764 0.0
9757727 1060 unnamed protein product [Arabidopsis tha 0.953 0.662 0.715 0.0
222632561 1062 hypothetical protein OsJ_19548 [Oryza sa 0.918 0.636 0.688 0.0
242091367 1051 hypothetical protein SORBIDRAFT_09g02844 0.953 0.667 0.647 0.0
>gi|224077052|ref|XP_002305110.1| predicted protein [Populus trichocarpa] gi|222848074|gb|EEE85621.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 1185 bits (3065), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 560/690 (81%), Positives = 629/690 (91%)

Query: 36  VTGPARPIRLVYCDEKGKFRMDPEAVAALQLVKEPIGVVSVCGRARQGKSFILNQLLGRS 95
           VTGPARPIRLVY DEKGKFRMD EAVAALQLVKEPIGVVSVCGR+RQGKSFILNQLLGRS
Sbjct: 37  VTGPARPIRLVYYDEKGKFRMDSEAVAALQLVKEPIGVVSVCGRSRQGKSFILNQLLGRS 96

Query: 96  SGFQVASTHRPCTKGLWLWSAPLKRTALDGTEYNLLLLDSEGIDAYDQTGTYSTQIFSLA 155
           SGFQVASTHRPCTKGLWLWSAPLKRTALDGTEYNLLLLDSEGIDA+DQTGTYSTQIFSLA
Sbjct: 97  SGFQVASTHRPCTKGLWLWSAPLKRTALDGTEYNLLLLDSEGIDAFDQTGTYSTQIFSLA 156

Query: 156 VLLSSMFIYNQMGGIDESAIDRLSLVTQMTKHIRIRASGGKTTPSELGQFSPIFVWLLRD 215
           VLLSSMFIYNQMGGIDE+A+DRLSLVTQMTKHIR+RASGG+++ SELGQFSPIFVWLLRD
Sbjct: 157 VLLSSMFIYNQMGGIDEAALDRLSLVTQMTKHIRVRASGGRSSASELGQFSPIFVWLLRD 216

Query: 216 FYLDLVEDNRKITPRDYLEIALRPVQGSGRDIAAKNEIRDSIRALFPDRECFTLVRPLSN 275
           FYLDLVEDN++ITPRDYLE+ALRPVQGSG+DIAAKNEIRDSIRALFPDRECF LVRPL+N
Sbjct: 217 FYLDLVEDNKRITPRDYLELALRPVQGSGKDIAAKNEIRDSIRALFPDRECFPLVRPLNN 276

Query: 276 ENELQRLDQISLDRLRPEFRAGLDALTKFVFERTRPKQVGATVLTGPVLIGITESYLDAI 335
           EN+LQR+DQISLD+LRPEFRAGLDALTKFVFERTRPKQVGATV+TGP+L+GITESYL+A+
Sbjct: 277 ENDLQRMDQISLDKLRPEFRAGLDALTKFVFERTRPKQVGATVMTGPILVGITESYLEAL 336

Query: 336 NNGAVPTISSSWQSVEEAECRRAYDSATETYMSTFDRSKPPEEVALGEAHEAAVQKALAV 395
           NNGAVPTISSSWQSVEEAECRRAYD+ATE YMS+FDRSKPPEEV L E+H+ AVQK+LA 
Sbjct: 337 NNGAVPTISSSWQSVEEAECRRAYDTATEIYMSSFDRSKPPEEVFLRESHDEAVQKSLAA 396

Query: 396 YNAGAVGVGLARKKYEGLLQKFFRKAFEDHKKNVYMEADIRCSSAIQSMERKLRAACHSS 455
           +NA AVG+G ARKKYEGLLQKFFR+A ED+K+N +MEAD+RCS+AIQ+ME++LRAACH+S
Sbjct: 397 FNAAAVGIGSARKKYEGLLQKFFRRALEDYKRNAFMEADLRCSNAIQNMEKRLRAACHAS 456

Query: 456 DASIDNVVKVLDGLISEYETSCHGPGKWQKLATFLQQSSEGPILDLVKRLIDQIGSERSS 515
           DA+IDN+VKVLDGL+SEYETSCHGPGKWQKLA FLQQS EG ILDL KRL D+IGSE+SS
Sbjct: 457 DANIDNIVKVLDGLLSEYETSCHGPGKWQKLAMFLQQSLEGSILDLAKRLNDKIGSEKSS 516

Query: 516 LMLKYRSIEDNMKLLKKQLEDSERYKSEYLKRYDDAINDKKKLADDYTSRINNLQGENIS 575
           LML+  S+ED M LL KQLE SE+ KSEY+KRYD+AIN+KKKLADDY  RIN+LQ    S
Sbjct: 517 LMLRCHSMEDKMALLHKQLEASEKDKSEYMKRYDEAINEKKKLADDYMRRINDLQSNRGS 576

Query: 576 LREKSSSLSKTVDSLKNEISDWKRKYDQVLTKQKAMEDQVCSEIEVLKSRSTAAEARLAA 635
           L E+ SSL K ++S K E S+WKRK+DQVL+KQKA E+Q  SEI +LKSRS+A+EARLAA
Sbjct: 577 LDERCSSLVKALESAKQETSNWKRKHDQVLSKQKADEEQAASEIAILKSRSSASEARLAA 636

Query: 636 AREQALSAQEEVEEWKRKYGVAVREAKAALEKAAIVQERTSKEMQQREDVLREEFSSTLA 695
           A EQ  SA+E+  EWKRKY +AVRE KAALEKAA VQERT+KE Q RED LREEFSS L 
Sbjct: 637 AHEQTRSAEEDAAEWKRKYDIAVRETKAALEKAANVQERTNKETQLREDALREEFSSHLV 696

Query: 696 EKEEEMKEKATKIEHAEQCLTTLRLELKVS 725
            KE+E+KEK  +IE+AEQCLT L LELK +
Sbjct: 697 VKEDEIKEKNRRIEYAEQCLTALNLELKAA 726




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255536707|ref|XP_002509420.1| interferon-induced guanylate-binding protein, putative [Ricinus communis] gi|223549319|gb|EEF50807.1| interferon-induced guanylate-binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356548658|ref|XP_003542717.1| PREDICTED: uncharacterized protein LOC100808644 [Glycine max] Back     alignment and taxonomy information
>gi|356521418|ref|XP_003529353.1| PREDICTED: uncharacterized protein LOC100796442 [Glycine max] Back     alignment and taxonomy information
>gi|145358912|ref|NP_199419.2| Guanylate-binding protein [Arabidopsis thaliana] gi|332007951|gb|AED95334.1| Guanylate-binding protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449433796|ref|XP_004134683.1| PREDICTED: uncharacterized protein LOC101220489 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356546617|ref|XP_003541721.1| PREDICTED: uncharacterized protein LOC100776402 [Glycine max] Back     alignment and taxonomy information
>gi|9757727|dbj|BAB08252.1| unnamed protein product [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|222632561|gb|EEE64693.1| hypothetical protein OsJ_19548 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|242091367|ref|XP_002441516.1| hypothetical protein SORBIDRAFT_09g028440 [Sorghum bicolor] gi|241946801|gb|EES19946.1| hypothetical protein SORBIDRAFT_09g028440 [Sorghum bicolor] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query736
TAIR|locus:2161358 1082 AT5G46070 [Arabidopsis thalian 0.983 0.669 0.704 1.3e-274
UNIPROTKB|F1N9J3623 GBP7 "Uncharacterized protein" 0.684 0.808 0.297 5.4e-59
RGD|1561523558 Mpa2l "macrophage activation 2 0.483 0.637 0.351 1.1e-58
ZFIN|ZDB-GENE-070705-98645 si:ch211-209n20.1 "si:ch211-20 0.748 0.854 0.291 4e-58
ZFIN|ZDB-GENE-070912-618630 gbp2 "guanylate binding protei 0.766 0.895 0.270 2.4e-53
UNIPROTKB|F1N1I1629 LOC781225 "Uncharacterized pro 0.744 0.871 0.287 3.8e-53
ZFIN|ZDB-GENE-041210-233618 si:dkey-61p9.3 "si:dkey-61p9.3 0.524 0.624 0.340 8e-53
UNIPROTKB|F6PPP4579 Bt.37579 "Uncharacterized prot 0.740 0.941 0.281 1.4e-52
ZFIN|ZDB-GENE-060531-46618 gbp4 "guanylate binding protei 0.524 0.624 0.338 1.7e-52
UNIPROTKB|Q9H0R5595 GBP3 "Guanylate-binding protei 0.729 0.902 0.283 2.7e-52
TAIR|locus:2161358 AT5G46070 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2640 (934.4 bits), Expect = 1.3e-274, P = 1.3e-274
 Identities = 510/724 (70%), Positives = 587/724 (81%)

Query:     2 MMKFFGKGKDSSPYXXXXXXXXXXXXXXXXXXXXVTGPARPIRLVYCDEKGKFRMDPEAV 61
             M  FFG+G   SP                     VTGP RPIRLVYCDEKGKFRMDPEAV
Sbjct:     1 MRSFFGRGGKDSPADSASPSPRSYPSTSPASSSAVTGPPRPIRLVYCDEKGKFRMDPEAV 60

Query:    62 AALQLVKEPIGVVSVCGRARQGKSFILNQLLGRSSGFQVASTHRPCTKGLWLWSAPLKRT 121
             A LQLVKEPIGVVSVCGRARQGKSFILNQLLGRS+GFQVASTH+PCTKGLWLWS+P+KRT
Sbjct:    61 ATLQLVKEPIGVVSVCGRARQGKSFILNQLLGRSNGFQVASTHKPCTKGLWLWSSPIKRT 120

Query:   122 ALDGTEYNLLLLDSEGIDAYDQTGTYSTQIFSLAVLLSSMFIYNQMGGIDESAIDRLSLV 181
             ALDGTEYNLLLLDSEGIDAYDQTGTYSTQIFSLAVLLSSMF+YNQMGGIDE+++DRLSLV
Sbjct:   121 ALDGTEYNLLLLDSEGIDAYDQTGTYSTQIFSLAVLLSSMFVYNQMGGIDEASLDRLSLV 180

Query:   182 TQMTKHIRIRASGGKTTPSELGQFSPIFVWLLRDFYLDLVEDNRKITPRDYLEIALRPVQ 241
             TQMTKHIR++ASGG ++ SELGQFSPIFVWLLRDFYLDLVEDNRKI+PRDYLEIALRPVQ
Sbjct:   181 TQMTKHIRVKASGGTSSRSELGQFSPIFVWLLRDFYLDLVEDNRKISPRDYLEIALRPVQ 240

Query:   242 GSGRDIAAKNEIRDSIRALFPDRECFTLVRPLSNENELQRLDQISLDRLRPEFRAGLDAL 301
             GSG DI AKNEIRDSIRALFPDRECFTLVRPL+NE +LQRLDQISL++LRPEF AGLDA 
Sbjct:   241 GSGGDIGAKNEIRDSIRALFPDRECFTLVRPLNNEKDLQRLDQISLEKLRPEFGAGLDAF 300

Query:   302 TKFVFERTRPKQVGATVLTGPVLIGITESYLDAINNGAVPTISSSWQSVEEAECRRAYDS 361
             TKFVFE+TRPKQ+G TV+TGP+L+GIT+SYLDA+NNGAVPTI+SSWQSVEE ECRRAYDS
Sbjct:   301 TKFVFEKTRPKQLGGTVMTGPILVGITQSYLDALNNGAVPTITSSWQSVEETECRRAYDS 360

Query:   362 ATETYMSTFDRSKPPEEVALGEAHEAAVQKALAVYNAGAVGVGLARKKYEGLLQKFFRKA 421
               E YM+ FD+SK PEE AL E HE AV+KALA++N+ AVG G ARKK+E LL K  +K 
Sbjct:   361 GVEAYMAAFDQSKAPEEGALREEHEEAVRKALAIFNSNAVGNGSARKKFEDLLHKDLKKK 420

Query:   422 FEDHKKNVYMEADIRCSSAIQSMERKLRAACHSSDASIDNVVKVLDGLISEYETSCHGPG 481
             FED+KKN +MEAD+RC+S IQ ME++LRAACH+S+A++DNVVKVL+  ++EYE SCHGPG
Sbjct:   421 FEDYKKNAFMEADLRCTSTIQRMEKQLRAACHASNANMDNVVKVLEARLAEYEASCHGPG 480

Query:   482 KWQKLATFLQQSSEGPILDLVKRLIDQIGSERSSLMLKYRSIEDNMKLLKKQLEDSERYK 541
             KWQKL+ FLQQS EGPI DL KRLID I  E++SL +K+RS+ED MK LK+QL+DSERYK
Sbjct:   481 KWQKLSVFLQQSLEGPIYDLTKRLIDSIAIEKNSLAMKFRSVEDAMKHLKQQLDDSERYK 540

Query:   542 SEYLKRYDDAINDKKKLADDYTSRINNLQGENISLREKSSSLSKTVDSLKNEISDWKRKY 601
              EY KRYD++ NDKKKL D Y  RI  LQGEN SL E+ S+L KTV+S K EI +W R Y
Sbjct:   541 LEYQKRYDESNNDKKKLEDIYRERITKLQGENSSLNERCSTLVKTVESKKEEIKEWIRNY 600

Query:   602 DQVLTKQKAMEDQVCSEIEVLKSRSTXXXXXXXXXXXXXXXXXXXVEEWKRKYGVAVREA 661
             DQ++ KQKA+++Q+ SE+EVL++RST                    +EWKRKY  AV EA
Sbjct:   601 DQIVLKQKAVQEQLSSEMEVLRTRSTTSEARVAAAREQAKSAAEETKEWKRKYDYAVGEA 660

Query:   662 KAALEKAAIVQERTSKEMQQREDVLREEFSSTLAXXXXXXXXXXXXXXHAEQCLTTLRLE 721
             ++AL+KAA VQER+ KE Q RED LREEFS TLA               AEQ LT LR +
Sbjct:   661 RSALQKAASVQERSGKETQLREDALREEFSITLANKDEEITEKATKLEKAEQSLTVLRSD 720

Query:   722 LKVS 725
             LKV+
Sbjct:   721 LKVA 724




GO:0003924 "GTPase activity" evidence=IEA;ISS
GO:0005525 "GTP binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006955 "immune response" evidence=ISS
GO:0009507 "chloroplast" evidence=IDA
GO:0005730 "nucleolus" evidence=IDA
GO:0000226 "microtubule cytoskeleton organization" evidence=RCA
GO:0000911 "cytokinesis by cell plate formation" evidence=RCA
UNIPROTKB|F1N9J3 GBP7 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1561523 Mpa2l "macrophage activation 2 like" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070705-98 si:ch211-209n20.1 "si:ch211-209n20.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070912-618 gbp2 "guanylate binding protein 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1N1I1 LOC781225 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041210-233 si:dkey-61p9.3 "si:dkey-61p9.3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F6PPP4 Bt.37579 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060531-46 gbp4 "guanylate binding protein 4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H0R5 GBP3 "Guanylate-binding protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.5LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00040459
hypothetical protein (1070 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query736
cd01851224 cd01851, GBP, Guanylate-binding protein (GBP) fami 3e-63
pfam02263264 pfam02263, GBP, Guanylate-binding protein, N-termi 2e-62
pfam02841297 pfam02841, GBP_C, Guanylate-binding protein, C-ter 2e-28
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-10
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-09
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 5e-08
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 2e-07
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 6e-07
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 1e-06
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 2e-06
PRK03918 880 PRK03918, PRK03918, chromosome segregation protein 2e-06
PRK03918 880 PRK03918, PRK03918, chromosome segregation protein 3e-06
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 5e-06
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-05
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 2e-05
TIGR03319 514 TIGR03319, RNase_Y, ribonuclease Y 2e-05
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 3e-05
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 3e-05
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 4e-05
PRK12704 520 PRK12704, PRK12704, phosphodiesterase; Provisional 4e-05
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 1e-04
COG1579239 COG1579, COG1579, Zn-ribbon protein, possibly nucl 1e-04
PHA02562 562 PHA02562, 46, endonuclease subunit; Provisional 2e-04
pfam01576 859 pfam01576, Myosin_tail_1, Myosin tail 4e-04
PRK01156895 PRK01156, PRK01156, chromosome segregation protein 4e-04
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 5e-04
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.001
pfam02841297 pfam02841, GBP_C, Guanylate-binding protein, C-ter 0.002
pfam08764282 pfam08764, Coagulase, Staphylococcus aureus coagul 0.002
pfam09726 680 pfam09726, Macoilin, Transmembrane protein 0.002
PRK12704 520 PRK12704, PRK12704, phosphodiesterase; Provisional 0.003
TIGR01843423 TIGR01843, type_I_hlyD, type I secretion membrane 0.004
pfam05483787 pfam05483, SCP-1, Synaptonemal complex protein 1 ( 0.004
>gnl|CDD|206650 cd01851, GBP, Guanylate-binding protein (GBP) family (N-terminal domain) Back     alignment and domain information
 Score =  209 bits (535), Expect = 3e-63
 Identities = 81/245 (33%), Positives = 112/245 (45%), Gaps = 22/245 (8%)

Query: 65  QLVKEPIGVVSVCGRARQGKSFILNQLLGRSSGFQVASTHRPCTKGLWLWSAPLKRTALD 124
             V  P+ VVSV G    GKSF+LN L G S GF V  T +  TKG+W+WS P K T  D
Sbjct: 1   LDVGFPVVVVSVFGSQSSGKSFLLNHLFGTSDGFDVMDTSQQTTKGIWMWSDPFKDT--D 58

Query: 125 GTEYNLLLLDSEGIDAYDQT-GTYSTQIFSLAVLLSSMFIYNQMGGIDESAIDRLSLVTQ 183
           G ++ +LLLD+EG D  ++       ++F+LA LLSS+ IYN    I    +D+L  + +
Sbjct: 59  GKKHAVLLLDTEGTDGRERGEFENDARLFALATLLSSVLIYNMWQTILGDDLDKLMGLLK 118

Query: 184 MTKHIRIRASGGKTTPSELGQFSPIFVWLLRDFYLDLVEDNRKITPRDYLEIALRPVQGS 243
                    + G        +  P+ ++++RDF      +   +T            + S
Sbjct: 119 TAL-----ETLGLAGLHNFSKPKPLLLFVVRDFTGPTPLEGLDVT------------EKS 161

Query: 244 GRDIAAKNEIRDSIRALFPDRECFTLVRPLSNENELQRLDQISLDRLRPEFRAGLDALTK 303
              I   N+I  SIR  F    CF L  P      LQ      L  L PEFR  L AL +
Sbjct: 162 ETLIEELNKIWSSIRKPFTPITCFVLPHPGLLHKLLQN--DGRLKDLPPEFRKALKALRQ 219

Query: 304 FVFER 308
             F  
Sbjct: 220 RFFSS 224


Guanylate-binding protein (GBP), N-terminal domain. Guanylate-binding proteins (GBPs) define a group of proteins that are synthesized after activation of the cell by interferons. The biochemical properties of GBPs are clearly different from those of Ras-like and heterotrimeric GTP-binding proteins. They bind guanine nucleotides with low affinity (micromolar range), are stable in their absence and have a high turnover GTPase. In addition to binding GDP/GTP, they have the unique ability to bind GMP with equal affinity and hydrolyze GTP not only to GDP, but also to GMP. Furthermore, two unique regions around the base and the phosphate-binding areas, the guanine and the phosphate caps, respectively, give the nucleotide-binding site a unique appearance not found in the canonical GTP-binding proteins. The phosphate cap, which constitutes the region analogous to switch I, completely shields the phosphate-binding site from solvent such that a potential GTPase-activating protein (GAP) cannot approach. Length = 224

>gnl|CDD|111185 pfam02263, GBP, Guanylate-binding protein, N-terminal domain Back     alignment and domain information
>gnl|CDD|202427 pfam02841, GBP_C, Guanylate-binding protein, C-terminal domain Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>gnl|CDD|222878 PHA02562, 46, endonuclease subunit; Provisional Back     alignment and domain information
>gnl|CDD|144972 pfam01576, Myosin_tail_1, Myosin tail Back     alignment and domain information
>gnl|CDD|100796 PRK01156, PRK01156, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|202427 pfam02841, GBP_C, Guanylate-binding protein, C-terminal domain Back     alignment and domain information
>gnl|CDD|204055 pfam08764, Coagulase, Staphylococcus aureus coagulase Back     alignment and domain information
>gnl|CDD|220365 pfam09726, Macoilin, Transmembrane protein Back     alignment and domain information
>gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional Back     alignment and domain information
>gnl|CDD|130902 TIGR01843, type_I_hlyD, type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>gnl|CDD|114219 pfam05483, SCP-1, Synaptonemal complex protein 1 (SCP-1) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 736
PF02263260 GBP: Guanylate-binding protein, N-terminal domain; 100.0
KOG2037552 consensus Guanylate-binding protein [General funct 100.0
cd01851224 GBP Guanylate-binding protein (GBP), N-terminal do 100.0
PF02841297 GBP_C: Guanylate-binding protein, C-terminal domai 100.0
KOG2037552 consensus Guanylate-binding protein [General funct 99.97
PF05879742 RHD3: Root hair defective 3 GTP-binding protein (R 99.96
KOG2203772 consensus GTP-binding protein [General function pr 99.95
KOG09941758 consensus Extracellular matrix glycoprotein Lamini 99.31
PF00038312 Filament: Intermediate filament protein; InterPro: 99.01
KOG4181491 consensus Uncharacterized conserved protein [Funct 98.86
TIGR02168 1179 SMC_prok_B chromosome segregation protein SMC, com 98.41
TIGR02169 1164 SMC_prok_A chromosome segregation protein SMC, pri 98.38
PF00038312 Filament: Intermediate filament protein; InterPro: 98.34
COG1159298 Era GTPase [General function prediction only] 98.28
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 98.25
PHA02562562 46 endonuclease subunit; Provisional 98.25
KOG09941758 consensus Extracellular matrix glycoprotein Lamini 98.25
KOG0977 546 consensus Nuclear envelope protein lamin, intermed 98.23
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 98.2
TIGR02168 1179 SMC_prok_B chromosome segregation protein SMC, com 98.2
PRK04778569 septation ring formation regulator EzrA; Provision 98.19
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 98.19
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 98.18
TIGR02169 1164 SMC_prok_A chromosome segregation protein SMC, pri 98.16
KOG4674 1822 consensus Uncharacterized conserved coiled-coil pr 98.12
PF04548212 AIG1: AIG1 family; InterPro: IPR006703 This entry 98.11
PRK02224 880 chromosome segregation protein; Provisional 98.11
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 98.08
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 98.08
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 98.06
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-env 98.04
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 98.01
PF07888546 CALCOCO1: Calcium binding and coiled-coil domain ( 98.01
TIGR00993763 3a0901s04IAP86 chloroplast protein import componen 97.99
PF06160560 EzrA: Septation ring formation regulator, EzrA ; I 97.99
PRK02224 880 chromosome segregation protein; Provisional 97.98
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 97.98
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 97.98
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 97.93
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 97.9
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 97.89
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 97.89
PF05010207 TACC: Transforming acidic coiled-coil-containing p 97.88
PHA02562 562 46 endonuclease subunit; Provisional 97.88
KOG0963 629 consensus Transcription factor/CCAAT displacement 97.84
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 97.81
PRK00089292 era GTPase Era; Reviewed 97.79
PF00350168 Dynamin_N: Dynamin family; InterPro: IPR001401 Mem 97.77
PRK11637 428 AmiB activator; Provisional 97.76
PRK04863 1486 mukB cell division protein MukB; Provisional 97.76
PF13851201 GAS: Growth-arrest specific micro-tubule binding 97.75
KOG0995581 consensus Centromere-associated protein HEC1 [Cell 97.74
PRK03918 880 chromosome segregation protein; Provisional 97.72
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 97.69
KOG1853 333 consensus LIS1-interacting protein NUDE [Cytoskele 97.64
KOG0971 1243 consensus Microtubule-associated protein dynactin 97.64
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 97.64
KOG0996 1293 consensus Structural maintenance of chromosome pro 97.64
PF10174 775 Cast: RIM-binding protein of the cytomatrix active 97.63
TIGR00436270 era GTP-binding protein Era. Era is an essential G 97.62
PF10174 775 Cast: RIM-binding protein of the cytomatrix active 97.61
PRK04863 1486 mukB cell division protein MukB; Provisional 97.6
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 97.6
PRK10698222 phage shock protein PspA; Provisional 97.59
COG4942 420 Membrane-bound metallopeptidase [Cell division and 97.57
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 97.57
KOG0980 980 consensus Actin-binding protein SLA2/Huntingtin-in 97.57
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 97.56
PF02841297 GBP_C: Guanylate-binding protein, C-terminal domai 97.56
PF10220 895 DUF2146: Uncharacterized conserved protein (DUF214 97.55
KOG4674 1822 consensus Uncharacterized conserved coiled-coil pr 97.54
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 97.54
PF05010207 TACC: Transforming acidic coiled-coil-containing p 97.53
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 97.53
PRK04778569 septation ring formation regulator EzrA; Provision 97.49
KOG0995581 consensus Centromere-associated protein HEC1 [Cell 97.45
KOG1003205 consensus Actin filament-coating protein tropomyos 97.44
TIGR00991313 3a0901s02IAP34 GTP-binding protein (Chloroplast En 97.4
KOG0977 546 consensus Nuclear envelope protein lamin, intermed 97.36
PRK03918 880 chromosome segregation protein; Provisional 97.35
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 97.34
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved fam 97.34
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 97.33
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 97.33
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 97.32
PF13851201 GAS: Growth-arrest specific micro-tubule binding 97.3
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 97.3
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 97.3
TIGR01843 423 type_I_hlyD type I secretion membrane fusion prote 97.28
KOG0980 980 consensus Actin-binding protein SLA2/Huntingtin-in 97.27
cd01878204 HflX HflX subfamily. A distinct conserved domain w 97.21
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 97.21
TIGR02680 1353 conserved hypothetical protein TIGR02680. Members 97.2
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 97.18
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 97.18
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 97.17
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 97.15
TIGR01005 754 eps_transp_fam exopolysaccharide transport protein 97.15
KOG1423379 consensus Ras-like GTPase ERA [Cell cycle control, 97.14
PRK09039 343 hypothetical protein; Validated 97.13
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 97.13
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 97.12
KOG0999 772 consensus Microtubule-associated protein Bicaudal- 97.1
TIGR00231161 small_GTP small GTP-binding protein domain. This m 97.09
PF15066527 CAGE1: Cancer-associated gene protein 1 family 97.08
PRK09039343 hypothetical protein; Validated 97.06
KOG0933 1174 consensus Structural maintenance of chromosome pro 97.05
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 97.04
PRK12289352 GTPase RsgA; Reviewed 97.03
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 97.01
cd04171164 SelB SelB subfamily. SelB is an elongation factor 97.0
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 96.98
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 96.98
KOG0976 1265 consensus Rho/Rac1-interacting serine/threonine ki 96.97
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 96.97
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 96.96
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 96.95
PRK15494339 era GTPase Era; Provisional 96.95
PRK00454196 engB GTP-binding protein YsxC; Reviewed 96.94
PRK12288347 GTPase RsgA; Reviewed 96.92
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 96.92
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 96.91
TIGR02977219 phageshock_pspA phage shock protein A. Members of 96.9
PRK12298390 obgE GTPase CgtA; Reviewed 96.9
COG5185622 HEC1 Protein involved in chromosome segregation, i 96.9
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 96.89
PF05701 522 WEMBL: Weak chloroplast movement under blue light; 96.87
PRK01156 895 chromosome segregation protein; Provisional 96.81
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 96.8
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 96.79
TIGR02836492 spore_IV_A stage IV sporulation protein A. A compa 96.79
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 96.79
KOG0996 1293 consensus Structural maintenance of chromosome pro 96.79
KOG0964 1200 consensus Structural maintenance of chromosome pro 96.78
PF05049376 IIGP: Interferon-inducible GTPase (IIGP); InterPro 96.77
COG1161322 Predicted GTPases [General function prediction onl 96.77
KOG0971 1243 consensus Microtubule-associated protein dynactin 96.75
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 96.75
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 96.75
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 96.75
PF04012221 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T 96.74
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 96.73
COG1084346 Predicted GTPase [General function prediction only 96.73
TIGR03007498 pepcterm_ChnLen polysaccharide chain length determ 96.73
PRK09563287 rbgA GTPase YlqF; Reviewed 96.72
TIGR01005 754 eps_transp_fam exopolysaccharide transport protein 96.7
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 96.7
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 96.69
PF13870177 DUF4201: Domain of unknown function (DUF4201) 96.69
PRK11058426 GTPase HflX; Provisional 96.68
TIGR03017444 EpsF chain length determinant protein EpsF. Sequen 96.67
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 96.67
KOG0964 1200 consensus Structural maintenance of chromosome pro 96.66
cd00154159 Rab Rab family. Rab GTPases form the largest famil 96.65
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 96.62
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 96.62
PF09787 511 Golgin_A5: Golgin subfamily A member 5; InterPro: 96.62
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 96.6
cd01881176 Obg_like The Obg-like subfamily consists of five w 96.6
cd00881189 GTP_translation_factor GTP translation factor fami 96.59
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 96.58
TIGR01843423 type_I_hlyD type I secretion membrane fusion prote 96.58
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 96.58
PRK10698222 phage shock protein PspA; Provisional 96.58
PRK00098298 GTPase RsgA; Reviewed 96.57
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 96.56
TIGR03185650 DNA_S_dndD DNA sulfur modification protein DndD. T 96.56
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 96.56
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 96.55
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 96.53
COG4372 499 Uncharacterized protein conserved in bacteria with 96.52
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 96.52
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 96.52
COG3596296 Predicted GTPase [General function prediction only 96.52
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 96.51
TIGR03017444 EpsF chain length determinant protein EpsF. Sequen 96.51
COG5019373 CDC3 Septin family protein [Cell division and chro 96.51
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 96.5
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 96.5
cd01896233 DRG The developmentally regulated GTP-binding prot 96.5
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 96.5
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 96.47
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 96.46
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 96.46
KOG0946 970 consensus ER-Golgi vesicle-tethering protein p115 96.45
TIGR03007 498 pepcterm_ChnLen polysaccharide chain length determ 96.45
COG1160444 Predicted GTPases [General function prediction onl 96.45
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 96.44
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 96.44
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 96.43
COG1340294 Uncharacterized archaeal coiled-coil protein [Func 96.43
KOG1003205 consensus Actin filament-coating protein tropomyos 96.43
TIGR02680 1353 conserved hypothetical protein TIGR02680. Members 96.42
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 96.42
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 96.41
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 96.4
PF01576 859 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu 96.39
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 96.39
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 96.39
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 96.38
KOG4673 961 consensus Transcription factor TMF, TATA element m 96.37
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 96.37
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 96.37
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 96.37
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 96.36
KOG1899 861 consensus LAR transmembrane tyrosine phosphatase-i 96.34
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 96.33
KOG2655366 consensus Septin family protein (P-loop GTPase) [C 96.32
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 96.31
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 96.31
PRK04213201 GTP-binding protein; Provisional 96.3
KOG0933 1174 consensus Structural maintenance of chromosome pro 96.3
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 96.29
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 96.28
PF00735281 Septin: Septin; InterPro: IPR000038 Septins consti 96.26
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 96.26
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 96.25
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 96.24
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 96.24
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protei 96.24
KOG1547336 consensus Septin CDC10 and related P-loop GTPases 96.24
PRK11281 1113 hypothetical protein; Provisional 96.23
cd00876160 Ras Ras family. The Ras family of the Ras superfam 96.22
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 96.2
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 96.2
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 96.19
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 96.18
PLN03118211 Rab family protein; Provisional 96.17
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 96.17
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 96.16
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 96.15
PRK00093435 GTP-binding protein Der; Reviewed 96.15
PF05483 786 SCP-1: Synaptonemal complex protein 1 (SCP-1); Int 96.13
COG4942 420 Membrane-bound metallopeptidase [Cell division and 96.13
cd04123162 Rab21 Rab21 subfamily. The localization and functi 96.13
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 96.13
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 96.11
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 96.1
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 96.09
COG0486454 ThdF Predicted GTPase [General function prediction 96.09
PF01576 859 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu 96.08
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 96.08
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 96.07
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 96.07
PF14073178 Cep57_CLD: Centrosome localisation domain of Cep57 96.06
PRK10929 1109 putative mechanosensitive channel protein; Provisi 96.06
smart00178184 SAR Sar1p-like members of the Ras-family of small 96.05
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 96.05
TIGR00450442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 96.03
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 96.03
PF09787511 Golgin_A5: Golgin subfamily A member 5; InterPro: 96.01
TIGR01000 457 bacteriocin_acc bacteriocin secretion accessory pr 96.0
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 96.0
PF14073178 Cep57_CLD: Centrosome localisation domain of Cep57 95.99
PF14662193 CCDC155: Coiled-coil region of CCDC155 95.99
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 95.99
PF09730 717 BicD: Microtubule-associated protein Bicaudal-D; I 95.97
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 95.97
PRK01156 895 chromosome segregation protein; Provisional 95.96
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 95.95
PRK12299335 obgE GTPase CgtA; Reviewed 95.94
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 95.94
COG1162301 Predicted GTPases [General function prediction onl 95.93
PRK03003472 GTP-binding protein Der; Reviewed 95.91
PTZ00258390 GTP-binding protein; Provisional 95.91
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 95.9
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 95.9
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 95.88
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 95.88
PRK03003472 GTP-binding protein Der; Reviewed 95.88
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 95.87
PRK00093435 GTP-binding protein Der; Reviewed 95.85
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 95.85
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 95.85
PF09730717 BicD: Microtubule-associated protein Bicaudal-D; I 95.84
KOG0448749 consensus Mitofusin 1 GTPase, involved in mitochon 95.83
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 95.81
PLN03110216 Rab GTPase; Provisional 95.79
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 95.79
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 95.77
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Tr 95.73
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 95.73
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 95.72
TIGR01000 457 bacteriocin_acc bacteriocin secretion accessory pr 95.69
PF05911 769 DUF869: Plant protein of unknown function (DUF869) 95.69
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 95.68
COG4477570 EzrA Negative regulator of septation ring formatio 95.65
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 95.65
COG1136226 SalX ABC-type antimicrobial peptide transport syst 95.64
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 95.64
TIGR03597360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 95.63
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 95.61
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 95.59
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 95.59
CHL00189742 infB translation initiation factor 2; Provisional 95.57
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 95.56
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 95.56
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 95.53
cd01899318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg 95.52
PRK12296500 obgE GTPase CgtA; Reviewed 95.52
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 95.51
cd01900274 YchF YchF subfamily. YchF is a member of the Obg f 95.51
PRK13796365 GTPase YqeH; Provisional 95.5
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 95.48
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 95.45
COG3206458 GumC Uncharacterized protein involved in exopolysa 95.44
KOG4643 1195 consensus Uncharacterized coiled-coil protein [Fun 95.44
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 95.44
PLN03108210 Rab family protein; Provisional 95.39
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation r 95.39
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of sever 95.39
PLN031881320 kinesin-12 family protein; Provisional 95.38
PRK12297424 obgE GTPase CgtA; Reviewed 95.38
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 95.35
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translo 95.34
KOG0018 1141 consensus Structural maintenance of chromosome pro 95.31
PF06160560 EzrA: Septation ring formation regulator, EzrA ; I 95.28
cd04143247 Rhes_like Rhes_like subfamily. This subfamily incl 95.28
KOG0963 629 consensus Transcription factor/CCAAT displacement 95.27
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 95.24
PRK09601364 GTP-binding protein YchF; Reviewed 95.24
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily co 95.23
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 95.23
PRK09602396 translation-associated GTPase; Reviewed 95.22
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 95.21
PF14915305 CCDC144C: CCDC144C protein coiled-coil region 95.12
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 95.12
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 95.11
COG3096 1480 MukB Uncharacterized protein involved in chromosom 95.08
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 95.08
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 95.07
TIGR01393595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 95.06
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 95.05
KOG0979 1072 consensus Structural maintenance of chromosome pro 95.03
COG1842225 PspA Phage shock protein A (IM30), suppresses sigm 94.98
KOG0018 1141 consensus Structural maintenance of chromosome pro 94.97
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 94.97
KOG2485335 consensus Conserved ATP/GTP binding protein [Gener 94.93
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 94.93
CHL00071409 tufA elongation factor Tu 94.92
KOG1191531 consensus Mitochondrial GTPase [Translation, ribos 94.92
KOG4643 1195 consensus Uncharacterized coiled-coil protein [Fun 94.91
COG4136213 ABC-type uncharacterized transport system, ATPase 94.91
cd04105203 SR_beta Signal recognition particle receptor, beta 94.91
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 94.91
PTZ00369189 Ras-like protein; Provisional 94.88
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 94.85
PRK10869 553 recombination and repair protein; Provisional 94.84
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 94.83
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 94.83
PRK04004586 translation initiation factor IF-2; Validated 94.8
KOG4593 716 consensus Mitotic checkpoint protein MAD1 [Cell cy 94.77
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 94.76
COG4372 499 Uncharacterized protein conserved in bacteria with 94.74
PLN03071219 GTP-binding nuclear protein Ran; Provisional 94.74
PRK10218607 GTP-binding protein; Provisional 94.73
PRK09435332 membrane ATPase/protein kinase; Provisional 94.71
PF05701 522 WEMBL: Weak chloroplast movement under blue light; 94.71
PF09789 319 DUF2353: Uncharacterized coiled-coil protein (DUF2 94.71
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 94.71
TIGR00491590 aIF-2 translation initiation factor aIF-2/yIF-2. T 94.69
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 94.67
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 94.67
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 94.66
PF06785 401 UPF0242: Uncharacterised protein family (UPF0242); 94.65
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 94.63
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 94.63
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 94.61
KOG4593 716 consensus Mitotic checkpoint protein MAD1 [Cell cy 94.6
PF00025175 Arf: ADP-ribosylation factor family The prints ent 94.59
PRK09866741 hypothetical protein; Provisional 94.59
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 94.59
PF14915305 CCDC144C: CCDC144C protein coiled-coil region 94.58
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 94.52
COG1160444 Predicted GTPases [General function prediction onl 94.51
PF09728309 Taxilin: Myosin-like coiled-coil protein; InterPro 94.45
PF09744158 Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; Inte 94.45
PF04880166 NUDE_C: NUDE protein, C-terminal conserved region; 94.39
COG1340294 Uncharacterized archaeal coiled-coil protein [Func 94.38
PRK05433600 GTP-binding protein LepA; Provisional 94.37
COG0218200 Predicted GTPase [General function prediction only 94.35
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 94.34
TIGR01010362 BexC_CtrB_KpsE polysaccharide export inner-membran 94.33
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove 94.32
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 94.26
PTZ00133182 ADP-ribosylation factor; Provisional 94.26
PF04111314 APG6: Autophagy protein Apg6; InterPro: IPR007243 94.24
COG3842352 PotA ABC-type spermidine/putrescine transport syst 94.24
PRK12736394 elongation factor Tu; Reviewed 94.22
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 94.2
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 94.2
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 94.19
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 94.18
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 94.17
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 94.15
PRK12735396 elongation factor Tu; Reviewed 94.13
COG3883265 Uncharacterized protein conserved in bacteria [Fun 94.12
COG1100219 GTPase SAR1 and related small G proteins [General 94.09
TIGR02977219 phageshock_pspA phage shock protein A. Members of 94.07
PF05911769 DUF869: Plant protein of unknown function (DUF869) 94.03
TIGR03185650 DNA_S_dndD DNA sulfur modification protein DndD. T 94.02
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 94.01
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 94.0
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 93.98
KOG0976 1265 consensus Rho/Rac1-interacting serine/threonine ki 93.97
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 93.96
COG2262411 HflX GTPases [General function prediction only] 93.92
PF05557 722 MAD: Mitotic checkpoint protein; InterPro: IPR0086 93.89
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 93.88
PF04012221 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T 93.88
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 93.85
PF00005137 ABC_tran: ABC transporter This structure is on hol 93.81
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 93.77
PF15397258 DUF4618: Domain of unknown function (DUF4618) 93.7
PF10186 302 Atg14: UV radiation resistance protein and autopha 93.68
TIGR00475581 selB selenocysteine-specific elongation factor Sel 93.68
PLN03229762 acetyl-coenzyme A carboxylase carboxyl transferase 93.66
PF06785401 UPF0242: Uncharacterised protein family (UPF0242); 93.64
COG1163365 DRG Predicted GTPase [General function prediction 93.63
PLN02318656 phosphoribulokinase/uridine kinase 93.62
KOG0410410 consensus Predicted GTP binding protein [General f 93.6
TIGR00484689 EF-G translation elongation factor EF-G. After pep 93.57
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 93.47
TIGR00235207 udk uridine kinase. Model contains a number of lon 93.43
PF09789319 DUF2353: Uncharacterized coiled-coil protein (DUF2 93.41
PRK01889356 GTPase RsgA; Reviewed 93.36
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 93.33
PRK05506632 bifunctional sulfate adenylyltransferase subunit 1 93.31
KOG0086214 consensus GTPase Rab4, small G protein superfamily 93.29
PRK12317425 elongation factor 1-alpha; Reviewed 93.27
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 93.26
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 93.24
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 93.21
PLN03126478 Elongation factor Tu; Provisional 93.21
PRK00300205 gmk guanylate kinase; Provisional 93.15
COG1126240 GlnQ ABC-type polar amino acid transport system, A 93.15
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 93.13
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 93.08
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 93.08
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 93.01
COG1842225 PspA Phage shock protein A (IM30), suppresses sigm 93.01
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 93.0
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 92.99
COG5185622 HEC1 Protein involved in chromosome segregation, i 92.99
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 92.97
PRK00049396 elongation factor Tu; Reviewed 92.96
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 92.9
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 92.9
TIGR00487587 IF-2 translation initiation factor IF-2. This mode 92.89
PRK05306787 infB translation initiation factor IF-2; Validated 92.89
PF09755310 DUF2046: Uncharacterized conserved protein H4 (DUF 92.84
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 92.82
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 92.78
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 92.74
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 92.71
KOG0979 1072 consensus Structural maintenance of chromosome pro 92.69
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 92.68
PF1355562 AAA_29: P-loop containing region of AAA domain 92.64
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 92.62
PF09744158 Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; Inte 92.61
TIGR01394594 TypA_BipA GTP-binding protein TypA/BipA. This bact 92.59
TIGR00634563 recN DNA repair protein RecN. All proteins in this 92.57
TIGR00503527 prfC peptide chain release factor 3. This translat 92.52
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 92.5
COG1341398 Predicted GTPase or GTP-binding protein [General f 92.48
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 92.47
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 92.46
COG3172187 NadR Predicted ATPase/kinase involved in NAD metab 92.45
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 92.45
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 92.45
cd03269210 ABC_putative_ATPase This subfamily is involved in 92.44
COG0419 908 SbcC ATPase involved in DNA repair [DNA replicatio 92.44
PRK10512614 selenocysteinyl-tRNA-specific translation factor; 92.43
PRK05124474 cysN sulfate adenylyltransferase subunit 1; Provis 92.42
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 92.42
PLN03127447 Elongation factor Tu; Provisional 92.4
PLN00223181 ADP-ribosylation factor; Provisional 92.39
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 92.33
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high se 92.33
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 92.32
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 92.31
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 92.3
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 92.28
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 92.28
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 92.28
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 92.27
PRK09452375 potA putrescine/spermidine ABC transporter ATPase 92.27
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 92.25
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 92.24
PLN02939 977 transferase, transferring glycosyl groups 92.23
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 92.21
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 92.21
PF13514 1111 AAA_27: AAA domain 92.21
cd03216163 ABC_Carb_Monos_I This family represents the domain 92.21
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 92.21
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 92.2
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 92.2
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 92.2
TIGR00485394 EF-Tu translation elongation factor TU. This align 92.19
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 92.19
>PF02263 GBP: Guanylate-binding protein, N-terminal domain; InterPro: IPR015894 Guanylate-binding protein is a GTPase that is induced by interferon (IFN)-gamma Back     alignment and domain information
Probab=100.00  E-value=2e-65  Score=537.19  Aligned_cols=259  Identities=47%  Similarity=0.868  Sum_probs=227.9

Q ss_pred             CCceeeCHHHHHHhhccCCCEEEEEeeCCCCCChhHHHHHHhCCCCcccccCCCCCccceEEeeccccccccCCCCceEE
Q 004698           51 KGKFRMDPEAVAALQLVKEPIGVVSVCGRARQGKSFILNQLLGRSSGFQVASTHRPCTKGLWLWSAPLKRTALDGTEYNL  130 (736)
Q Consensus        51 ~~~l~l~~eAl~~L~~i~~~v~vVsv~G~~rtGKS~LlN~l~~~~~gF~~~~~~~~~T~Giw~w~~p~~~~~~~g~~~~v  130 (736)
                      +++|.||++|+++|..++.||+||||+|+||||||||||+|+|...||+||++++|||+|||||+.|.    +.|++++|
T Consensus         1 ~~~~~~~~~al~~l~~~~~~v~vvsi~G~~rtGKSfLln~l~~~~~gF~~~~~~~~~T~Giw~w~~~~----~~~~~~~v   76 (260)
T PF02263_consen    1 DNKLELNEEALEILQQIDQPVAVVSIVGPYRTGKSFLLNQLLGPQSGFSWGPTVEPCTKGIWMWSEPL----PDGEKVAV   76 (260)
T ss_dssp             TTEEEE-HHHHHHHCTTTSBEEEEEEEEETTSSHHHHHHHHCCBSSSSESSSCSSST-SCEEEECCE-----TTSTCEEE
T ss_pred             CCeEEECHHHHHHHhcCCCCEEEEEeecCCccchHHHHHHHhcccccccccCCCCCCCcceeeeeccc----ccccceeE
Confidence            47899999999999989999999999999999999999999999999999999999999999999994    45788999


Q ss_pred             EEeecCCCcccC-CCCccchHHHHHhhhccceEEEccCCCCchHHhhhhHHHHHHHHHHHHHhcCCCCCCCcccccCCeE
Q 004698          131 LLLDSEGIDAYD-QTGTYSTQIFSLAVLLSSMFIYNQMGGIDESAIDRLSLVTQMTKHIRIRASGGKTTPSELGQFSPIF  209 (736)
Q Consensus       131 ~llDteG~~~~~-~~~~~d~~IFaLa~LLSS~~IyN~~g~i~e~~l~~L~~v~el~~~i~~k~~~~~~~~~e~~~~~P~f  209 (736)
                      +||||||++++. .+.++|++||+|++||||++|||++|.|++++|++|+++++++++|+++... .....++..+||+|
T Consensus        77 ~llDteG~~~~~~~~~~~d~~if~Ls~LLSS~~IyN~~~~i~~~~l~~L~~~~~l~~~i~~~~~~-~~~~~~~~~~fp~l  155 (260)
T PF02263_consen   77 VLLDTEGLGDVEQSDEKYDAKIFALSMLLSSVLIYNSMGNIDEDDLDQLELFTELAKHIRVKYGD-SADSEDLGKPFPSL  155 (260)
T ss_dssp             EEEEEECBTTTTCCCCHHCHHHHHHHHHH-SEEEEEECSSSSHHHHHCCHHHHHHHHHHHHTHHH-HHHHHCTTTTCEEE
T ss_pred             EEecchhccccccCcccccHHHHHHHHHHhCceeeCCCCccchhHHHHHHHHHHHHHHHHHhccc-ccchhhhcccchHH
Confidence            999999998854 4567899999999999999999999999999999999999999999876321 11223456789999


Q ss_pred             EEEeecccccccccCccCChHHHHHHhhccccCCChhhhhhhHHHHHHHhhCCCCceEeccCCCcChhhhhcccCCCcCC
Q 004698          210 VWLLRDFYLDLVEDNRKITPRDYLEIALRPVQGSGRDIAAKNEIRDSIRALFPDRECFTLVRPLSNENELQRLDQISLDR  289 (736)
Q Consensus       210 ~wlvRDf~l~~~~~g~~~t~~~yLe~~L~~~~g~~~~~~~~n~ir~~i~~~F~~~~cf~l~~P~~~~~~l~~l~~~~~~~  289 (736)
                      +||||||++++..+|+.+|+++||+++|+...|.++.+..+|.+|++|++||++++||+||||+.++..++++++++.++
T Consensus       156 ~wlvRDf~~~~~~~~~~~t~~eyLe~~L~~~~~~~~~~~~~N~iR~~I~~~F~~~~cf~Lp~P~~~~~~l~~l~~l~~~~  235 (260)
T PF02263_consen  156 VWLVRDFSLELEDDGGKITPQEYLEQALKPESGQDEEIQERNKIRECIRSCFPSRDCFTLPHPGSDVDKLQNLDGLSLDD  235 (260)
T ss_dssp             EEEEECE-SCTCCTTECHHHHHHHHHHCCSSTSSSCCCCCHHHHHHHHHHHECCEEEEEEE-SSCCCCC-TCGCCCBGGG
T ss_pred             HHHHhhccchhhhccCCCCHHHHHHHHHhcccchhHHHHHhhHHHHHHHHHCCCCeEEEecCCCchhhhccCcccCChhh
Confidence            99999999998888999999999999999888888888899999999999999999999999999999889999999999


Q ss_pred             CChHHHHHHHHHHHHHhccCCcccc
Q 004698          290 LRPEFRAGLDALTKFVFERTRPKQV  314 (736)
Q Consensus       290 l~~eF~~~l~~l~~~i~~~~~pK~~  314 (736)
                      |+|+|+++++.||++|++...+|++
T Consensus       236 L~~eF~~~l~~l~~~i~~~~~~k~~  260 (260)
T PF02263_consen  236 LDPEFVEQLDELVKYIFSSAKVKTL  260 (260)
T ss_dssp             S-HHHHHHHHHHHHHHHCCT---BE
T ss_pred             CCHHHHHHHHHHHHHHhccCCcccC
Confidence            9999999999999999998888763



GTPases induced by IFN-gamma are key to the protective immunity against microbial and viral pathogens. These GTPases are classified into three groups: the small 47-kd GTPases, the Mx proteins, and the large 65- to 67-kd GTPases. Guanylate-binding proteins (GBP) fall into the last class. In humans, there are seven GBPs (hGBP1-7) []. Structurally, hGBP1 consists of two domains: a compact globular N-terminal domain harbouring the GTPase function, and an alpha-helical finger-like C-terminal domain (IPR003191 from INTERPRO). Human GBP1 is secreted from cells without the need of a leader peptide, and has been shown to exhibit antiviral activity against Vesicular stomatitis virus and Encephalomyocarditis virus, as well as being able to regulate the inhibition of proliferation and invasion of endothelial cells in response to IFN-gamma [].; GO: 0003924 GTPase activity, 0005525 GTP binding; PDB: 3QOF_A 3Q5E_C 3QNU_A 3Q5D_A 1DG3_A 2D4H_A 2B8W_B 2B92_A 2BC9_A 1F5N_A.

>KOG2037 consensus Guanylate-binding protein [General function prediction only] Back     alignment and domain information
>cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain Back     alignment and domain information
>PF02841 GBP_C: Guanylate-binding protein, C-terminal domain; InterPro: IPR003191 Guanylate-binding protein is a GTPase that is induced by interferon (IFN)-gamma Back     alignment and domain information
>KOG2037 consensus Guanylate-binding protein [General function prediction only] Back     alignment and domain information
>PF05879 RHD3: Root hair defective 3 GTP-binding protein (RHD3); InterPro: IPR008803 This family consists of several eukaryotic root hair defective 3 like GTP-binding proteins Back     alignment and domain information
>KOG2203 consensus GTP-binding protein [General function prediction only] Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>KOG4181 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] Back     alignment and domain information
>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains Back     alignment and domain information
>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>PRK10698 phage shock protein PspA; Provisional Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>PF02841 GBP_C: Guanylate-binding protein, C-terminal domain; InterPro: IPR003191 Guanylate-binding protein is a GTPase that is induced by interferon (IFN)-gamma Back     alignment and domain information
>PF10220 DUF2146: Uncharacterized conserved protein (DUF2146); InterPro: IPR019354 Smg8 and Smg9 are two subunits of the Smg-1 complex Back     alignment and domain information
>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] Back     alignment and domain information
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>cd01850 CDC_Septin CDC/Septin Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>KOG1423 consensus Ras-like GTPase ERA [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>PF15066 CAGE1: Cancer-associated gene protein 1 family Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02977 phageshock_pspA phage shock protein A Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>TIGR02836 spore_IV_A stage IV sporulation protein A Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence Back     alignment and domain information
>COG1161 Predicted GTPases [General function prediction only] Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>PF13870 DUF4201: Domain of unknown function (DUF4201) Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>TIGR03017 EpsF chain length determinant protein EpsF Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>PRK10698 phage shock protein PspA; Provisional Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>COG3596 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>TIGR03017 EpsF chain length determinant protein EpsF Back     alignment and domain information
>COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton] Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] Back     alignment and domain information
>KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only] Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>KOG2655 consensus Septin family protein (P-loop GTPase) [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments [] Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>KOG1547 consensus Septin CDC10 and related P-loop GTPases [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PRK11281 hypothetical protein; Provisional Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>PF14073 Cep57_CLD: Centrosome localisation domain of Cep57 Back     alignment and domain information
>PRK10929 putative mechanosensitive channel protein; Provisional Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure Back     alignment and domain information
>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>PF14073 Cep57_CLD: Centrosome localisation domain of Cep57 Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>COG1162 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PTZ00258 GTP-binding protein; Provisional Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>KOG0448 consensus Mitofusin 1 GTPase, involved in mitochondrila biogenesis [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein Back     alignment and domain information
>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>cd01899 Ygr210 Ygr210 subfamily Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>cd01900 YchF YchF subfamily Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>COG3206 GumC Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>cd01885 EF2 EF2 (for archaea and eukarya) Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>PLN03188 kinesin-12 family protein; Provisional Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>PRK09601 GTP-binding protein YchF; Reviewed Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>PRK09602 translation-associated GTPase; Reviewed Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>PF14915 CCDC144C: CCDC144C protein coiled-coil region Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>COG3096 MukB Uncharacterized protein involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>KOG2485 consensus Conserved ATP/GTP binding protein [General function prediction only] Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>KOG1191 consensus Mitochondrial GTPase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] Back     alignment and domain information
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>PRK10869 recombination and repair protein; Provisional Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>PF14915 CCDC144C: CCDC144C protein coiled-coil region Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed Back     alignment and domain information
>PF09744 Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; InterPro: IPR019143 This entry represents the N-terminal 200 residues of a set of proteins conserved from yeasts to humans Back     alignment and domain information
>PF04880 NUDE_C: NUDE protein, C-terminal conserved region; InterPro: IPR006964 This domain represents the C-terminal conserved region of NUDE proteins Back     alignment and domain information
>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family Back     alignment and domain information
>cd04102 RabL3 RabL3 (Rab-like3) subfamily Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>TIGR02977 phageshock_pspA phage shock protein A Back     alignment and domain information
>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>PF15397 DUF4618: Domain of unknown function (DUF4618) Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional Back     alignment and domain information
>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>PLN02318 phosphoribulokinase/uridine kinase Back     alignment and domain information
>KOG0410 consensus Predicted GTP binding protein [General function prediction only] Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>KOG0086 consensus GTPase Rab4, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PF09744 Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; InterPro: IPR019143 This entry represents the N-terminal 200 residues of a set of proteins conserved from yeasts to humans Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN Back     alignment and domain information
>TIGR00503 prfC peptide chain release factor 3 Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>COG1341 Predicted GTPase or GTP-binding protein [General function prediction only] Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>COG3172 NadR Predicted ATPase/kinase involved in NAD metabolism [Coenzyme metabolism] Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PLN02939 transferase, transferring glycosyl groups Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PF13514 AAA_27: AAA domain Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query736
1dg3_A592 Structure Of Human Guanylate Binding Protein-1 In N 5e-52
2b8w_A328 Crystal-Structure Of The N-Terminal Large Gtpase Do 1e-47
3q5e_A447 Crystal Structure Of Human Atlastin-1 (Residues 1-4 5e-11
4idq_A447 Human Atlastin-1 1-446, N440t, Gdpalf4- Length = 44 5e-11
4idn_A457 Human Atlastin-1 1-446, C-his6, Gppnhp Length = 457 5e-11
3qnu_A459 Crystal Structure Of The Cytosolic Domain Of Human 6e-11
4idp_A447 Human Atlastin-1 1-446, N440t, Gppnhp Length = 447 1e-09
3q5d_A447 Crystal Structure Of Human Atlastin-1 (Residues 1-4 1e-09
>pdb|1DG3|A Chain A, Structure Of Human Guanylate Binding Protein-1 In Nucleotide Free Form Length = 592 Back     alignment and structure

Iteration: 1

Score = 202 bits (515), Expect = 5e-52, Method: Compositional matrix adjust. Identities = 171/599 (28%), Positives = 295/599 (49%), Gaps = 57/599 (9%) Query: 36 VTGPARPIRLVYCDEKGKFRMDPEAVAALQLVKEPIGVVSVCGRARQGKSFILNQLLGRS 95 +TGP I + G+ +PEA+ L + +P+ VV++ G R GKS+++N+L G+ Sbjct: 7 MTGPMCLIE----NTNGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKK 62 Query: 96 SGFQVASTHRPCTKGLWLWSAPLKRTALDGTEYNLLLLDSEGI-DAYDQTGTYSTQIFSL 154 GF + ST + TKG+W+W P + + L+LLD+EG+ D + IF+L Sbjct: 63 KGFSLGSTVQSHTKGIWMWCVPHPKKP----GHILVLLDTEGLGDVEKGDNQNDSWIFAL 118 Query: 155 AVLLSSMFIYNQMGGIDESAIDRLSLVTQMTKHIRIRASGGKTT-----PSELGQFSPIF 209 AVLLSS F+YN +G I++ A+D+L VT++T IR ++S + ++ F P F Sbjct: 119 AVLLSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSSPDENENEVEDSADFVSFFPDF 178 Query: 210 VWLLRDFYLDLVEDNRKITPRDYLEIALRPVQGSGRDIAAKNEIRDSIRALFPDRECFTL 269 VW LRDF LDL D + +TP +YL +L+ +G+ + N R IR FP ++CF Sbjct: 179 VWTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFVF 238 Query: 270 VRPLSNENELQRLDQISLDRLRPEFRAGLDALTKFVFERTRPKQV-GATVLTGPVLIGIT 328 RP+ + +L +L+++ + L PEF + ++F ++ K + G + GP L + Sbjct: 239 DRPV-HRRKLAQLEKLQDEELDPEFVQQVADFCSYIFSNSKTKTLSGGIQVNGPRLESLV 297 Query: 329 ESYLDAINNGAVPTISSSWQSVEEAECRRAYDSATETYMSTFDRSK--PPEEVA-LGEAH 385 +Y++AI++G +P + ++ ++ + E A A Y + P E + L + H Sbjct: 298 LTYVNAISSGDLPCMENAVLALAQIENSAAVQKAIAHYEQQMGQKVQLPTESLQELLDLH 357 Query: 386 EAAVQKALAVYNAGAVGVGLARKKYEGLLQKFFRKAFEDH-----KKNVYMEADIRCSSA 440 + ++A+ V+ + + K + L QK E K+N +D RCS Sbjct: 358 RDSEREAIEVF------IRSSFKDVDHLFQKELAAQLEKKRDDFCKQNQEASSD-RCSGL 410 Query: 441 IQ----SMERKLRAACHSSDASIDNVVKVLDGLISE-YETSCHGPGKWQKLATFL--QQS 493 +Q +E +++A +S V+ L L + YE G + L T+L ++S Sbjct: 411 LQVIFSPLEEEVKAGIYSKPGGYRLFVQKLQDLKKKYYEEPRKGIQAEEILQTYLKSKES 470 Query: 494 SEGPILDLVKRLID---QIGSERSSLMLKYRSIEDNMKLL-------KKQLEDSERYKSE 543 IL + L + +I ER +K S + + K+L ++ +E ER E Sbjct: 471 MTDAILQTDQTLTEKEKEIEVER----VKAESAQASAKMLHEMQRKNEQMMEQKERSYQE 526 Query: 544 YLKRYDDAI-NDKKKLADDYTSRIN-NLQGENISLREKSSSLSKTVDSLKNEISDWKRK 600 +LK+ + + ND+ +L + + LQ + L+E K +KNEI D + K Sbjct: 527 HLKQLTEKMENDRVQLLKEQERTLALKLQEQEQLLKE---GFQKESRIMKNEIQDLQTK 582
>pdb|2B8W|A Chain A, Crystal-Structure Of The N-Terminal Large Gtpase Domain Of Human Guanylate Binding Protein 1 (Hgbp1) In Complex With GmpALF4 Length = 328 Back     alignment and structure
>pdb|3Q5E|A Chain A, Crystal Structure Of Human Atlastin-1 (Residues 1-447) Bound To Gdp, Crystal Form 2 Length = 447 Back     alignment and structure
>pdb|4IDQ|A Chain A, Human Atlastin-1 1-446, N440t, Gdpalf4- Length = 447 Back     alignment and structure
>pdb|4IDN|A Chain A, Human Atlastin-1 1-446, C-his6, Gppnhp Length = 457 Back     alignment and structure
>pdb|3QNU|A Chain A, Crystal Structure Of The Cytosolic Domain Of Human Atlastin-1 In Complex With Gdp, Hexagonal Form Length = 459 Back     alignment and structure
>pdb|4IDP|A Chain A, Human Atlastin-1 1-446, N440t, Gppnhp Length = 447 Back     alignment and structure
>pdb|3Q5D|A Chain A, Crystal Structure Of Human Atlastin-1 (Residues 1-447) Bound To Gdp, Crystal Form 1 Length = 447 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query736
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 1e-112
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 1e-06
3q5d_A447 Atlastin-1; G protein, GTPase, GDP/GTP binding, hy 8e-88
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-19
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-12
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-11
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-11
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-06
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 2e-07
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-05
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 1e-06
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 6e-04
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 5e-06
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 1e-05
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 4e-05
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 1e-05
4akv_A386 Sorting nexin-33; transport protein, organelle bio 7e-05
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 Back     alignment and structure
 Score =  351 bits (902), Expect = e-112
 Identities = 153/587 (26%), Positives = 278/587 (47%), Gaps = 32/587 (5%)

Query: 40  ARPIRLVYCDEKGKFRMDPEAVAALQLVKEPIGVVSVCGRARQGKSFILNQLLGRSSGFQ 99
             P+ L+  +  G+   +PEA+  L  + +P+ VV++ G  R GKS+++N+L G+  GF 
Sbjct: 8   TGPMCLIE-NTNGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFS 66

Query: 100 VASTHRPCTKGLWLWSAPLKRTALDGTEYNLLLLDSEGI-DAYDQTGTYSTQIFSLAVLL 158
           + ST +  TKG+W+W  P          + L+LLD+EG+ D         + IF+LAVLL
Sbjct: 67  LGSTVQSHTKGIWMWCVPHP----KKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLL 122

Query: 159 SSMFIYNQMGGIDESAIDRLSLVTQMTKHIRIRASGGKTT-----PSELGQFSPIFVWLL 213
           SS F+YN +G I++ A+D+L  VT++T  IR ++S  +        ++   F P FVW L
Sbjct: 123 SSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSSPDENENEVEDSADFVSFFPDFVWTL 182

Query: 214 RDFYLDLVEDNRKITPRDYLEIALRPVQGSGRDIAAKNEIRDSIRALFPDRECFTLVRPL 273
           RDF LDL  D + +TP +YL  +L+  +G+ +     N  R  IR  FP ++CF   RP 
Sbjct: 183 RDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFVFDRP- 241

Query: 274 SNENELQRLDQISLDRLRPEFRAGLDALTKFVFERTRPKQV-GATVLTGPVLIGITESYL 332
            +  +L +L+++  + L PEF   +     ++F  ++ K + G   + GP L  +  +Y+
Sbjct: 242 VHRRKLAQLEKLQDEELDPEFVQQVADFCSYIFSNSKTKTLSGGIQVNGPRLESLVLTYV 301

Query: 333 DAINNGAVPTISSSWQSVEEAECRRAYDSATETY---MSTFDRSKPPEEVALGEAHEAAV 389
           +AI++G +P + ++  ++ + E   A   A   Y   M    +        L + H  + 
Sbjct: 302 NAISSGDLPCMENAVLALAQIENSAAVQKAIAHYEQQMGQKVQLPTESLQELLDLHRDSE 361

Query: 390 QKALAVYNAGAVGVGLARKKYEGLLQKFFRKAFEDHKKNVYMEADIRCSSAIQ----SME 445
           ++A+ V+             ++  L     K  +D  K     +  RCS  +Q     +E
Sbjct: 362 REAIEVFI--RSSFKDVDHLFQKELAAQLEKKRDDFCKQNQEASSDRCSGLLQVIFSPLE 419

Query: 446 RKLRAACHSSDASIDNVVKVLDGLISEY-ETSCHGPGKWQKLATFLQ--QSSEGPILDLV 502
            +++A  +S        V+ L  L  +Y E    G    + L T+L+  +S    IL   
Sbjct: 420 EEVKAGIYSKPGGYRLFVQKLQDLKKKYYEEPRKGIQAEEILQTYLKSKESMTDAILQTD 479

Query: 503 KRLIDQIGSERSSLMLKYRSIEDNMKLLKKQLEDSERYKSEYLKRYDDAINDKKKLADDY 562
           + L ++   E     +K  S + + K+L +    +E+   +  + Y + +    +  ++ 
Sbjct: 480 QTLTEKE-KEIEVERVKAESAQASAKMLHEMQRKNEQMMEQKERSYQEHLKQLTEKMEND 538

Query: 563 TSRINNLQGENISLREKS------SSLSKTVDSLKNEISDWKRKYDQ 603
             ++   Q   ++L+ +           K    +KNEI D + K  +
Sbjct: 539 RVQLLKEQERTLALKLQEQEQLLKEGFQKESRIMKNEIQDLQTKMRR 585


>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 Back     alignment and structure
>3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* Length = 447 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 Back     alignment and structure
>4akv_A Sorting nexin-33; transport protein, organelle biogenesis; 2.65A {Homo sapiens} Length = 386 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query736
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 100.0
4ido_A457 Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HE 100.0
3q5d_A447 Atlastin-1; G protein, GTPase, GDP/GTP binding, hy 100.0
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 98.98
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 98.55
2v66_B111 Nuclear distribution protein NUDE-like 1; structur 98.52
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 98.47
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 98.41
3swk_A86 Vimentin; cytoskeleton, intermediate filament, alp 98.25
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 97.77
3lxw_A247 GTPase IMAP family member 1; immunity, structural 97.76
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 97.71
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 97.68
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 97.68
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 97.68
3lxx_A239 GTPase IMAP family member 4; structural genomics c 97.61
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 97.6
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 97.46
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 97.44
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 97.43
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 97.41
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 97.4
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 97.37
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 97.32
3trt_A77 Vimentin; cytoskeleton, intermediate filament, alp 97.31
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 97.31
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 97.23
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 97.19
2j69_A695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 97.18
2efr_A155 General control protein GCN4 and tropomyosin 1 Al; 97.1
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 97.08
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 97.05
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 97.05
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 97.04
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 97.04
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 97.03
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 97.03
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 97.01
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 97.0
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 96.98
3tnu_B129 Keratin, type II cytoskeletal 5; coiled-coil, stru 96.96
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 96.95
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 96.95
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 96.95
3iby_A256 Ferrous iron transport protein B; G protein, G dom 96.95
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 96.95
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 96.94
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 96.94
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 96.93
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 96.93
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 96.93
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 96.92
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 96.92
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 96.92
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 96.9
3tnu_A131 Keratin, type I cytoskeletal 14; coiled-coil, stru 96.9
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 96.89
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 96.88
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 96.87
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 96.86
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 96.85
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 96.83
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 96.82
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 96.82
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 96.8
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 96.79
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 96.77
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 96.75
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 96.75
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 96.74
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 96.74
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 96.74
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 96.72
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 96.71
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 96.71
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 96.7
1wxq_A397 GTP-binding protein; structural genomics, riken st 96.7
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 96.69
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 96.69
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 96.69
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 96.69
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 96.67
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 96.66
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 96.66
2www_A349 Methylmalonic aciduria type A protein, mitochondri 96.66
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 96.66
2wji_A165 Ferrous iron transport protein B homolog; membrane 96.64
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 96.64
4a9a_A376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 96.64
3t1o_A198 Gliding protein MGLA; G domain containing protein, 96.63
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 96.63
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 96.62
2x2e_A353 Dynamin-1; nitration, hydrolase, membrane fission, 96.62
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 96.61
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 96.6
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 96.59
2dfs_A 1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 96.57
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 96.56
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 96.52
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 96.52
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 96.52
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 96.51
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 96.5
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 96.49
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 96.48
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 96.47
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 96.47
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 96.46
3qq5_A423 Small GTP-binding protein; hydrogenase, H-cluster, 96.46
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 96.46
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 96.46
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 96.46
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 96.43
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 96.43
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 96.4
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 96.4
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 96.39
3llu_A196 RAS-related GTP-binding protein C; structural geno 96.39
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 96.37
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 96.36
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 96.35
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 96.35
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 96.34
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 96.34
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 96.34
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 96.33
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 96.33
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 96.31
2ged_A193 SR-beta, signal recognition particle receptor beta 96.31
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 96.31
3zvr_A772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 96.3
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 96.29
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 96.28
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 96.28
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 96.28
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 96.28
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 96.27
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 96.27
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 96.26
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 96.26
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 96.25
3cnl_A262 YLQF, putative uncharacterized protein; circular p 96.23
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 96.22
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 96.21
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 96.21
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 96.2
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 96.2
3swk_A86 Vimentin; cytoskeleton, intermediate filament, alp 96.18
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 96.17
1jal_A363 YCHF protein; nucleotide-binding fold, structural 96.15
1nrj_B218 SR-beta, signal recognition particle receptor beta 96.14
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 96.14
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 96.14
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coi 96.13
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 96.12
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 96.11
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 96.08
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 96.08
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 96.07
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 96.04
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 96.01
2fh5_B214 SR-beta, signal recognition particle receptor beta 96.0
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 95.99
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 95.98
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 95.98
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 95.97
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 95.97
3s84_A273 Apolipoprotein A-IV; four helix bundle, transport 95.96
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 95.95
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 95.93
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 95.88
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 95.86
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 95.86
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 95.86
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 95.85
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 95.83
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 95.82
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 95.82
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 95.76
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 95.75
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 95.75
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 95.53
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 95.53
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 95.48
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 95.45
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 95.39
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 95.38
2ocy_A154 RAB guanine nucleotide exchange factor SEC2; RAB, 95.34
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 95.31
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 95.28
2h5e_A529 Peptide chain release factor RF-3; beta barrel, tr 95.28
2ohf_A396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 95.17
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 95.16
2ocy_A154 RAB guanine nucleotide exchange factor SEC2; RAB, 95.13
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 95.1
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 95.09
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 95.07
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 95.06
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 94.93
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 94.92
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 94.9
3p26_A483 Elongation factor 1 alpha-like protein; GTP/GDP bi 94.83
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 94.82
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 94.79
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 93.8
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 94.76
3dpu_A535 RAB family protein; roccor, G-domain, COR, GTP-bin 94.73
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 94.72
2dby_A368 GTP-binding protein; GDP, structural genomics, NPP 94.7
3sjy_A403 Translation initiation factor 2 subunit gamma; zin 94.7
2ywe_A600 GTP-binding protein LEPA; G domain, beta-barrel, f 94.68
2xex_A693 Elongation factor G; GTPase, translation, biosynth 94.65
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 94.6
3cb4_D599 GTP-binding protein LEPA; GTPase, OB-fold, membran 94.54
3tr5_A528 RF-3, peptide chain release factor 3; protein synt 94.49
2b9c_A147 Striated-muscle alpha tropomyosin; alpha-helix, co 94.46
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 94.39
3tnu_B129 Keratin, type II cytoskeletal 5; coiled-coil, stru 94.37
1kk1_A410 EIF2gamma; initiation of translation; HET: GNP; 1. 94.37
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 94.3
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 94.25
2b9c_A147 Striated-muscle alpha tropomyosin; alpha-helix, co 94.16
1wb1_A482 Translation elongation factor SELB; selenocysteine 94.16
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coi 94.15
2c78_A405 Elongation factor TU-A; hydrolase, GTPase, transla 94.15
1zun_B434 Sulfate adenylate transferase, subunit 1/adenylyls 94.12
3u59_A101 Tropomyosin beta chain; muscle contraction, actin, 94.12
3izy_P537 Translation initiation factor IF-2, mitochondrial; 94.07
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 94.04
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 94.01
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 94.0
3o47_A329 ADP-ribosylation factor GTPase-activating protein 94.0
3tnu_A131 Keratin, type I cytoskeletal 14; coiled-coil, stru 93.96
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 93.91
3s84_A273 Apolipoprotein A-IV; four helix bundle, transport 93.89
1r5b_A467 Eukaryotic peptide chain release factor GTP-bindi 93.89
2rdo_7704 EF-G, elongation factor G; elongation factor G, EF 93.82
3izq_1611 HBS1P, elongation factor 1 alpha-like protein; NO- 93.82
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 93.77
3j2k_7439 ERF3, eukaryotic polypeptide chain release factor 93.66
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 93.65
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 93.64
1dar_A691 EF-G, elongation factor G; ribosomal translocase, 93.63
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 93.53
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 93.47
3u59_A101 Tropomyosin beta chain; muscle contraction, actin, 93.44
2efr_A155 General control protein GCN4 and tropomyosin 1 Al; 93.42
1g6h_A257 High-affinity branched-chain amino acid transport 93.42
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 93.38
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 93.34
1sgw_A214 Putative ABC transporter; structural genomics, P p 93.31
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 93.3
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 93.29
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 93.28
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 93.27
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 93.26
1b0u_A262 Histidine permease; ABC transporter, transport pro 93.26
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 93.25
2elf_A370 Protein translation elongation factor 1A; tRNA, py 93.24
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 93.23
1s0u_A408 EIF-2-gamma, translation initiation factor 2 gamma 93.22
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 93.16
1ji0_A240 ABC transporter; ATP binding protein, structural g 93.16
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 93.15
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 93.13
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 93.1
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 93.04
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 92.99
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 92.98
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 92.93
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 92.89
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 92.87
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 92.85
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 92.79
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 92.79
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 92.77
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 92.76
1n0u_A 842 EF-2, elongation factor 2; G-protein, CIS-proline, 92.75
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 92.7
2kjq_A149 DNAA-related protein; solution structure, NESG, st 92.7
2ghi_A260 Transport protein; multidrug resistance protein, M 92.67
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 92.65
3mca_A592 HBS1, elongation factor 1 alpha-like protein; prot 92.61
1g7s_A594 Translation initiation factor IF2/EIF5B; translati 92.54
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 92.42
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 92.29
2eyu_A261 Twitching motility protein PILT; pilus retraction 92.22
1zo1_I501 IF2, translation initiation factor 2; E. coli, rib 92.18
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 92.1
1jny_A435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 92.09
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 92.05
2v66_B111 Nuclear distribution protein NUDE-like 1; structur 92.02
1d2e_A397 Elongation factor TU (EF-TU); G-protein, beta-barr 91.96
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 91.91
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 91.88
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 91.88
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 91.87
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 91.83
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 91.81
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 91.72
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 91.67
3s4r_A93 Vimentin; alpha-helix, cytoskeleton, intermediate 91.67
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 91.66
2dy1_A665 Elongation factor G; translocation, GTP complex, s 91.66
1f60_A458 Elongation factor EEF1A; protein-protein complex, 91.65
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 91.63
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 91.49
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 91.45
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 91.43
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 91.37
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 91.34
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 91.19
1kag_A173 SKI, shikimate kinase I; transferase, structural g 91.18
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 91.18
1p9r_A418 General secretion pathway protein E; bacterial typ 91.1
2oap_1511 GSPE-2, type II secretion system protein; hexameri 91.08
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 91.04
4a74_A231 DNA repair and recombination protein RADA; hydrola 90.99
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 90.98
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 90.97
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 90.97
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 90.93
2xxa_A433 Signal recognition particle protein; protein trans 90.93
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 90.88
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 90.87
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 90.86
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 90.84
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 90.8
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 90.69
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 90.61
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 90.6
2eqb_B97 RAB guanine nucleotide exchange factor SEC2; coile 90.55
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 90.54
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 90.39
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 90.39
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 90.31
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 90.22
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 90.21
2e7s_A135 RAB guanine nucleotide exchange factor SEC2; coile 90.02
2e7s_A135 RAB guanine nucleotide exchange factor SEC2; coile 90.02
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 89.88
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 89.87
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 89.68
3szr_A608 Interferon-induced GTP-binding protein MX1; interf 89.67
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 89.67
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 89.59
3mq9_A471 Bone marrow stromal antigen 2 fused to maltose-BI 89.55
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 89.34
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 89.29
2ewv_A372 Twitching motility protein PILT; pilus retraction 89.16
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 89.1
1deq_A 390 Fibrinogen (alpha chain); coiled-coil, blood clott 89.08
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 89.08
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 89.07
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 89.05
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 89.02
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 89.01
3mq9_A471 Bone marrow stromal antigen 2 fused to maltose-BI 89.01
3i00_A120 HIP-I, huntingtin-interacting protein 1; transcrip 89.0
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 88.96
1xjc_A169 MOBB protein homolog; structural genomics, midwest 88.9
3s4r_A93 Vimentin; alpha-helix, cytoskeleton, intermediate 88.89
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 88.83
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 88.81
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 88.69
3iox_A 497 AGI/II, PA; alpha helix, PPII helix, supersandwich 88.41
1ic2_A81 Tropomyosin alpha chain, skeletal muscle; alpha-he 88.32
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 88.11
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 88.05
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 88.04
1ic2_A81 Tropomyosin alpha chain, skeletal muscle; alpha-he 87.89
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 87.64
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 87.42
2a01_A243 Apolipoprotein A-I; four-helix bundle, lipid trans 87.36
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 87.35
3haj_A 486 Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, 87.26
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 87.1
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 87.0
2og2_A359 Putative signal recognition particle receptor; nuc 86.99
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 86.95
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 86.95
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 86.93
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 86.81
2zqm_A117 Prefoldin beta subunit 1; chaperone; HET: CIT; 1.9 86.69
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 86.44
3euj_A483 Chromosome partition protein MUKB, linker; MUKB, M 86.44
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 86.4
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 86.35
2hf9_A226 Probable hydrogenase nickel incorporation protein 86.24
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 86.17
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 86.09
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 86.09
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 86.08
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 86.04
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 86.0
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 85.83
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 85.77
3i00_A120 HIP-I, huntingtin-interacting protein 1; transcrip 85.67
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 85.65
3r7w_B331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 85.58
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 85.55
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 85.51
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 85.39
1l8d_A112 DNA double-strand break repair RAD50 ATPase; zinc 85.18
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 85.13
3r6n_A 450 Desmoplakin; spectrin repeat, SH3 domain, cell adh 84.92
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 84.76
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 84.74
1x8y_A86 Lamin A/C; structural protein, intermediate filame 84.67
3qh9_A81 Liprin-beta-2; coiled-coil, dimerization, structur 84.67
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 84.63
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 84.61
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 84.4
4fla_A152 Regulation of nuclear PRE-mRNA domain-containing 1 84.3
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 84.29
1fxk_A107 Prefoldin; archaeal protein, chaperone; 2.30A {Met 84.28
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 84.27
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 84.17
2cvh_A220 DNA repair and recombination protein RADB; filamen 84.1
3vaa_A199 Shikimate kinase, SK; structural genomics, center 84.04
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 83.96
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 83.96
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 83.89
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 83.87
3trt_A77 Vimentin; cytoskeleton, intermediate filament, alp 83.76
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 83.75
3kta_A182 Chromosome segregation protein SMC; structural mai 83.72
1gk4_A84 Vimentin; intermediate filament, dimer, parallel c 83.6
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 83.56
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 83.52
4aby_A415 DNA repair protein RECN; hydrolase, double strand 83.36
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 83.34
2l7b_A307 Apolipoprotein E, APO-E; lipid transport, atherosc 83.0
4gkw_A167 Spindle assembly abnormal protein 6; double helix, 82.99
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 82.98
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 82.97
3cvf_A79 Homer-3, homer protein homolog 3; coiled coil, alt 82.97
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 82.91
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 82.69
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 82.65
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 82.59
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 82.49
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 82.37
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 82.34
1via_A175 Shikimate kinase; structural genomics, transferase 82.34
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 82.3
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 82.22
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 82.17
3r20_A233 Cytidylate kinase; structural genomics, seattle st 82.15
3bos_A242 Putative DNA replication factor; P-loop containing 82.09
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 82.07
1m1j_B 464 Fibrinogen beta chain; coiled coils, disulfide rin 82.04
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 81.73
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 81.73
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 81.65
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 81.5
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 81.44
1qhl_A227 Protein (cell division protein MUKB); SMC, chromos 81.41
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 81.28
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 81.19
3qh9_A81 Liprin-beta-2; coiled-coil, dimerization, structur 81.0
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 80.9
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 80.74
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 80.68
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 80.65
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 80.57
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 80.54
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 80.49
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 80.45
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 80.41
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 80.31
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
Probab=100.00  E-value=1.5e-90  Score=796.25  Aligned_cols=515  Identities=28%  Similarity=0.491  Sum_probs=476.1

Q ss_pred             CCCCCeeEEEeCCCCceeeCHHHHHHhhccCCCEEEEEeeCCCCCChhHHHHHHhCCCCcccccCCCCCccceEEeeccc
Q 004698           38 GPARPIRLVYCDEKGKFRMDPEAVAALQLVKEPIGVVSVCGRARQGKSFILNQLLGRSSGFQVASTHRPCTKGLWLWSAP  117 (736)
Q Consensus        38 ~~~~pi~Lv~~d~~~~l~l~~eAl~~L~~i~~~v~vVsv~G~~rtGKS~LlN~l~~~~~gF~~~~~~~~~T~Giw~w~~p  117 (736)
                      ..+.|||||.++ +|.|.+|++|+++|..++.|+.+|+|+|++++|||||+|.|+|...||.+++++.+||+|||+|+.|
T Consensus         6 ~m~~pv~li~~~-~~~l~~~~eal~~L~~i~~~~~~VaivG~pnvGKStLiN~L~g~~~~~~~~~tt~~~T~gi~~~~~~   84 (592)
T 1f5n_A            6 HMTGPMCLIENT-NGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGIWMWCVP   84 (592)
T ss_dssp             -CCSCEEEEEEE-TTEEEECHHHHHHHHTCCSBEEEEEEEEBTTSSHHHHHHHHTTCSSCSCCCCSSSCCCCSEEEEEEE
T ss_pred             CCCCCeEEEEeC-CCcEEECHHHHHHHHhccCCCcEEEEECCCCCCHHHHHHhHcCCCCccccCCCCCCceeEEEEeecc
Confidence            356799999987 7999999999999999999999999999999999999999999999999999999999999999988


Q ss_pred             cccccCCCCceEEEEeecCCCcccCC-CCccchHHHHHhhhccceEEEccCCCCchHHhhhhHHHHHHHHHHHHHhcC--
Q 004698          118 LKRTALDGTEYNLLLLDSEGIDAYDQ-TGTYSTQIFSLAVLLSSMFIYNQMGGIDESAIDRLSLVTQMTKHIRIRASG--  194 (736)
Q Consensus       118 ~~~~~~~g~~~~v~llDteG~~~~~~-~~~~d~~IFaLa~LLSS~~IyN~~g~i~e~~l~~L~~v~el~~~i~~k~~~--  194 (736)
                      ++.    +.+..++|+||||+++... +..+|+++|+|+++|||++|||+.|.|++++++.|++++++++.++.++++  
T Consensus        85 ~~~----~~~~~i~LiDTpGi~~~~~~~~~~~~~~fala~llss~lv~n~~~~i~~~dl~~l~~v~e~~~~l~~k~~~~~  160 (592)
T 1f5n_A           85 HPK----KPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSSPDE  160 (592)
T ss_dssp             CSS----STTCEEEEEEECCBCCGGGCCCTTHHHHHHHHHHHCSEEEEEEESCSSHHHHHTTHHHHTHHHHCBSCCC---
T ss_pred             ccc----CCCceEEEecCCCcCcccccchhHHHHHHHHHHHhcCeEEEECCCCccHHHHHHHHHHHHHhhhhhcccCccc
Confidence            854    2346799999999988776 567899999999999999999999999999999999999999999887652  


Q ss_pred             ---CCCCCCcccccCCeEEEEeecccccccccCccCChHHHHHHhhccccCCChhhhhhhHHHHHHHhhCCCCceEeccC
Q 004698          195 ---GKTTPSELGQFSPIFVWLLRDFYLDLVEDNRKITPRDYLEIALRPVQGSGRDIAAKNEIRDSIRALFPDRECFTLVR  271 (736)
Q Consensus       195 ---~~~~~~e~~~~~P~f~wlvRDf~l~~~~~g~~~t~~~yLe~~L~~~~g~~~~~~~~n~ir~~i~~~F~~~~cf~l~~  271 (736)
                         +..+..+++.|||+|+||||||++++..+|+++|+++||+++|+..+|.++.+...|.+|.+|++|||+++||+|||
T Consensus       161 ~~~~~~~~~~~~~~fP~~~wvvRD~~l~~~~~g~~~t~~eyLe~~L~~~~~~~~~~~~~n~~R~~I~~~F~~~~cf~lp~  240 (592)
T 1f5n_A          161 NENEVEDSADFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFVFDR  240 (592)
T ss_dssp             ----CCGGGGHHHHCCEEEEEEETCCCCCCCSSSCCCHHHHHHHHTCCCCCCSHHHHHHHHHHHHHHHHCSCEEEEECCC
T ss_pred             ccccccchhhhhccCCceEEEEecccchhccCCCCCCHHHHHHHHHhhccCCChhhHhhhhHHHHHHHhCCCCcEEEeCC
Confidence               22234567889999999999999999889999999999999999999988889999999999999999999999999


Q ss_pred             CCcChhhhhcccCCCcCCCChHHHHHHHHHHHHHhccCCcccc-CCcccchhhHHHHHHHHHHHHhcCCCCCccchHHHH
Q 004698          272 PLSNENELQRLDQISLDRLRPEFRAGLDALTKFVFERTRPKQV-GATVLTGPVLIGITESYLDAINNGAVPTISSSWQSV  350 (736)
Q Consensus       272 P~~~~~~l~~l~~~~~~~l~~eF~~~l~~l~~~i~~~~~pK~~-~g~~ltg~~l~~l~~~yv~ain~g~vP~i~s~~~~~  350 (736)
                      |+.+. .+++++.++.++|+|+|+++++.||++|++.++||++ +|.++||++|+.|++.||+|||+|.+|+++|+|.++
T Consensus       241 P~~~~-~l~~L~~~~~~~L~peF~~~l~~l~~~i~~~~~~K~~~gg~~vtG~~L~~l~~~yv~ain~g~vP~~~s~~~a~  319 (592)
T 1f5n_A          241 PVHRR-KLAQLEKLQDEELDPEFVQQVADFCSYIFSNSKTKTLSGGIQVNGPRLESLVLTYVNAISSGDLPCMENAVLAL  319 (592)
T ss_dssp             CSCGG-GGGGGGGSCGGGSCHHHHHHHHHHHHHHHHHCCCCEETTTEECBHHHHHHHHHHHHHHHHHTSCCBHHHHHHHH
T ss_pred             CCcHH-HHhhhccCChhhCCHHHHHHHHHHHHHHHccccceeecCCccccHHHHHHHHHHHHHHHhCCCCCCcchHHHHH
Confidence            99988 8999999999999999999999999999999999999 578999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHhhcccC--CCCCh-HHHHHHHHHHHHHHHHHhhhcccCChhhhHHHHHHHHHHHHHHHHHHHH
Q 004698          351 EEAECRRAYDSATETYMSTFDRS--KPPEE-VALGEAHEAAVQKALAVYNAGAVGVGLARKKYEGLLQKFFRKAFEDHKK  427 (736)
Q Consensus       351 ~e~~~~~a~~~A~~~Y~~~m~~~--~p~~e-~~L~~~h~~~~~~Al~~F~~~s~g~~~~~~~~~~~L~~~i~~~~e~~~~  427 (736)
                      ++.+|.+|++.|+++|.+.|...  +|.+. ++|...|..+..+|+++|++.+|+  +..++|+++|...|.+.+++|++
T Consensus       320 a~~e~~~av~~A~~~Y~~~M~~~~~~P~~~~~eL~~~H~~~~~~Al~~F~~~~~~--d~~~~~~~~L~~~i~~~~~~~~~  397 (592)
T 1f5n_A          320 AQIENSAAVQKAIAHYEQQMGQKVQLPTESLQELLDLHRDSEREAIEVFIRSSFK--DVDHLFQKELAAQLEKKRDDFCK  397 (592)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHCCSSCSSHHHHHHHHHHHHHHHHHHHHHHCCC--CGGGHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhhcCCCCCCHHHHHHHHHHHHHHHHHHHHHhcch--hhHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999863  46655 899999999999999999999987  56789999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHH----HHHHHHhhccCCCcchhHHHHHHHHHHHHHhccc-CCCchhHHHHHHHH--HhhhhhHHH
Q 004698          428 NVYMEADIRCSSAIQS----MERKLRAACHSSDASIDNVVKVLDGLISEYETSC-HGPGKWQKLATFLQ--QSSEGPILD  500 (736)
Q Consensus       428 ~n~~~s~~~C~~~l~~----le~~l~~~~~~~~~~~~~~~~~~~~ll~~Y~~~~-~Gp~K~~~L~~fLq--~~~~~~il~  500 (736)
                      .|+.+|..+|+++|+.    |+++|+++.+..+|+|+.|.+.++.+..+|+..+ +||.++.+|++||+  ....++|++
T Consensus       398 ~N~~~s~~~C~~ll~~l~~~l~~~i~~g~~~~p~g~~~~~~~~~~~~~~Y~~~~~kg~~~~~vl~~fl~~~~~~~~~ilq  477 (592)
T 1f5n_A          398 QNQEASSDRCSGLLQVIFSPLEEEVKAGIYSKPGGYRLFVQKLQDLKKKYYEEPRKGIQAEEILQTYLKSKESMTDAILQ  477 (592)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHTTTTSSTTHHHHHHHHHHHHHHHHHHSSCCCTTHHHHHHHHHHHTHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHhcCCcCCCCcHHHHHHHHHHHHHHHHHhcCCcccHHHHHHHHHHHHHHHHHHHHH
Confidence            9999999999999986    5666667788888899999999999999999999 89999999999998  467899999


Q ss_pred             HHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 004698          501 LVKRLIDQIGSERSSLMLKYRSIEDNMKLLKKQLEDSERYKSEYLKRYDDAINDKKKLADD  561 (736)
Q Consensus       501 ~~~~l~~~i~~e~~~L~~k~es~e~e~~~lk~~Le~~e~~~~e~~k~~e~~In~lkk~~e~  561 (736)
                      +|+.|+++ ++++.+.+++.++++.+...+.+.+...++.+++.+++|+++|.+++.+|+.
T Consensus       478 ~d~~l~~~-~k~~~~~~~~~e~~~~~~~~l~~~~~~~~~~~~~~~~~~~e~~~ql~~kme~  537 (592)
T 1f5n_A          478 TDQTLTEK-EKEIEVERVKAESAQASAKMLHEMQRKNEQMMEQKERSYQEHLKQLTEKMEN  537 (592)
T ss_dssp             HCSSSCHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999 9999999999999999999999999999999999999999999999766554



>4ido_A Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HET: GDP; 2.09A {Homo sapiens} PDB: 4idn_A* 3q5d_A* 3q5e_A* 4idq_A* 4idp_A* 3qnu_A* 3qof_A* Back     alignment and structure
>3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Back     alignment and structure
>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Back     alignment and structure
>3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>3trt_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural protein; 2.30A {Homo sapiens} PDB: 3klt_A* Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure
>3s84_A Apolipoprotein A-IV; four helix bundle, transport protein; 2.40A {Homo sapiens} Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>3s84_A Apolipoprotein A-IV; four helix bundle, transport protein; 2.40A {Homo sapiens} Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} Back     alignment and structure
>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} Back     alignment and structure
>3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Back     alignment and structure
>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>2a01_A Apolipoprotein A-I; four-helix bundle, lipid transport; HET: AC9; 2.40A {Homo sapiens} PDB: 3k2s_A* 1av1_A 3j00_0* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>2zqm_A Prefoldin beta subunit 1; chaperone; HET: CIT; 1.90A {Thermococcus SP} PDB: 2zdi_A Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>1x8y_A Lamin A/C; structural protein, intermediate filament protein; 2.20A {Homo sapiens} SCOP: h.1.20.1 PDB: 3v5b_A 3v4w_A 3v4q_A Back     alignment and structure
>3qh9_A Liprin-beta-2; coiled-coil, dimerization, structural protein; 2.01A {Homo sapiens} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>4fla_A Regulation of nuclear PRE-mRNA domain-containing 1B; structural genomics consortium, SGC, transcription; 2.20A {Homo sapiens} Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>1fxk_A Prefoldin; archaeal protein, chaperone; 2.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: a.2.5.1 PDB: 1fxk_B Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>3trt_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural protein; 2.30A {Homo sapiens} PDB: 3klt_A* Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>1gk4_A Vimentin; intermediate filament, dimer, parallel coiled coil, heptad repeat, stutter; 2.3A {Homo sapiens} SCOP: h.1.20.1 Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>2l7b_A Apolipoprotein E, APO-E; lipid transport, atherosclerosis, alzheime disease; NMR {Homo sapiens} Back     alignment and structure
>4gkw_A Spindle assembly abnormal protein 6; double helix, SAS-5, centriole, structural protein; 3.30A {Caenorhabditis elegans} Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B* Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3qh9_A Liprin-beta-2; coiled-coil, dimerization, structural protein; 2.01A {Homo sapiens} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 736
d1f5na2277 c.37.1.8 (A:7-283) Interferon-induced guanylate-bi 1e-78
d1f5na1300 a.114.1.1 (A:284-583) Interferon-induced guanylate 1e-22
d1f5na1300 a.114.1.1 (A:284-583) Interferon-induced guanylate 0.001
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  251 bits (642), Expect = 1e-78
 Identities = 94/279 (33%), Positives = 156/279 (55%), Gaps = 12/279 (4%)

Query: 42  PIRLVYCDEKGKFRMDPEAVAALQLVKEPIGVVSVCGRARQGKSFILNQLLGRSSGFQVA 101
           P+ L+  +  G+   +PEA+  L  + +P+ VV++ G  R GKS+++N+L G+  GF + 
Sbjct: 4   PMCLIE-NTNGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLG 62

Query: 102 STHRPCTKGLWLWSAPLKRTALDGTEYNLLLLDSEGIDAYDQ-TGTYSTQIFSLAVLLSS 160
           ST +  TKG+W+W  P          + L+LLD+EG+   ++      + IF+LAVLLSS
Sbjct: 63  STVQSHTKGIWMWCVPHP----KKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSS 118

Query: 161 MFIYNQMGGIDESAIDRLSLVTQMTKHIRIRAS-----GGKTTPSELGQFSPIFVWLLRD 215
            F+YN +G I++ A+D+L  VT++T  IR ++S           ++   F P FVW LRD
Sbjct: 119 TFVYNSIGTINQQAMDQLYYVTELTHRIRSKSSPDENENEVEDSADFVSFFPDFVWTLRD 178

Query: 216 FYLDLVEDNRKITPRDYLEIALRPVQGSGRDIAAKNEIRDSIRALFPDRECFTLVRPLSN 275
           F LDL  D + +TP +YL  +L+  +G+ +     N  R  IR  FP ++CF   RP+  
Sbjct: 179 FSLDLEADGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFVFDRPVHR 238

Query: 276 ENELQRLDQISLDRLRPEFRAGLDALTKFVFERTRPKQV 314
              L +L+++  + L PEF   +     ++F  ++ K +
Sbjct: 239 RK-LAQLEKLQDEELDPEFVQQVADFCSYIFSNSKTKTL 276


>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 Back     information, alignment and structure
>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query736
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 100.0
d1f5na1300 Interferon-induced guanylate-binding protein 1 (GB 99.96
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 98.03
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 97.87
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 97.85
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 97.62
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 97.48
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 97.4
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 97.39
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 97.34
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 97.24
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 97.24
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 97.24
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 97.24
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 97.23
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 97.2
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 97.16
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 97.1
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 96.96
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 96.95
d2fh5b1207 Signal recognition particle receptor beta-subunit 96.68
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 96.54
d1nrjb_209 Signal recognition particle receptor beta-subunit 96.49
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 96.45
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 96.45
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 96.42
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 96.41
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 96.38
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 96.36
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 96.23
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 96.18
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 96.18
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 96.13
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 96.12
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 96.12
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 96.08
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 96.05
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 96.0
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 95.99
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 95.99
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 95.94
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 95.92
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 95.89
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 95.88
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 95.78
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 95.77
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 95.72
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 95.71
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 95.68
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 95.67
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 95.65
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 95.65
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 95.57
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 95.51
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 95.5
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 95.49
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 95.38
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 95.37
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 95.35
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 95.33
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 95.3
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 95.25
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 95.19
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 95.16
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 95.07
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 95.07
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 95.05
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 94.99
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 94.78
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 94.77
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 94.74
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 94.73
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 94.68
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.57
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 94.56
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 94.55
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 94.48
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 94.41
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 94.29
d2awna2232 Maltose transport protein MalK, N-terminal domain 94.05
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 93.96
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 93.95
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 93.93
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 93.77
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 93.7
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 93.69
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 93.46
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 93.42
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 93.35
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 93.34
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 93.33
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 93.28
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 93.27
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 93.25
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 93.11
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 93.05
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 93.04
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 93.02
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 93.0
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 92.95
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 92.68
d1g2912240 Maltose transport protein MalK, N-terminal domain 92.67
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 92.64
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 92.6
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 92.6
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 92.57
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 92.47
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 92.43
d2hyda1255 Putative multidrug export ATP-binding/permease pro 92.42
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 92.32
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 92.31
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 92.26
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 92.01
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 91.72
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 91.53
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 91.47
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 91.38
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 91.15
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 91.07
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 90.75
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 90.42
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 90.07
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 89.71
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 89.51
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 89.36
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 89.35
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 89.34
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 88.94
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 88.9
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 88.66
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 88.4
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 88.31
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 88.28
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 88.17
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 88.16
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 87.14
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 86.72
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 86.39
d1j8yf2211 GTPase domain of the signal sequence recognition p 86.12
d1ls1a2207 GTPase domain of the signal sequence recognition p 85.97
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 85.96
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 85.92
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 85.83
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 85.81
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 85.72
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 85.56
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 85.39
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 85.13
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 84.76
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 84.73
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 84.65
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 84.54
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 84.34
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 84.05
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 83.77
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 83.25
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 82.95
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 82.6
d1fxka_107 Prefoldin beta subunit {Archaeon Methanobacterium 82.54
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 82.5
d2efla1288 Formin-binding protein 1, FNBP1 {Human (Homo sapie 82.42
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 82.2
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 81.99
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 81.62
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 81.46
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 81.29
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 81.1
d1fxka_107 Prefoldin beta subunit {Archaeon Methanobacterium 81.04
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 80.95
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 80.17
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=5.6e-62  Score=511.09  Aligned_cols=270  Identities=35%  Similarity=0.678  Sum_probs=246.4

Q ss_pred             CCCeeEEEeCCCCceeeCHHHHHHhhccCCCEEEEEeeCCCCCChhHHHHHHhCCCCcccccCCCCCccceEEeeccccc
Q 004698           40 ARPIRLVYCDEKGKFRMDPEAVAALQLVKEPIGVVSVCGRARQGKSFILNQLLGRSSGFQVASTHRPCTKGLWLWSAPLK  119 (736)
Q Consensus        40 ~~pi~Lv~~d~~~~l~l~~eAl~~L~~i~~~v~vVsv~G~~rtGKS~LlN~l~~~~~gF~~~~~~~~~T~Giw~w~~p~~  119 (736)
                      +.|||||+ +++|+|.++++|+++|+.+++||+||||+|++|||||||||+|+|...||.||+++++||+|||||+.|++
T Consensus         2 ~~p~~li~-~~~~~l~~~~e~l~~l~~~~~~v~vvsi~G~~~sGKS~llN~l~~~~~~f~~~~~~~~~T~Giw~~~~~~~   80 (277)
T d1f5na2           2 TGPMCLIE-NTNGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGIWMWCVPHP   80 (277)
T ss_dssp             CSCEEEEE-EETTEEEECHHHHHHHHTCCSBEEEEEEEEBTTSSHHHHHHHHTTCSSCSCCCCSSSCCCCSEEEEEEECS
T ss_pred             CCCeEEEE-cCCCeEEECHHHHHHHHcCCCCEEEEEEECCCCCCHHHHHHHHcCCCCCCccCCCCCCCCCceEEEEeecc
Confidence            57999997 56799999999999999999999999999999999999999999999999999999999999999999985


Q ss_pred             cccCCCCceEEEEeecCCCcccCC-CCccchHHHHHhhhccceEEEccCCCCchHHhhhhHHHHHHHHHHHHHhcC----
Q 004698          120 RTALDGTEYNLLLLDSEGIDAYDQ-TGTYSTQIFSLAVLLSSMFIYNQMGGIDESAIDRLSLVTQMTKHIRIRASG----  194 (736)
Q Consensus       120 ~~~~~g~~~~v~llDteG~~~~~~-~~~~d~~IFaLa~LLSS~~IyN~~g~i~e~~l~~L~~v~el~~~i~~k~~~----  194 (736)
                          +|.++.|++|||||+++.+. +..+|.+||+|++||||++|||+++.|++.++++|++++++++.+.++.+.    
T Consensus        81 ----~~~~~~~~~lDteG~~~~~~~~~~~~~~i~~l~~llSs~~i~N~~~~~~~~~l~~L~~~~~~~~~~~~~~~~~~~~  156 (277)
T d1f5na2          81 ----KKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSSPDENE  156 (277)
T ss_dssp             ----SSTTCEEEEEEECCBCCGGGCCCTTHHHHHHHHHHHCSEEEEEEESCSSHHHHHTTHHHHTHHHHCBSCCC-----
T ss_pred             ----CCCCceEEEEecccccccccccchhHHHHHHHHHHHhCEEEEeccccCcHHHHHHHHHHHHHHHHHHHhhcccccc
Confidence                46778999999999998775 456899999999999999999999999999999999999999988766531    


Q ss_pred             -CCCCCCcccccCCeEEEEeecccccccccCccCChHHHHHHhhccccCCChhhhhhhHHHHHHHhhCCCCceEeccCCC
Q 004698          195 -GKTTPSELGQFSPIFVWLLRDFYLDLVEDNRKITPRDYLEIALRPVQGSGRDIAAKNEIRDSIRALFPDRECFTLVRPL  273 (736)
Q Consensus       195 -~~~~~~e~~~~~P~f~wlvRDf~l~~~~~g~~~t~~~yLe~~L~~~~g~~~~~~~~n~ir~~i~~~F~~~~cf~l~~P~  273 (736)
                       +.....++..++|.|+|+||||++++..+|..+|+.+||+++|+..++.+.++...|.+|++|++||++++||+||||+
T Consensus       157 ~~~~~~~~~~~~~p~l~~vvRD~~~~~~~~~~~~t~~eyLe~~l~~~~~~~~~~~~~N~~R~~i~~~F~dv~cf~Lp~P~  236 (277)
T d1f5na2         157 NEVEDSADFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFVFDRPV  236 (277)
T ss_dssp             --CCGGGGHHHHCCEEEEEEETCCCCCCCSSSCCCHHHHHHHHTCCCCCCSHHHHHHHHHHHHHHHHCSCEEEEECCCCS
T ss_pred             cccccchhhcccCCceEEEeecccccccccCCcccHHHHHHHHHhcccCchhhhHhhhhHHHHHHHhcCCCeEEeCCCCc
Confidence             1122345567899999999999998877889999999999999999998889999999999999999999999999998


Q ss_pred             cChhhhhcccCCCcCCCChHHHHHHHHHHHHHhccCCccccC
Q 004698          274 SNENELQRLDQISLDRLRPEFRAGLDALTKFVFERTRPKQVG  315 (736)
Q Consensus       274 ~~~~~l~~l~~~~~~~l~~eF~~~l~~l~~~i~~~~~pK~~~  315 (736)
                      ..+ .+++++.++.++|+|+|+++++.||++|+++++||+++
T Consensus       237 ~~~-~l~~l~~~~~~~L~~~F~~~v~~L~k~I~~~~~~K~ln  277 (277)
T d1f5na2         237 HRR-KLAQLEKLQDEELDPEFVQQVADFCSYIFSNSKTKTLS  277 (277)
T ss_dssp             CGG-GGGGGGGSCGGGSCHHHHHHHHHHHHHHHHHCCCCEET
T ss_pred             chh-hhchhhcCCccccCHHHHHHHHHHHHHHhccCCCcccC
Confidence            654 58899999999999999999999999999999999874



>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1fxka_ a.2.5.1 (A:) Prefoldin beta subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2efla1 a.238.1.4 (A:1-288) Formin-binding protein 1, FNBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1fxka_ a.2.5.1 (A:) Prefoldin beta subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure