Citrus Sinensis ID: 004698
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 736 | ||||||
| 224077052 | 1070 | predicted protein [Populus trichocarpa] | 0.937 | 0.644 | 0.811 | 0.0 | |
| 255536707 | 1065 | interferon-induced guanylate-binding pro | 0.978 | 0.676 | 0.773 | 0.0 | |
| 356548658 | 1060 | PREDICTED: uncharacterized protein LOC10 | 0.991 | 0.688 | 0.764 | 0.0 | |
| 356521418 | 1060 | PREDICTED: uncharacterized protein LOC10 | 0.991 | 0.688 | 0.763 | 0.0 | |
| 145358912 | 1082 | Guanylate-binding protein [Arabidopsis t | 0.983 | 0.669 | 0.744 | 0.0 | |
| 449433796 | 1062 | PREDICTED: uncharacterized protein LOC10 | 0.975 | 0.676 | 0.776 | 0.0 | |
| 356546617 | 1059 | PREDICTED: uncharacterized protein LOC10 | 0.971 | 0.675 | 0.764 | 0.0 | |
| 9757727 | 1060 | unnamed protein product [Arabidopsis tha | 0.953 | 0.662 | 0.715 | 0.0 | |
| 222632561 | 1062 | hypothetical protein OsJ_19548 [Oryza sa | 0.918 | 0.636 | 0.688 | 0.0 | |
| 242091367 | 1051 | hypothetical protein SORBIDRAFT_09g02844 | 0.953 | 0.667 | 0.647 | 0.0 |
| >gi|224077052|ref|XP_002305110.1| predicted protein [Populus trichocarpa] gi|222848074|gb|EEE85621.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 1185 bits (3065), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 560/690 (81%), Positives = 629/690 (91%)
Query: 36 VTGPARPIRLVYCDEKGKFRMDPEAVAALQLVKEPIGVVSVCGRARQGKSFILNQLLGRS 95
VTGPARPIRLVY DEKGKFRMD EAVAALQLVKEPIGVVSVCGR+RQGKSFILNQLLGRS
Sbjct: 37 VTGPARPIRLVYYDEKGKFRMDSEAVAALQLVKEPIGVVSVCGRSRQGKSFILNQLLGRS 96
Query: 96 SGFQVASTHRPCTKGLWLWSAPLKRTALDGTEYNLLLLDSEGIDAYDQTGTYSTQIFSLA 155
SGFQVASTHRPCTKGLWLWSAPLKRTALDGTEYNLLLLDSEGIDA+DQTGTYSTQIFSLA
Sbjct: 97 SGFQVASTHRPCTKGLWLWSAPLKRTALDGTEYNLLLLDSEGIDAFDQTGTYSTQIFSLA 156
Query: 156 VLLSSMFIYNQMGGIDESAIDRLSLVTQMTKHIRIRASGGKTTPSELGQFSPIFVWLLRD 215
VLLSSMFIYNQMGGIDE+A+DRLSLVTQMTKHIR+RASGG+++ SELGQFSPIFVWLLRD
Sbjct: 157 VLLSSMFIYNQMGGIDEAALDRLSLVTQMTKHIRVRASGGRSSASELGQFSPIFVWLLRD 216
Query: 216 FYLDLVEDNRKITPRDYLEIALRPVQGSGRDIAAKNEIRDSIRALFPDRECFTLVRPLSN 275
FYLDLVEDN++ITPRDYLE+ALRPVQGSG+DIAAKNEIRDSIRALFPDRECF LVRPL+N
Sbjct: 217 FYLDLVEDNKRITPRDYLELALRPVQGSGKDIAAKNEIRDSIRALFPDRECFPLVRPLNN 276
Query: 276 ENELQRLDQISLDRLRPEFRAGLDALTKFVFERTRPKQVGATVLTGPVLIGITESYLDAI 335
EN+LQR+DQISLD+LRPEFRAGLDALTKFVFERTRPKQVGATV+TGP+L+GITESYL+A+
Sbjct: 277 ENDLQRMDQISLDKLRPEFRAGLDALTKFVFERTRPKQVGATVMTGPILVGITESYLEAL 336
Query: 336 NNGAVPTISSSWQSVEEAECRRAYDSATETYMSTFDRSKPPEEVALGEAHEAAVQKALAV 395
NNGAVPTISSSWQSVEEAECRRAYD+ATE YMS+FDRSKPPEEV L E+H+ AVQK+LA
Sbjct: 337 NNGAVPTISSSWQSVEEAECRRAYDTATEIYMSSFDRSKPPEEVFLRESHDEAVQKSLAA 396
Query: 396 YNAGAVGVGLARKKYEGLLQKFFRKAFEDHKKNVYMEADIRCSSAIQSMERKLRAACHSS 455
+NA AVG+G ARKKYEGLLQKFFR+A ED+K+N +MEAD+RCS+AIQ+ME++LRAACH+S
Sbjct: 397 FNAAAVGIGSARKKYEGLLQKFFRRALEDYKRNAFMEADLRCSNAIQNMEKRLRAACHAS 456
Query: 456 DASIDNVVKVLDGLISEYETSCHGPGKWQKLATFLQQSSEGPILDLVKRLIDQIGSERSS 515
DA+IDN+VKVLDGL+SEYETSCHGPGKWQKLA FLQQS EG ILDL KRL D+IGSE+SS
Sbjct: 457 DANIDNIVKVLDGLLSEYETSCHGPGKWQKLAMFLQQSLEGSILDLAKRLNDKIGSEKSS 516
Query: 516 LMLKYRSIEDNMKLLKKQLEDSERYKSEYLKRYDDAINDKKKLADDYTSRINNLQGENIS 575
LML+ S+ED M LL KQLE SE+ KSEY+KRYD+AIN+KKKLADDY RIN+LQ S
Sbjct: 517 LMLRCHSMEDKMALLHKQLEASEKDKSEYMKRYDEAINEKKKLADDYMRRINDLQSNRGS 576
Query: 576 LREKSSSLSKTVDSLKNEISDWKRKYDQVLTKQKAMEDQVCSEIEVLKSRSTAAEARLAA 635
L E+ SSL K ++S K E S+WKRK+DQVL+KQKA E+Q SEI +LKSRS+A+EARLAA
Sbjct: 577 LDERCSSLVKALESAKQETSNWKRKHDQVLSKQKADEEQAASEIAILKSRSSASEARLAA 636
Query: 636 AREQALSAQEEVEEWKRKYGVAVREAKAALEKAAIVQERTSKEMQQREDVLREEFSSTLA 695
A EQ SA+E+ EWKRKY +AVRE KAALEKAA VQERT+KE Q RED LREEFSS L
Sbjct: 637 AHEQTRSAEEDAAEWKRKYDIAVRETKAALEKAANVQERTNKETQLREDALREEFSSHLV 696
Query: 696 EKEEEMKEKATKIEHAEQCLTTLRLELKVS 725
KE+E+KEK +IE+AEQCLT L LELK +
Sbjct: 697 VKEDEIKEKNRRIEYAEQCLTALNLELKAA 726
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255536707|ref|XP_002509420.1| interferon-induced guanylate-binding protein, putative [Ricinus communis] gi|223549319|gb|EEF50807.1| interferon-induced guanylate-binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356548658|ref|XP_003542717.1| PREDICTED: uncharacterized protein LOC100808644 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356521418|ref|XP_003529353.1| PREDICTED: uncharacterized protein LOC100796442 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|145358912|ref|NP_199419.2| Guanylate-binding protein [Arabidopsis thaliana] gi|332007951|gb|AED95334.1| Guanylate-binding protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|449433796|ref|XP_004134683.1| PREDICTED: uncharacterized protein LOC101220489 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356546617|ref|XP_003541721.1| PREDICTED: uncharacterized protein LOC100776402 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|9757727|dbj|BAB08252.1| unnamed protein product [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|222632561|gb|EEE64693.1| hypothetical protein OsJ_19548 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|242091367|ref|XP_002441516.1| hypothetical protein SORBIDRAFT_09g028440 [Sorghum bicolor] gi|241946801|gb|EES19946.1| hypothetical protein SORBIDRAFT_09g028440 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 736 | ||||||
| TAIR|locus:2161358 | 1082 | AT5G46070 [Arabidopsis thalian | 0.983 | 0.669 | 0.704 | 1.3e-274 | |
| UNIPROTKB|F1N9J3 | 623 | GBP7 "Uncharacterized protein" | 0.684 | 0.808 | 0.297 | 5.4e-59 | |
| RGD|1561523 | 558 | Mpa2l "macrophage activation 2 | 0.483 | 0.637 | 0.351 | 1.1e-58 | |
| ZFIN|ZDB-GENE-070705-98 | 645 | si:ch211-209n20.1 "si:ch211-20 | 0.748 | 0.854 | 0.291 | 4e-58 | |
| ZFIN|ZDB-GENE-070912-618 | 630 | gbp2 "guanylate binding protei | 0.766 | 0.895 | 0.270 | 2.4e-53 | |
| UNIPROTKB|F1N1I1 | 629 | LOC781225 "Uncharacterized pro | 0.744 | 0.871 | 0.287 | 3.8e-53 | |
| ZFIN|ZDB-GENE-041210-233 | 618 | si:dkey-61p9.3 "si:dkey-61p9.3 | 0.524 | 0.624 | 0.340 | 8e-53 | |
| UNIPROTKB|F6PPP4 | 579 | Bt.37579 "Uncharacterized prot | 0.740 | 0.941 | 0.281 | 1.4e-52 | |
| ZFIN|ZDB-GENE-060531-46 | 618 | gbp4 "guanylate binding protei | 0.524 | 0.624 | 0.338 | 1.7e-52 | |
| UNIPROTKB|Q9H0R5 | 595 | GBP3 "Guanylate-binding protei | 0.729 | 0.902 | 0.283 | 2.7e-52 |
| TAIR|locus:2161358 AT5G46070 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 2640 (934.4 bits), Expect = 1.3e-274, P = 1.3e-274
Identities = 510/724 (70%), Positives = 587/724 (81%)
Query: 2 MMKFFGKGKDSSPYXXXXXXXXXXXXXXXXXXXXVTGPARPIRLVYCDEKGKFRMDPEAV 61
M FFG+G SP VTGP RPIRLVYCDEKGKFRMDPEAV
Sbjct: 1 MRSFFGRGGKDSPADSASPSPRSYPSTSPASSSAVTGPPRPIRLVYCDEKGKFRMDPEAV 60
Query: 62 AALQLVKEPIGVVSVCGRARQGKSFILNQLLGRSSGFQVASTHRPCTKGLWLWSAPLKRT 121
A LQLVKEPIGVVSVCGRARQGKSFILNQLLGRS+GFQVASTH+PCTKGLWLWS+P+KRT
Sbjct: 61 ATLQLVKEPIGVVSVCGRARQGKSFILNQLLGRSNGFQVASTHKPCTKGLWLWSSPIKRT 120
Query: 122 ALDGTEYNLLLLDSEGIDAYDQTGTYSTQIFSLAVLLSSMFIYNQMGGIDESAIDRLSLV 181
ALDGTEYNLLLLDSEGIDAYDQTGTYSTQIFSLAVLLSSMF+YNQMGGIDE+++DRLSLV
Sbjct: 121 ALDGTEYNLLLLDSEGIDAYDQTGTYSTQIFSLAVLLSSMFVYNQMGGIDEASLDRLSLV 180
Query: 182 TQMTKHIRIRASGGKTTPSELGQFSPIFVWLLRDFYLDLVEDNRKITPRDYLEIALRPVQ 241
TQMTKHIR++ASGG ++ SELGQFSPIFVWLLRDFYLDLVEDNRKI+PRDYLEIALRPVQ
Sbjct: 181 TQMTKHIRVKASGGTSSRSELGQFSPIFVWLLRDFYLDLVEDNRKISPRDYLEIALRPVQ 240
Query: 242 GSGRDIAAKNEIRDSIRALFPDRECFTLVRPLSNENELQRLDQISLDRLRPEFRAGLDAL 301
GSG DI AKNEIRDSIRALFPDRECFTLVRPL+NE +LQRLDQISL++LRPEF AGLDA
Sbjct: 241 GSGGDIGAKNEIRDSIRALFPDRECFTLVRPLNNEKDLQRLDQISLEKLRPEFGAGLDAF 300
Query: 302 TKFVFERTRPKQVGATVLTGPVLIGITESYLDAINNGAVPTISSSWQSVEEAECRRAYDS 361
TKFVFE+TRPKQ+G TV+TGP+L+GIT+SYLDA+NNGAVPTI+SSWQSVEE ECRRAYDS
Sbjct: 301 TKFVFEKTRPKQLGGTVMTGPILVGITQSYLDALNNGAVPTITSSWQSVEETECRRAYDS 360
Query: 362 ATETYMSTFDRSKPPEEVALGEAHEAAVQKALAVYNAGAVGVGLARKKYEGLLQKFFRKA 421
E YM+ FD+SK PEE AL E HE AV+KALA++N+ AVG G ARKK+E LL K +K
Sbjct: 361 GVEAYMAAFDQSKAPEEGALREEHEEAVRKALAIFNSNAVGNGSARKKFEDLLHKDLKKK 420
Query: 422 FEDHKKNVYMEADIRCSSAIQSMERKLRAACHSSDASIDNVVKVLDGLISEYETSCHGPG 481
FED+KKN +MEAD+RC+S IQ ME++LRAACH+S+A++DNVVKVL+ ++EYE SCHGPG
Sbjct: 421 FEDYKKNAFMEADLRCTSTIQRMEKQLRAACHASNANMDNVVKVLEARLAEYEASCHGPG 480
Query: 482 KWQKLATFLQQSSEGPILDLVKRLIDQIGSERSSLMLKYRSIEDNMKLLKKQLEDSERYK 541
KWQKL+ FLQQS EGPI DL KRLID I E++SL +K+RS+ED MK LK+QL+DSERYK
Sbjct: 481 KWQKLSVFLQQSLEGPIYDLTKRLIDSIAIEKNSLAMKFRSVEDAMKHLKQQLDDSERYK 540
Query: 542 SEYLKRYDDAINDKKKLADDYTSRINNLQGENISLREKSSSLSKTVDSLKNEISDWKRKY 601
EY KRYD++ NDKKKL D Y RI LQGEN SL E+ S+L KTV+S K EI +W R Y
Sbjct: 541 LEYQKRYDESNNDKKKLEDIYRERITKLQGENSSLNERCSTLVKTVESKKEEIKEWIRNY 600
Query: 602 DQVLTKQKAMEDQVCSEIEVLKSRSTXXXXXXXXXXXXXXXXXXXVEEWKRKYGVAVREA 661
DQ++ KQKA+++Q+ SE+EVL++RST +EWKRKY AV EA
Sbjct: 601 DQIVLKQKAVQEQLSSEMEVLRTRSTTSEARVAAAREQAKSAAEETKEWKRKYDYAVGEA 660
Query: 662 KAALEKAAIVQERTSKEMQQREDVLREEFSSTLAXXXXXXXXXXXXXXHAEQCLTTLRLE 721
++AL+KAA VQER+ KE Q RED LREEFS TLA AEQ LT LR +
Sbjct: 661 RSALQKAASVQERSGKETQLREDALREEFSITLANKDEEITEKATKLEKAEQSLTVLRSD 720
Query: 722 LKVS 725
LKV+
Sbjct: 721 LKVA 724
|
|
| UNIPROTKB|F1N9J3 GBP7 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| RGD|1561523 Mpa2l "macrophage activation 2 like" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-070705-98 si:ch211-209n20.1 "si:ch211-209n20.1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-070912-618 gbp2 "guanylate binding protein 2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N1I1 LOC781225 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-041210-233 si:dkey-61p9.3 "si:dkey-61p9.3" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F6PPP4 Bt.37579 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-060531-46 gbp4 "guanylate binding protein 4" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9H0R5 GBP3 "Guanylate-binding protein 3" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| eugene3.00040459 | hypothetical protein (1070 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 736 | |||
| cd01851 | 224 | cd01851, GBP, Guanylate-binding protein (GBP) fami | 3e-63 | |
| pfam02263 | 264 | pfam02263, GBP, Guanylate-binding protein, N-termi | 2e-62 | |
| pfam02841 | 297 | pfam02841, GBP_C, Guanylate-binding protein, C-ter | 2e-28 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-10 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-09 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 5e-08 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 2e-07 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 6e-07 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 1e-06 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-06 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 2e-06 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 3e-06 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 5e-06 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-05 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 2e-05 | |
| TIGR03319 | 514 | TIGR03319, RNase_Y, ribonuclease Y | 2e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-05 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 3e-05 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 4e-05 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 4e-05 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 1e-04 | |
| COG1579 | 239 | COG1579, COG1579, Zn-ribbon protein, possibly nucl | 1e-04 | |
| PHA02562 | 562 | PHA02562, 46, endonuclease subunit; Provisional | 2e-04 | |
| pfam01576 | 859 | pfam01576, Myosin_tail_1, Myosin tail | 4e-04 | |
| PRK01156 | 895 | PRK01156, PRK01156, chromosome segregation protein | 4e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 5e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.001 | |
| pfam02841 | 297 | pfam02841, GBP_C, Guanylate-binding protein, C-ter | 0.002 | |
| pfam08764 | 282 | pfam08764, Coagulase, Staphylococcus aureus coagul | 0.002 | |
| pfam09726 | 680 | pfam09726, Macoilin, Transmembrane protein | 0.002 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 0.003 | |
| TIGR01843 | 423 | TIGR01843, type_I_hlyD, type I secretion membrane | 0.004 | |
| pfam05483 | 787 | pfam05483, SCP-1, Synaptonemal complex protein 1 ( | 0.004 |
| >gnl|CDD|206650 cd01851, GBP, Guanylate-binding protein (GBP) family (N-terminal domain) | Back alignment and domain information |
|---|
Score = 209 bits (535), Expect = 3e-63
Identities = 81/245 (33%), Positives = 112/245 (45%), Gaps = 22/245 (8%)
Query: 65 QLVKEPIGVVSVCGRARQGKSFILNQLLGRSSGFQVASTHRPCTKGLWLWSAPLKRTALD 124
V P+ VVSV G GKSF+LN L G S GF V T + TKG+W+WS P K T D
Sbjct: 1 LDVGFPVVVVSVFGSQSSGKSFLLNHLFGTSDGFDVMDTSQQTTKGIWMWSDPFKDT--D 58
Query: 125 GTEYNLLLLDSEGIDAYDQT-GTYSTQIFSLAVLLSSMFIYNQMGGIDESAIDRLSLVTQ 183
G ++ +LLLD+EG D ++ ++F+LA LLSS+ IYN I +D+L + +
Sbjct: 59 GKKHAVLLLDTEGTDGRERGEFENDARLFALATLLSSVLIYNMWQTILGDDLDKLMGLLK 118
Query: 184 MTKHIRIRASGGKTTPSELGQFSPIFVWLLRDFYLDLVEDNRKITPRDYLEIALRPVQGS 243
+ G + P+ ++++RDF + +T + S
Sbjct: 119 TAL-----ETLGLAGLHNFSKPKPLLLFVVRDFTGPTPLEGLDVT------------EKS 161
Query: 244 GRDIAAKNEIRDSIRALFPDRECFTLVRPLSNENELQRLDQISLDRLRPEFRAGLDALTK 303
I N+I SIR F CF L P LQ L L PEFR L AL +
Sbjct: 162 ETLIEELNKIWSSIRKPFTPITCFVLPHPGLLHKLLQN--DGRLKDLPPEFRKALKALRQ 219
Query: 304 FVFER 308
F
Sbjct: 220 RFFSS 224
|
Guanylate-binding protein (GBP), N-terminal domain. Guanylate-binding proteins (GBPs) define a group of proteins that are synthesized after activation of the cell by interferons. The biochemical properties of GBPs are clearly different from those of Ras-like and heterotrimeric GTP-binding proteins. They bind guanine nucleotides with low affinity (micromolar range), are stable in their absence and have a high turnover GTPase. In addition to binding GDP/GTP, they have the unique ability to bind GMP with equal affinity and hydrolyze GTP not only to GDP, but also to GMP. Furthermore, two unique regions around the base and the phosphate-binding areas, the guanine and the phosphate caps, respectively, give the nucleotide-binding site a unique appearance not found in the canonical GTP-binding proteins. The phosphate cap, which constitutes the region analogous to switch I, completely shields the phosphate-binding site from solvent such that a potential GTPase-activating protein (GAP) cannot approach. Length = 224 |
| >gnl|CDD|111185 pfam02263, GBP, Guanylate-binding protein, N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|202427 pfam02841, GBP_C, Guanylate-binding protein, C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|222878 PHA02562, 46, endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|144972 pfam01576, Myosin_tail_1, Myosin tail | Back alignment and domain information |
|---|
| >gnl|CDD|100796 PRK01156, PRK01156, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|202427 pfam02841, GBP_C, Guanylate-binding protein, C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|204055 pfam08764, Coagulase, Staphylococcus aureus coagulase | Back alignment and domain information |
|---|
| >gnl|CDD|220365 pfam09726, Macoilin, Transmembrane protein | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130902 TIGR01843, type_I_hlyD, type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >gnl|CDD|114219 pfam05483, SCP-1, Synaptonemal complex protein 1 (SCP-1) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 736 | |||
| PF02263 | 260 | GBP: Guanylate-binding protein, N-terminal domain; | 100.0 | |
| KOG2037 | 552 | consensus Guanylate-binding protein [General funct | 100.0 | |
| cd01851 | 224 | GBP Guanylate-binding protein (GBP), N-terminal do | 100.0 | |
| PF02841 | 297 | GBP_C: Guanylate-binding protein, C-terminal domai | 100.0 | |
| KOG2037 | 552 | consensus Guanylate-binding protein [General funct | 99.97 | |
| PF05879 | 742 | RHD3: Root hair defective 3 GTP-binding protein (R | 99.96 | |
| KOG2203 | 772 | consensus GTP-binding protein [General function pr | 99.95 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 99.31 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 99.01 | |
| KOG4181 | 491 | consensus Uncharacterized conserved protein [Funct | 98.86 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 98.41 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 98.38 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 98.34 | |
| COG1159 | 298 | Era GTPase [General function prediction only] | 98.28 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 98.25 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 98.25 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 98.25 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 98.23 | |
| cd01852 | 196 | AIG1 AIG1 (avrRpt2-induced gene 1). This represent | 98.2 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 98.2 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 98.19 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 98.19 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 98.18 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 98.16 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 98.12 | |
| PF04548 | 212 | AIG1: AIG1 family; InterPro: IPR006703 This entry | 98.11 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 98.11 | |
| PF01926 | 116 | MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I | 98.08 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 98.08 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 98.06 | |
| cd01853 | 249 | Toc34_like Toc34-like (Translocon at the Outer-env | 98.04 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 98.01 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 98.01 | |
| TIGR00993 | 763 | 3a0901s04IAP86 chloroplast protein import componen | 97.99 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 97.99 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 97.98 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 97.98 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 97.98 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 97.93 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 97.9 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 97.89 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 97.89 | |
| PF05010 | 207 | TACC: Transforming acidic coiled-coil-containing p | 97.88 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 97.88 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 97.84 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 97.81 | |
| PRK00089 | 292 | era GTPase Era; Reviewed | 97.79 | |
| PF00350 | 168 | Dynamin_N: Dynamin family; InterPro: IPR001401 Mem | 97.77 | |
| PRK11637 | 428 | AmiB activator; Provisional | 97.76 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 97.76 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 97.75 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 97.74 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 97.72 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 97.69 | |
| KOG1853 | 333 | consensus LIS1-interacting protein NUDE [Cytoskele | 97.64 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 97.64 | |
| PF02421 | 156 | FeoB_N: Ferrous iron transport protein B; InterPro | 97.64 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 97.64 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 97.63 | |
| TIGR00436 | 270 | era GTP-binding protein Era. Era is an essential G | 97.62 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 97.61 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 97.6 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 97.6 | |
| PRK10698 | 222 | phage shock protein PspA; Provisional | 97.59 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 97.57 | |
| TIGR03598 | 179 | GTPase_YsxC ribosome biogenesis GTP-binding protei | 97.57 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 97.57 | |
| cd04163 | 168 | Era Era subfamily. Era (E. coli Ras-like protein) | 97.56 | |
| PF02841 | 297 | GBP_C: Guanylate-binding protein, C-terminal domai | 97.56 | |
| PF10220 | 895 | DUF2146: Uncharacterized conserved protein (DUF214 | 97.55 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 97.54 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 97.54 | |
| PF05010 | 207 | TACC: Transforming acidic coiled-coil-containing p | 97.53 | |
| cd01858 | 157 | NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei | 97.53 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 97.49 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 97.45 | |
| KOG1003 | 205 | consensus Actin filament-coating protein tropomyos | 97.44 | |
| TIGR00991 | 313 | 3a0901s02IAP34 GTP-binding protein (Chloroplast En | 97.4 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 97.36 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 97.35 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 97.34 | |
| cd01850 | 276 | CDC_Septin CDC/Septin. Septins are a conserved fam | 97.34 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 97.33 | |
| PF03193 | 161 | DUF258: Protein of unknown function, DUF258; Inter | 97.33 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 97.32 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 97.3 | |
| cd01849 | 155 | YlqF_related_GTPase YlqF-related GTPases. These pr | 97.3 | |
| cd01894 | 157 | EngA1 EngA1 subfamily. This CD represents the firs | 97.3 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 97.28 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 97.27 | |
| cd01878 | 204 | HflX HflX subfamily. A distinct conserved domain w | 97.21 | |
| cd04101 | 164 | RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove | 97.21 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 97.2 | |
| cd04178 | 172 | Nucleostemin_like Nucleostemin-like. Nucleostemin | 97.18 | |
| cd01897 | 168 | NOG NOG1 is a nucleolar GTP-binding protein presen | 97.18 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 97.17 | |
| cd00880 | 163 | Era_like Era (E. coli Ras-like protein)-like. This | 97.15 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 97.15 | |
| KOG1423 | 379 | consensus Ras-like GTPase ERA [Cell cycle control, | 97.14 | |
| PRK09039 | 343 | hypothetical protein; Validated | 97.13 | |
| cd01898 | 170 | Obg Obg subfamily. The Obg nucleotide binding prot | 97.13 | |
| cd04104 | 197 | p47_IIGP_like p47 (47-kDa) family. The p47 GTPase | 97.12 | |
| KOG0999 | 772 | consensus Microtubule-associated protein Bicaudal- | 97.1 | |
| TIGR00231 | 161 | small_GTP small GTP-binding protein domain. This m | 97.09 | |
| PF15066 | 527 | CAGE1: Cancer-associated gene protein 1 family | 97.08 | |
| PRK09039 | 343 | hypothetical protein; Validated | 97.06 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 97.05 | |
| cd04164 | 157 | trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein | 97.04 | |
| PRK12289 | 352 | GTPase RsgA; Reviewed | 97.03 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 97.01 | |
| cd04171 | 164 | SelB SelB subfamily. SelB is an elongation factor | 97.0 | |
| cd04142 | 198 | RRP22 RRP22 subfamily. RRP22 (Ras-related protein | 96.98 | |
| cd01890 | 179 | LepA LepA subfamily. LepA belongs to the GTPase fa | 96.98 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 96.97 | |
| cd01876 | 170 | YihA_EngB The YihA (EngB) subfamily. This subfamil | 96.97 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 96.96 | |
| cd01857 | 141 | HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t | 96.95 | |
| PRK15494 | 339 | era GTPase Era; Provisional | 96.95 | |
| PRK00454 | 196 | engB GTP-binding protein YsxC; Reviewed | 96.94 | |
| PRK12288 | 347 | GTPase RsgA; Reviewed | 96.92 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 96.92 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 96.91 | |
| TIGR02977 | 219 | phageshock_pspA phage shock protein A. Members of | 96.9 | |
| PRK12298 | 390 | obgE GTPase CgtA; Reviewed | 96.9 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 96.9 | |
| cd01861 | 161 | Rab6 Rab6 subfamily. Rab6 is involved in microtubu | 96.89 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 96.87 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 96.81 | |
| cd01855 | 190 | YqeH YqeH. YqeH is an essential GTP-binding protei | 96.8 | |
| cd01868 | 165 | Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a | 96.79 | |
| TIGR02836 | 492 | spore_IV_A stage IV sporulation protein A. A compa | 96.79 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 96.79 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 96.79 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 96.78 | |
| PF05049 | 376 | IIGP: Interferon-inducible GTPase (IIGP); InterPro | 96.77 | |
| COG1161 | 322 | Predicted GTPases [General function prediction onl | 96.77 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 96.75 | |
| cd04119 | 168 | RJL RJL (RabJ-Like) subfamily. RJLs are found in m | 96.75 | |
| cd00882 | 157 | Ras_like_GTPase Ras-like GTPase superfamily. The R | 96.75 | |
| cd01887 | 168 | IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo | 96.75 | |
| PF04012 | 221 | PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T | 96.74 | |
| PF08477 | 119 | Miro: Miro-like protein; InterPro: IPR013684 Mitoc | 96.73 | |
| COG1084 | 346 | Predicted GTPase [General function prediction only | 96.73 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 96.73 | |
| PRK09563 | 287 | rbgA GTPase YlqF; Reviewed | 96.72 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 96.7 | |
| cd01864 | 165 | Rab19 Rab19 subfamily. Rab19 proteins are associat | 96.7 | |
| COG3840 | 231 | ThiQ ABC-type thiamine transport system, ATPase co | 96.69 | |
| PF13870 | 177 | DUF4201: Domain of unknown function (DUF4201) | 96.69 | |
| PRK11058 | 426 | GTPase HflX; Provisional | 96.68 | |
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 96.67 | |
| cd01866 | 168 | Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg | 96.67 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 96.66 | |
| cd00154 | 159 | Rab Rab family. Rab GTPases form the largest famil | 96.65 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 96.62 | |
| cd04113 | 161 | Rab4 Rab4 subfamily. Rab4 has been implicated in n | 96.62 | |
| PF09787 | 511 | Golgin_A5: Golgin subfamily A member 5; InterPro: | 96.62 | |
| cd01895 | 174 | EngA2 EngA2 subfamily. This CD represents the seco | 96.6 | |
| cd01881 | 176 | Obg_like The Obg-like subfamily consists of five w | 96.6 | |
| cd00881 | 189 | GTP_translation_factor GTP translation factor fami | 96.59 | |
| cd04145 | 164 | M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf | 96.58 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 96.58 | |
| cd01860 | 163 | Rab5_related Rab5-related subfamily. This subfamil | 96.58 | |
| PRK10698 | 222 | phage shock protein PspA; Provisional | 96.58 | |
| PRK00098 | 298 | GTPase RsgA; Reviewed | 96.57 | |
| cd01865 | 165 | Rab3 Rab3 subfamily. The Rab3 subfamily contains R | 96.56 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 96.56 | |
| cd04118 | 193 | Rab24 Rab24 subfamily. Rab24 is distinct from othe | 96.56 | |
| cd04122 | 166 | Rab14 Rab14 subfamily. Rab14 GTPases are localized | 96.55 | |
| smart00175 | 164 | RAB Rab subfamily of small GTPases. Rab GTPases ar | 96.53 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 96.52 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 96.52 | |
| cd04139 | 164 | RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) | 96.52 | |
| COG3596 | 296 | Predicted GTPase [General function prediction only | 96.52 | |
| PF00009 | 188 | GTP_EFTU: Elongation factor Tu GTP binding domain; | 96.51 | |
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 96.51 | |
| COG5019 | 373 | CDC3 Septin family protein [Cell division and chro | 96.51 | |
| TIGR03156 | 351 | GTP_HflX GTP-binding protein HflX. This protein fa | 96.5 | |
| cd04106 | 162 | Rab23_lke Rab23-like subfamily. Rab23 is a member | 96.5 | |
| cd01896 | 233 | DRG The developmentally regulated GTP-binding prot | 96.5 | |
| cd04159 | 159 | Arl10_like Arl10-like subfamily. Arl9/Arl10 was id | 96.5 | |
| cd04112 | 191 | Rab26 Rab26 subfamily. First identified in rat pan | 96.47 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 96.46 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 96.46 | |
| KOG0946 | 970 | consensus ER-Golgi vesicle-tethering protein p115 | 96.45 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 96.45 | |
| COG1160 | 444 | Predicted GTPases [General function prediction onl | 96.45 | |
| TIGR00157 | 245 | ribosome small subunit-dependent GTPase A. The Aqu | 96.44 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 96.44 | |
| cd01856 | 171 | YlqF YlqF. Proteins of the YlqF family contain all | 96.43 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 96.43 | |
| KOG1003 | 205 | consensus Actin filament-coating protein tropomyos | 96.43 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 96.42 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 96.42 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 96.41 | |
| cd04124 | 161 | RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily | 96.4 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 96.39 | |
| cd04116 | 170 | Rab9 Rab9 subfamily. Rab9 is found in late endosom | 96.39 | |
| smart00173 | 164 | RAS Ras subfamily of RAS small GTPases. Similar in | 96.39 | |
| cd01862 | 172 | Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th | 96.38 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 96.37 | |
| cd04136 | 163 | Rap_like Rap-like subfamily. The Rap subfamily con | 96.37 | |
| cd01867 | 167 | Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp | 96.37 | |
| cd01854 | 287 | YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil | 96.37 | |
| cd01869 | 166 | Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev | 96.36 | |
| KOG1899 | 861 | consensus LAR transmembrane tyrosine phosphatase-i | 96.34 | |
| cd04138 | 162 | H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, | 96.33 | |
| KOG2655 | 366 | consensus Septin family protein (P-loop GTPase) [C | 96.32 | |
| cd01891 | 194 | TypA_BipA TypA (tyrosine phosphorylated protein A) | 96.31 | |
| cd04109 | 215 | Rab28 Rab28 subfamily. First identified in maize, | 96.31 | |
| PRK04213 | 201 | GTP-binding protein; Provisional | 96.3 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 96.3 | |
| COG1116 | 248 | TauB ABC-type nitrate/sulfonate/bicarbonate transp | 96.29 | |
| cd04115 | 170 | Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u | 96.28 | |
| PF00735 | 281 | Septin: Septin; InterPro: IPR000038 Septins consti | 96.26 | |
| TIGR03594 | 429 | GTPase_EngA ribosome-associated GTPase EngA. EngA | 96.26 | |
| cd04127 | 180 | Rab27A Rab27a subfamily. The Rab27a subfamily cons | 96.25 | |
| cd00879 | 190 | Sar1 Sar1 subfamily. Sar1 is an essential componen | 96.24 | |
| cd01863 | 161 | Rab18 Rab18 subfamily. Mammalian Rab18 is implicat | 96.24 | |
| TIGR03596 | 276 | GTPase_YlqF ribosome biogenesis GTP-binding protei | 96.24 | |
| KOG1547 | 336 | consensus Septin CDC10 and related P-loop GTPases | 96.24 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 96.23 | |
| cd00876 | 160 | Ras Ras family. The Ras family of the Ras superfam | 96.22 | |
| cd00877 | 166 | Ran Ran (Ras-related nuclear proteins) /TC4 subfam | 96.2 | |
| cd04155 | 173 | Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f | 96.2 | |
| cd00157 | 171 | Rho Rho (Ras homology) family. Members of the Rho | 96.19 | |
| cd04110 | 199 | Rab35 Rab35 subfamily. Rab35 is one of several Rab | 96.18 | |
| PLN03118 | 211 | Rab family protein; Provisional | 96.17 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 96.17 | |
| cd04166 | 208 | CysN_ATPS CysN_ATPS subfamily. CysN, together with | 96.16 | |
| cd04111 | 211 | Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 | 96.15 | |
| PRK00093 | 435 | GTP-binding protein Der; Reviewed | 96.15 | |
| PF05483 | 786 | SCP-1: Synaptonemal complex protein 1 (SCP-1); Int | 96.13 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 96.13 | |
| cd04123 | 162 | Rab21 Rab21 subfamily. The localization and functi | 96.13 | |
| cd04177 | 168 | RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the | 96.13 | |
| cd04137 | 180 | RheB Rheb (Ras Homolog Enriched in Brain) subfamil | 96.11 | |
| cd01859 | 156 | MJ1464 MJ1464. This family represents archaeal GTP | 96.1 | |
| cd04125 | 188 | RabA_like RabA-like subfamily. RabA was first iden | 96.09 | |
| COG0486 | 454 | ThdF Predicted GTPase [General function prediction | 96.09 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 96.08 | |
| cd04107 | 201 | Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 | 96.08 | |
| cd04146 | 165 | RERG_RasL11_like RERG/RasL11-like subfamily. RERG | 96.07 | |
| cd01889 | 192 | SelB_euk SelB subfamily. SelB is an elongation fac | 96.07 | |
| PF14073 | 178 | Cep57_CLD: Centrosome localisation domain of Cep57 | 96.06 | |
| PRK10929 | 1109 | putative mechanosensitive channel protein; Provisi | 96.06 | |
| smart00178 | 184 | SAR Sar1p-like members of the Ras-family of small | 96.05 | |
| TIGR03594 | 429 | GTPase_EngA ribosome-associated GTPase EngA. EngA | 96.05 | |
| TIGR00450 | 442 | mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE | 96.03 | |
| cd01870 | 175 | RhoA_like RhoA-like subfamily. The RhoA subfamily | 96.03 | |
| PF09787 | 511 | Golgin_A5: Golgin subfamily A member 5; InterPro: | 96.01 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 96.0 | |
| PRK05291 | 449 | trmE tRNA modification GTPase TrmE; Reviewed | 96.0 | |
| PF14073 | 178 | Cep57_CLD: Centrosome localisation domain of Cep57 | 95.99 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 95.99 | |
| cd01879 | 158 | FeoB Ferrous iron transport protein B (FeoB) subfa | 95.99 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 95.97 | |
| cd04135 | 174 | Tc10 TC10 subfamily. TC10 is a Rho family protein | 95.97 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 95.96 | |
| cd01893 | 166 | Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr | 95.95 | |
| PRK12299 | 335 | obgE GTPase CgtA; Reviewed | 95.94 | |
| cd04156 | 160 | ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su | 95.94 | |
| COG1162 | 301 | Predicted GTPases [General function prediction onl | 95.93 | |
| PRK03003 | 472 | GTP-binding protein Der; Reviewed | 95.91 | |
| PTZ00258 | 390 | GTP-binding protein; Provisional | 95.91 | |
| cd04117 | 161 | Rab15 Rab15 subfamily. Rab15 colocalizes with the | 95.9 | |
| cd04114 | 169 | Rab30 Rab30 subfamily. Rab30 appears to be associa | 95.9 | |
| cd04140 | 165 | ARHI_like ARHI subfamily. ARHI (A Ras homolog memb | 95.88 | |
| smart00174 | 174 | RHO Rho (Ras homology) subfamily of Ras-like small | 95.88 | |
| PRK03003 | 472 | GTP-binding protein Der; Reviewed | 95.88 | |
| cd04175 | 164 | Rap1 Rap1 subgroup. The Rap1 subgroup is part of t | 95.87 | |
| PRK00093 | 435 | GTP-binding protein Der; Reviewed | 95.85 | |
| cd04153 | 174 | Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a | 95.85 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 95.85 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 95.84 | |
| KOG0448 | 749 | consensus Mitofusin 1 GTPase, involved in mitochon | 95.83 | |
| cd04157 | 162 | Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub | 95.81 | |
| PLN03110 | 216 | Rab GTPase; Provisional | 95.79 | |
| cd04160 | 167 | Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote | 95.79 | |
| cd04176 | 163 | Rap2 Rap2 subgroup. The Rap2 subgroup is part of t | 95.77 | |
| cd04170 | 268 | EF-G_bact Elongation factor G (EF-G) subfamily. Tr | 95.73 | |
| cd01884 | 195 | EF_Tu EF-Tu subfamily. This subfamily includes ort | 95.73 | |
| cd04132 | 187 | Rho4_like Rho4-like subfamily. Rho4 is a GTPase th | 95.72 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 95.69 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 95.69 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 95.68 | |
| COG4477 | 570 | EzrA Negative regulator of septation ring formatio | 95.65 | |
| cd00878 | 158 | Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik | 95.65 | |
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 95.64 | |
| TIGR02528 | 142 | EutP ethanolamine utilization protein, EutP. This | 95.64 | |
| TIGR03597 | 360 | GTPase_YqeH ribosome biogenesis GTPase YqeH. This | 95.63 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 95.61 | |
| cd04148 | 221 | RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki | 95.59 | |
| cd04108 | 170 | Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr | 95.59 | |
| CHL00189 | 742 | infB translation initiation factor 2; Provisional | 95.57 | |
| PRK09518 | 712 | bifunctional cytidylate kinase/GTPase Der; Reviewe | 95.56 | |
| cd04147 | 198 | Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v | 95.56 | |
| cd04154 | 173 | Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are | 95.53 | |
| cd01899 | 318 | Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg | 95.52 | |
| PRK12296 | 500 | obgE GTPase CgtA; Reviewed | 95.52 | |
| TIGR02729 | 329 | Obg_CgtA Obg family GTPase CgtA. This model descri | 95.51 | |
| cd01900 | 274 | YchF YchF subfamily. YchF is a member of the Obg f | 95.51 | |
| PRK13796 | 365 | GTPase YqeH; Provisional | 95.5 | |
| PTZ00132 | 215 | GTP-binding nuclear protein Ran; Provisional | 95.48 | |
| cd04141 | 172 | Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p | 95.45 | |
| COG3206 | 458 | GumC Uncharacterized protein involved in exopolysa | 95.44 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 95.44 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 95.44 | |
| PLN03108 | 210 | Rab family protein; Provisional | 95.39 | |
| cd01885 | 222 | EF2 EF2 (for archaea and eukarya). Translocation r | 95.39 | |
| cd04167 | 213 | Snu114p Snu114p subfamily. Snu114p is one of sever | 95.39 | |
| PLN03188 | 1320 | kinesin-12 family protein; Provisional | 95.38 | |
| PRK12297 | 424 | obgE GTPase CgtA; Reviewed | 95.38 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 95.35 | |
| cd01886 | 270 | EF-G Elongation factor G (EF-G) subfamily. Translo | 95.34 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 95.31 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 95.28 | |
| cd04143 | 247 | Rhes_like Rhes_like subfamily. This subfamily incl | 95.28 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 95.27 | |
| cd04162 | 164 | Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 | 95.24 | |
| PRK09601 | 364 | GTP-binding protein YchF; Reviewed | 95.24 | |
| cd01882 | 225 | BMS1 Bms1. Bms1 is an essential, evolutionarily co | 95.23 | |
| cd04144 | 190 | Ras2 Ras2 subfamily. The Ras2 subfamily, found exc | 95.23 | |
| PRK09602 | 396 | translation-associated GTPase; Reviewed | 95.22 | |
| PF00071 | 162 | Ras: Ras family; InterPro: IPR001806 Small GTPases | 95.21 | |
| PF14915 | 305 | CCDC144C: CCDC144C protein coiled-coil region | 95.12 | |
| cd04169 | 267 | RF3 RF3 subfamily. Peptide chain release factor 3 | 95.12 | |
| PRK09554 | 772 | feoB ferrous iron transport protein B; Reviewed | 95.11 | |
| COG3096 | 1480 | MukB Uncharacterized protein involved in chromosom | 95.08 | |
| cd04152 | 183 | Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i | 95.08 | |
| cd04168 | 237 | TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T | 95.07 | |
| TIGR01393 | 595 | lepA GTP-binding protein LepA. LepA (GUF1 in Sacca | 95.06 | |
| cd04158 | 169 | ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor | 95.05 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 95.03 | |
| COG1842 | 225 | PspA Phage shock protein A (IM30), suppresses sigm | 94.98 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 94.97 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 94.97 | |
| KOG2485 | 335 | consensus Conserved ATP/GTP binding protein [Gener | 94.93 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 94.93 | |
| CHL00071 | 409 | tufA elongation factor Tu | 94.92 | |
| KOG1191 | 531 | consensus Mitochondrial GTPase [Translation, ribos | 94.92 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 94.91 | |
| COG4136 | 213 | ABC-type uncharacterized transport system, ATPase | 94.91 | |
| cd04105 | 203 | SR_beta Signal recognition particle receptor, beta | 94.91 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 94.91 | |
| PTZ00369 | 189 | Ras-like protein; Provisional | 94.88 | |
| cd04131 | 178 | Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 | 94.85 | |
| PRK10869 | 553 | recombination and repair protein; Provisional | 94.84 | |
| cd01892 | 169 | Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr | 94.83 | |
| cd04149 | 168 | Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor | 94.83 | |
| PRK04004 | 586 | translation initiation factor IF-2; Validated | 94.8 | |
| KOG4593 | 716 | consensus Mitotic checkpoint protein MAD1 [Cell cy | 94.77 | |
| cd04128 | 182 | Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi | 94.76 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 94.74 | |
| PLN03071 | 219 | GTP-binding nuclear protein Ran; Provisional | 94.74 | |
| PRK10218 | 607 | GTP-binding protein; Provisional | 94.73 | |
| PRK09435 | 332 | membrane ATPase/protein kinase; Provisional | 94.71 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 94.71 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 94.71 | |
| cd04134 | 189 | Rho3 Rho3 subfamily. Rho3 is a member of the Rho f | 94.71 | |
| TIGR00491 | 590 | aIF-2 translation initiation factor aIF-2/yIF-2. T | 94.69 | |
| cd04161 | 167 | Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( | 94.67 | |
| cd04120 | 202 | Rab12 Rab12 subfamily. Rab12 was first identified | 94.67 | |
| cd04151 | 158 | Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t | 94.66 | |
| PF06785 | 401 | UPF0242: Uncharacterised protein family (UPF0242); | 94.65 | |
| cd04130 | 173 | Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive | 94.63 | |
| PRK09518 | 712 | bifunctional cytidylate kinase/GTPase Der; Reviewe | 94.63 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 94.61 | |
| KOG4593 | 716 | consensus Mitotic checkpoint protein MAD1 [Cell cy | 94.6 | |
| PF00025 | 175 | Arf: ADP-ribosylation factor family The prints ent | 94.59 | |
| PRK09866 | 741 | hypothetical protein; Provisional | 94.59 | |
| cd04129 | 187 | Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that | 94.59 | |
| PF14915 | 305 | CCDC144C: CCDC144C protein coiled-coil region | 94.58 | |
| cd01871 | 174 | Rac1_like Rac1-like subfamily. The Rac1-like subfa | 94.52 | |
| COG1160 | 444 | Predicted GTPases [General function prediction onl | 94.51 | |
| PF09728 | 309 | Taxilin: Myosin-like coiled-coil protein; InterPro | 94.45 | |
| PF09744 | 158 | Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; Inte | 94.45 | |
| PF04880 | 166 | NUDE_C: NUDE protein, C-terminal conserved region; | 94.39 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 94.38 | |
| PRK05433 | 600 | GTP-binding protein LepA; Provisional | 94.37 | |
| COG0218 | 200 | Predicted GTPase [General function prediction only | 94.35 | |
| cd01888 | 203 | eIF2_gamma eIF2-gamma (gamma subunit of initiation | 94.34 | |
| TIGR01010 | 362 | BexC_CtrB_KpsE polysaccharide export inner-membran | 94.33 | |
| cd04102 | 202 | RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove | 94.32 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 94.26 | |
| PTZ00133 | 182 | ADP-ribosylation factor; Provisional | 94.26 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 94.24 | |
| COG3842 | 352 | PotA ABC-type spermidine/putrescine transport syst | 94.24 | |
| PRK12736 | 394 | elongation factor Tu; Reviewed | 94.22 | |
| cd04121 | 189 | Rab40 Rab40 subfamily. This subfamily contains Rab | 94.2 | |
| cd03268 | 208 | ABC_BcrA_bacitracin_resist The BcrA subfamily repr | 94.2 | |
| cd03296 | 239 | ABC_CysA_sulfate_importer Part of the ABC transpor | 94.19 | |
| cd01874 | 175 | Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas | 94.18 | |
| cd03301 | 213 | ABC_MalK_N The N-terminal ATPase domain of the mal | 94.17 | |
| COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 94.15 | |
| PRK12735 | 396 | elongation factor Tu; Reviewed | 94.13 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 94.12 | |
| COG1100 | 219 | GTPase SAR1 and related small G proteins [General | 94.09 | |
| TIGR02977 | 219 | phageshock_pspA phage shock protein A. Members of | 94.07 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 94.03 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 94.02 | |
| TIGR03522 | 301 | GldA_ABC_ATP gliding motility-associated ABC trans | 94.01 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 94.0 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 93.98 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 93.97 | |
| cd04150 | 159 | Arf1_5_like Arf1-Arf5-like subfamily. This subfami | 93.96 | |
| COG2262 | 411 | HflX GTPases [General function prediction only] | 93.92 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 93.89 | |
| cd00071 | 137 | GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. | 93.88 | |
| PF04012 | 221 | PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T | 93.88 | |
| PRK14250 | 241 | phosphate ABC transporter ATP-binding protein; Pro | 93.85 | |
| PF00005 | 137 | ABC_tran: ABC transporter This structure is on hol | 93.81 | |
| smart00177 | 175 | ARF ARF-like small GTPases; ARF, ADP-ribosylation | 93.77 | |
| PF15397 | 258 | DUF4618: Domain of unknown function (DUF4618) | 93.7 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 93.68 | |
| TIGR00475 | 581 | selB selenocysteine-specific elongation factor Sel | 93.68 | |
| PLN03229 | 762 | acetyl-coenzyme A carboxylase carboxyl transferase | 93.66 | |
| PF06785 | 401 | UPF0242: Uncharacterised protein family (UPF0242); | 93.64 | |
| COG1163 | 365 | DRG Predicted GTPase [General function prediction | 93.63 | |
| PLN02318 | 656 | phosphoribulokinase/uridine kinase | 93.62 | |
| KOG0410 | 410 | consensus Predicted GTP binding protein [General f | 93.6 | |
| TIGR00484 | 689 | EF-G translation elongation factor EF-G. After pep | 93.57 | |
| cd04173 | 222 | Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb | 93.47 | |
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 93.43 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 93.41 | |
| PRK01889 | 356 | GTPase RsgA; Reviewed | 93.36 | |
| PRK13638 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 93.33 | |
| PRK05506 | 632 | bifunctional sulfate adenylyltransferase subunit 1 | 93.31 | |
| KOG0086 | 214 | consensus GTPase Rab4, small G protein superfamily | 93.29 | |
| PRK12317 | 425 | elongation factor 1-alpha; Reviewed | 93.27 | |
| TIGR01288 | 303 | nodI ATP-binding ABC transporter family nodulation | 93.26 | |
| cd04103 | 158 | Centaurin_gamma Centaurin gamma. The centaurins (a | 93.24 | |
| cd04126 | 220 | Rab20 Rab20 subfamily. Rab20 is one of several Rab | 93.21 | |
| PLN03126 | 478 | Elongation factor Tu; Provisional | 93.21 | |
| PRK00300 | 205 | gmk guanylate kinase; Provisional | 93.15 | |
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 93.15 | |
| PRK09493 | 240 | glnQ glutamine ABC transporter ATP-binding protein | 93.13 | |
| cd04174 | 232 | Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb | 93.08 | |
| TIGR01277 | 213 | thiQ thiamine ABC transporter, ATP-binding protein | 93.08 | |
| cd03261 | 235 | ABC_Org_Solvent_Resistant ABC (ATP-binding cassett | 93.01 | |
| COG1842 | 225 | PspA Phage shock protein A (IM30), suppresses sigm | 93.01 | |
| PRK13644 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 93.0 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 92.99 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 92.99 | |
| COG0396 | 251 | sufC Cysteine desulfurase activator ATPase [Posttr | 92.97 | |
| PRK00049 | 396 | elongation factor Tu; Reviewed | 92.96 | |
| PRK10418 | 254 | nikD nickel transporter ATP-binding protein NikD; | 92.9 | |
| COG1134 | 249 | TagH ABC-type polysaccharide/polyol phosphate tran | 92.9 | |
| TIGR00487 | 587 | IF-2 translation initiation factor IF-2. This mode | 92.89 | |
| PRK05306 | 787 | infB translation initiation factor IF-2; Validated | 92.89 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 92.84 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 92.82 | |
| cd04172 | 182 | Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE | 92.78 | |
| TIGR01166 | 190 | cbiO cobalt transport protein ATP-binding subunit. | 92.74 | |
| TIGR00960 | 216 | 3a0501s02 Type II (General) Secretory Pathway (IIS | 92.71 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 92.69 | |
| cd03225 | 211 | ABC_cobalt_CbiO_domain1 Domain I of the ABC compon | 92.68 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 92.64 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 92.62 | |
| PF09744 | 158 | Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; Inte | 92.61 | |
| TIGR01394 | 594 | TypA_BipA GTP-binding protein TypA/BipA. This bact | 92.59 | |
| TIGR00634 | 563 | recN DNA repair protein RecN. All proteins in this | 92.57 | |
| TIGR00503 | 527 | prfC peptide chain release factor 3. This translat | 92.52 | |
| cd03226 | 205 | ABC_cobalt_CbiO_domain2 Domain II of the ABC compo | 92.5 | |
| COG1341 | 398 | Predicted GTPase or GTP-binding protein [General f | 92.48 | |
| cd03263 | 220 | ABC_subfamily_A The ABCA subfamily mediates the tr | 92.47 | |
| cd03265 | 220 | ABC_DrrA DrrA is the ATP-binding protein component | 92.46 | |
| COG3172 | 187 | NadR Predicted ATPase/kinase involved in NAD metab | 92.45 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 92.45 | |
| cd02023 | 198 | UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. | 92.45 | |
| cd03269 | 210 | ABC_putative_ATPase This subfamily is involved in | 92.44 | |
| COG0419 | 908 | SbcC ATPase involved in DNA repair [DNA replicatio | 92.44 | |
| PRK10512 | 614 | selenocysteinyl-tRNA-specific translation factor; | 92.43 | |
| PRK05124 | 474 | cysN sulfate adenylyltransferase subunit 1; Provis | 92.42 | |
| cd03224 | 222 | ABC_TM1139_LivF_branched LivF (TM1139) is part of | 92.42 | |
| PLN03127 | 447 | Elongation factor Tu; Provisional | 92.4 | |
| PLN00223 | 181 | ADP-ribosylation factor; Provisional | 92.39 | |
| COG3839 | 338 | MalK ABC-type sugar transport systems, ATPase comp | 92.33 | |
| cd01875 | 191 | RhoG RhoG subfamily. RhoG is a GTPase with high se | 92.33 | |
| TIGR02673 | 214 | FtsE cell division ATP-binding protein FtsE. This | 92.32 | |
| cd03255 | 218 | ABC_MJ0796_Lo1CDE_FtsE This family is comprised of | 92.31 | |
| TIGR02211 | 221 | LolD_lipo_ex lipoprotein releasing system, ATP-bin | 92.3 | |
| cd03264 | 211 | ABC_drug_resistance_like ABC-type multidrug transp | 92.28 | |
| PF00485 | 194 | PRK: Phosphoribulokinase / Uridine kinase family; | 92.28 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 92.28 | |
| cd03292 | 214 | ABC_FtsE_transporter FtsE is a hydrophilic nucleot | 92.27 | |
| PRK09452 | 375 | potA putrescine/spermidine ABC transporter ATPase | 92.27 | |
| cd03260 | 227 | ABC_PstB_phosphate_transporter Phosphate uptake is | 92.25 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 92.24 | |
| PLN02939 | 977 | transferase, transferring glycosyl groups | 92.23 | |
| cd03235 | 213 | ABC_Metallic_Cations ABC component of the metal-ty | 92.21 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 92.21 | |
| PF13514 | 1111 | AAA_27: AAA domain | 92.21 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 92.21 | |
| cd02025 | 220 | PanK Pantothenate kinase (PanK) catalyzes the phos | 92.21 | |
| TIGR02982 | 220 | heterocyst_DevA ABC exporter ATP-binding subunit, | 92.2 | |
| TIGR02315 | 243 | ABC_phnC phosphonate ABC transporter, ATP-binding | 92.2 | |
| cd03238 | 176 | ABC_UvrA The excision repair protein UvrA; Nucleot | 92.2 | |
| TIGR00485 | 394 | EF-Tu translation elongation factor TU. This align | 92.19 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 92.19 |
| >PF02263 GBP: Guanylate-binding protein, N-terminal domain; InterPro: IPR015894 Guanylate-binding protein is a GTPase that is induced by interferon (IFN)-gamma | Back alignment and domain information |
|---|
Probab=100.00 E-value=2e-65 Score=537.19 Aligned_cols=259 Identities=47% Similarity=0.868 Sum_probs=227.9
Q ss_pred CCceeeCHHHHHHhhccCCCEEEEEeeCCCCCChhHHHHHHhCCCCcccccCCCCCccceEEeeccccccccCCCCceEE
Q 004698 51 KGKFRMDPEAVAALQLVKEPIGVVSVCGRARQGKSFILNQLLGRSSGFQVASTHRPCTKGLWLWSAPLKRTALDGTEYNL 130 (736)
Q Consensus 51 ~~~l~l~~eAl~~L~~i~~~v~vVsv~G~~rtGKS~LlN~l~~~~~gF~~~~~~~~~T~Giw~w~~p~~~~~~~g~~~~v 130 (736)
+++|.||++|+++|..++.||+||||+|+||||||||||+|+|...||+||++++|||+|||||+.|. +.|++++|
T Consensus 1 ~~~~~~~~~al~~l~~~~~~v~vvsi~G~~rtGKSfLln~l~~~~~gF~~~~~~~~~T~Giw~w~~~~----~~~~~~~v 76 (260)
T PF02263_consen 1 DNKLELNEEALEILQQIDQPVAVVSIVGPYRTGKSFLLNQLLGPQSGFSWGPTVEPCTKGIWMWSEPL----PDGEKVAV 76 (260)
T ss_dssp TTEEEE-HHHHHHHCTTTSBEEEEEEEEETTSSHHHHHHHHCCBSSSSESSSCSSST-SCEEEECCE-----TTSTCEEE
T ss_pred CCeEEECHHHHHHHhcCCCCEEEEEeecCCccchHHHHHHHhcccccccccCCCCCCCcceeeeeccc----ccccceeE
Confidence 47899999999999989999999999999999999999999999999999999999999999999994 45788999
Q ss_pred EEeecCCCcccC-CCCccchHHHHHhhhccceEEEccCCCCchHHhhhhHHHHHHHHHHHHHhcCCCCCCCcccccCCeE
Q 004698 131 LLLDSEGIDAYD-QTGTYSTQIFSLAVLLSSMFIYNQMGGIDESAIDRLSLVTQMTKHIRIRASGGKTTPSELGQFSPIF 209 (736)
Q Consensus 131 ~llDteG~~~~~-~~~~~d~~IFaLa~LLSS~~IyN~~g~i~e~~l~~L~~v~el~~~i~~k~~~~~~~~~e~~~~~P~f 209 (736)
+||||||++++. .+.++|++||+|++||||++|||++|.|++++|++|+++++++++|+++... .....++..+||+|
T Consensus 77 ~llDteG~~~~~~~~~~~d~~if~Ls~LLSS~~IyN~~~~i~~~~l~~L~~~~~l~~~i~~~~~~-~~~~~~~~~~fp~l 155 (260)
T PF02263_consen 77 VLLDTEGLGDVEQSDEKYDAKIFALSMLLSSVLIYNSMGNIDEDDLDQLELFTELAKHIRVKYGD-SADSEDLGKPFPSL 155 (260)
T ss_dssp EEEEEECBTTTTCCCCHHCHHHHHHHHHH-SEEEEEECSSSSHHHHHCCHHHHHHHHHHHHTHHH-HHHHHCTTTTCEEE
T ss_pred EEecchhccccccCcccccHHHHHHHHHHhCceeeCCCCccchhHHHHHHHHHHHHHHHHHhccc-ccchhhhcccchHH
Confidence 999999998854 4567899999999999999999999999999999999999999999876321 11223456789999
Q ss_pred EEEeecccccccccCccCChHHHHHHhhccccCCChhhhhhhHHHHHHHhhCCCCceEeccCCCcChhhhhcccCCCcCC
Q 004698 210 VWLLRDFYLDLVEDNRKITPRDYLEIALRPVQGSGRDIAAKNEIRDSIRALFPDRECFTLVRPLSNENELQRLDQISLDR 289 (736)
Q Consensus 210 ~wlvRDf~l~~~~~g~~~t~~~yLe~~L~~~~g~~~~~~~~n~ir~~i~~~F~~~~cf~l~~P~~~~~~l~~l~~~~~~~ 289 (736)
+||||||++++..+|+.+|+++||+++|+...|.++.+..+|.+|++|++||++++||+||||+.++..++++++++.++
T Consensus 156 ~wlvRDf~~~~~~~~~~~t~~eyLe~~L~~~~~~~~~~~~~N~iR~~I~~~F~~~~cf~Lp~P~~~~~~l~~l~~l~~~~ 235 (260)
T PF02263_consen 156 VWLVRDFSLELEDDGGKITPQEYLEQALKPESGQDEEIQERNKIRECIRSCFPSRDCFTLPHPGSDVDKLQNLDGLSLDD 235 (260)
T ss_dssp EEEEECE-SCTCCTTECHHHHHHHHHHCCSSTSSSCCCCCHHHHHHHHHHHECCEEEEEEE-SSCCCCC-TCGCCCBGGG
T ss_pred HHHHhhccchhhhccCCCCHHHHHHHHHhcccchhHHHHHhhHHHHHHHHHCCCCeEEEecCCCchhhhccCcccCChhh
Confidence 99999999998888999999999999999888888888899999999999999999999999999999889999999999
Q ss_pred CChHHHHHHHHHHHHHhccCCcccc
Q 004698 290 LRPEFRAGLDALTKFVFERTRPKQV 314 (736)
Q Consensus 290 l~~eF~~~l~~l~~~i~~~~~pK~~ 314 (736)
|+|+|+++++.||++|++...+|++
T Consensus 236 L~~eF~~~l~~l~~~i~~~~~~k~~ 260 (260)
T PF02263_consen 236 LDPEFVEQLDELVKYIFSSAKVKTL 260 (260)
T ss_dssp S-HHHHHHHHHHHHHHHCCT---BE
T ss_pred CCHHHHHHHHHHHHHHhccCCcccC
Confidence 9999999999999999998888763
|
GTPases induced by IFN-gamma are key to the protective immunity against microbial and viral pathogens. These GTPases are classified into three groups: the small 47-kd GTPases, the Mx proteins, and the large 65- to 67-kd GTPases. Guanylate-binding proteins (GBP) fall into the last class. In humans, there are seven GBPs (hGBP1-7) []. Structurally, hGBP1 consists of two domains: a compact globular N-terminal domain harbouring the GTPase function, and an alpha-helical finger-like C-terminal domain (IPR003191 from INTERPRO). Human GBP1 is secreted from cells without the need of a leader peptide, and has been shown to exhibit antiviral activity against Vesicular stomatitis virus and Encephalomyocarditis virus, as well as being able to regulate the inhibition of proliferation and invasion of endothelial cells in response to IFN-gamma [].; GO: 0003924 GTPase activity, 0005525 GTP binding; PDB: 3QOF_A 3Q5E_C 3QNU_A 3Q5D_A 1DG3_A 2D4H_A 2B8W_B 2B92_A 2BC9_A 1F5N_A. |
| >KOG2037 consensus Guanylate-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain | Back alignment and domain information |
|---|
| >PF02841 GBP_C: Guanylate-binding protein, C-terminal domain; InterPro: IPR003191 Guanylate-binding protein is a GTPase that is induced by interferon (IFN)-gamma | Back alignment and domain information |
|---|
| >KOG2037 consensus Guanylate-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF05879 RHD3: Root hair defective 3 GTP-binding protein (RHD3); InterPro: IPR008803 This family consists of several eukaryotic root hair defective 3 like GTP-binding proteins | Back alignment and domain information |
|---|
| >KOG2203 consensus GTP-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >KOG4181 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >COG1159 Era GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK00089 era GTPase Era; Reviewed | Back alignment and domain information |
|---|
| >PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >TIGR00436 era GTP-binding protein Era | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PRK10698 phage shock protein PspA; Provisional | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd04163 Era Era subfamily | Back alignment and domain information |
|---|
| >PF02841 GBP_C: Guanylate-binding protein, C-terminal domain; InterPro: IPR003191 Guanylate-binding protein is a GTPase that is induced by interferon (IFN)-gamma | Back alignment and domain information |
|---|
| >PF10220 DUF2146: Uncharacterized conserved protein (DUF2146); InterPro: IPR019354 Smg8 and Smg9 are two subunits of the Smg-1 complex | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules | Back alignment and domain information |
|---|
| >cd01858 NGP_1 NGP-1 | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >cd01850 CDC_Septin CDC/Septin | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >cd01849 YlqF_related_GTPase YlqF-related GTPases | Back alignment and domain information |
|---|
| >cd01894 EngA1 EngA1 subfamily | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd01878 HflX HflX subfamily | Back alignment and domain information |
|---|
| >cd04101 RabL4 RabL4 (Rab-like4) subfamily | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >cd04178 Nucleostemin_like Nucleostemin-like | Back alignment and domain information |
|---|
| >cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >cd00880 Era_like Era (E | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >KOG1423 consensus Ras-like GTPase ERA [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd01898 Obg Obg subfamily | Back alignment and domain information |
|---|
| >cd04104 p47_IIGP_like p47 (47-kDa) family | Back alignment and domain information |
|---|
| >KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR00231 small_GTP small GTP-binding protein domain | Back alignment and domain information |
|---|
| >PF15066 CAGE1: Cancer-associated gene protein 1 family | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes | Back alignment and domain information |
|---|
| >PRK12289 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >cd04171 SelB SelB subfamily | Back alignment and domain information |
|---|
| >cd04142 RRP22 RRP22 subfamily | Back alignment and domain information |
|---|
| >cd01890 LepA LepA subfamily | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd01876 YihA_EngB The YihA (EngB) subfamily | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd01857 HSR1_MMR1 HSR1/MMR1 | Back alignment and domain information |
|---|
| >PRK15494 era GTPase Era; Provisional | Back alignment and domain information |
|---|
| >PRK00454 engB GTP-binding protein YsxC; Reviewed | Back alignment and domain information |
|---|
| >PRK12288 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR02977 phageshock_pspA phage shock protein A | Back alignment and domain information |
|---|
| >PRK12298 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >cd01861 Rab6 Rab6 subfamily | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >cd01855 YqeH YqeH | Back alignment and domain information |
|---|
| >cd01868 Rab11_like Rab11-like | Back alignment and domain information |
|---|
| >TIGR02836 spore_IV_A stage IV sporulation protein A | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence | Back alignment and domain information |
|---|
| >COG1161 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >cd04119 RJL RJL (RabJ-Like) subfamily | Back alignment and domain information |
|---|
| >cd00882 Ras_like_GTPase Ras-like GTPase superfamily | Back alignment and domain information |
|---|
| >cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily | Back alignment and domain information |
|---|
| >PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription | Back alignment and domain information |
|---|
| >PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases | Back alignment and domain information |
|---|
| >COG1084 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PRK09563 rbgA GTPase YlqF; Reviewed | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >cd01864 Rab19 Rab19 subfamily | Back alignment and domain information |
|---|
| >COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF13870 DUF4201: Domain of unknown function (DUF4201) | Back alignment and domain information |
|---|
| >PRK11058 GTPase HflX; Provisional | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >cd01866 Rab2 Rab2 subfamily | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd00154 Rab Rab family | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >cd04113 Rab4 Rab4 subfamily | Back alignment and domain information |
|---|
| >PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure | Back alignment and domain information |
|---|
| >cd01895 EngA2 EngA2 subfamily | Back alignment and domain information |
|---|
| >cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 | Back alignment and domain information |
|---|
| >cd00881 GTP_translation_factor GTP translation factor family | Back alignment and domain information |
|---|
| >cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >cd01860 Rab5_related Rab5-related subfamily | Back alignment and domain information |
|---|
| >PRK10698 phage shock protein PspA; Provisional | Back alignment and domain information |
|---|
| >PRK00098 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >cd01865 Rab3 Rab3 subfamily | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >cd04118 Rab24 Rab24 subfamily | Back alignment and domain information |
|---|
| >cd04122 Rab14 Rab14 subfamily | Back alignment and domain information |
|---|
| >smart00175 RAB Rab subfamily of small GTPases | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >cd04139 RalA_RalB RalA/RalB subfamily | Back alignment and domain information |
|---|
| >COG3596 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR03156 GTP_HflX GTP-binding protein HflX | Back alignment and domain information |
|---|
| >cd04106 Rab23_lke Rab23-like subfamily | Back alignment and domain information |
|---|
| >cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins | Back alignment and domain information |
|---|
| >cd04159 Arl10_like Arl10-like subfamily | Back alignment and domain information |
|---|
| >cd04112 Rab26 Rab26 subfamily | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >COG1160 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00157 ribosome small subunit-dependent GTPase A | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01856 YlqF YlqF | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >cd04124 RabL2 RabL2 subfamily | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >cd04116 Rab9 Rab9 subfamily | Back alignment and domain information |
|---|
| >smart00173 RAS Ras subfamily of RAS small GTPases | Back alignment and domain information |
|---|
| >cd01862 Rab7 Rab7 subfamily | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >cd04136 Rap_like Rap-like subfamily | Back alignment and domain information |
|---|
| >cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 | Back alignment and domain information |
|---|
| >cd01854 YjeQ_engC YjeQ/EngC | Back alignment and domain information |
|---|
| >cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily | Back alignment and domain information |
|---|
| >KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only] | Back alignment and domain information |
|---|
| >cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily | Back alignment and domain information |
|---|
| >KOG2655 consensus Septin family protein (P-loop GTPase) [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily | Back alignment and domain information |
|---|
| >cd04109 Rab28 Rab28 subfamily | Back alignment and domain information |
|---|
| >PRK04213 GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily | Back alignment and domain information |
|---|
| >PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments [] | Back alignment and domain information |
|---|
| >TIGR03594 GTPase_EngA ribosome-associated GTPase EngA | Back alignment and domain information |
|---|
| >cd04127 Rab27A Rab27a subfamily | Back alignment and domain information |
|---|
| >cd00879 Sar1 Sar1 subfamily | Back alignment and domain information |
|---|
| >cd01863 Rab18 Rab18 subfamily | Back alignment and domain information |
|---|
| >TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF | Back alignment and domain information |
|---|
| >KOG1547 consensus Septin CDC10 and related P-loop GTPases [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd00876 Ras Ras family | Back alignment and domain information |
|---|
| >cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases | Back alignment and domain information |
|---|
| >cd04155 Arl3 Arl3 subfamily | Back alignment and domain information |
|---|
| >cd00157 Rho Rho (Ras homology) family | Back alignment and domain information |
|---|
| >cd04110 Rab35 Rab35 subfamily | Back alignment and domain information |
|---|
| >PLN03118 Rab family protein; Provisional | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >cd04166 CysN_ATPS CysN_ATPS subfamily | Back alignment and domain information |
|---|
| >cd04111 Rab39 Rab39 subfamily | Back alignment and domain information |
|---|
| >PRK00093 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >cd04123 Rab21 Rab21 subfamily | Back alignment and domain information |
|---|
| >cd04177 RSR1 RSR1 subgroup | Back alignment and domain information |
|---|
| >cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily | Back alignment and domain information |
|---|
| >cd01859 MJ1464 MJ1464 | Back alignment and domain information |
|---|
| >cd04125 RabA_like RabA-like subfamily | Back alignment and domain information |
|---|
| >COG0486 ThdF Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >cd04107 Rab32_Rab38 Rab38/Rab32 subfamily | Back alignment and domain information |
|---|
| >cd04146 RERG_RasL11_like RERG/RasL11-like subfamily | Back alignment and domain information |
|---|
| >cd01889 SelB_euk SelB subfamily | Back alignment and domain information |
|---|
| >PF14073 Cep57_CLD: Centrosome localisation domain of Cep57 | Back alignment and domain information |
|---|
| >PRK10929 putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >smart00178 SAR Sar1p-like members of the Ras-family of small GTPases | Back alignment and domain information |
|---|
| >TIGR03594 GTPase_EngA ribosome-associated GTPase EngA | Back alignment and domain information |
|---|
| >TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE | Back alignment and domain information |
|---|
| >cd01870 RhoA_like RhoA-like subfamily | Back alignment and domain information |
|---|
| >PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >PRK05291 trmE tRNA modification GTPase TrmE; Reviewed | Back alignment and domain information |
|---|
| >PF14073 Cep57_CLD: Centrosome localisation domain of Cep57 | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >cd04135 Tc10 TC10 subfamily | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >cd01893 Miro1 Miro1 subfamily | Back alignment and domain information |
|---|
| >PRK12299 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >cd04156 ARLTS1 ARLTS1 subfamily | Back alignment and domain information |
|---|
| >COG1162 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK03003 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >PTZ00258 GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >cd04117 Rab15 Rab15 subfamily | Back alignment and domain information |
|---|
| >cd04114 Rab30 Rab30 subfamily | Back alignment and domain information |
|---|
| >cd04140 ARHI_like ARHI subfamily | Back alignment and domain information |
|---|
| >smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases | Back alignment and domain information |
|---|
| >PRK03003 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >cd04175 Rap1 Rap1 subgroup | Back alignment and domain information |
|---|
| >PRK00093 GTP-binding protein Der; Reviewed | Back alignment and domain information |
|---|
| >cd04153 Arl5_Arl8 Arl5/Arl8 subfamily | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >KOG0448 consensus Mitofusin 1 GTPase, involved in mitochondrila biogenesis [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd04157 Arl6 Arl6 subfamily | Back alignment and domain information |
|---|
| >PLN03110 Rab GTPase; Provisional | Back alignment and domain information |
|---|
| >cd04160 Arfrp1 Arfrp1 subfamily | Back alignment and domain information |
|---|
| >cd04176 Rap2 Rap2 subgroup | Back alignment and domain information |
|---|
| >cd04170 EF-G_bact Elongation factor G (EF-G) subfamily | Back alignment and domain information |
|---|
| >cd01884 EF_Tu EF-Tu subfamily | Back alignment and domain information |
|---|
| >cd04132 Rho4_like Rho4-like subfamily | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR02528 EutP ethanolamine utilization protein, EutP | Back alignment and domain information |
|---|
| >TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd04148 RGK RGK subfamily | Back alignment and domain information |
|---|
| >cd04108 Rab36_Rab34 Rab34/Rab36 subfamily | Back alignment and domain information |
|---|
| >CHL00189 infB translation initiation factor 2; Provisional | Back alignment and domain information |
|---|
| >PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed | Back alignment and domain information |
|---|
| >cd04147 Ras_dva Ras-dva subfamily | Back alignment and domain information |
|---|
| >cd04154 Arl2 Arl2 subfamily | Back alignment and domain information |
|---|
| >cd01899 Ygr210 Ygr210 subfamily | Back alignment and domain information |
|---|
| >PRK12296 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >TIGR02729 Obg_CgtA Obg family GTPase CgtA | Back alignment and domain information |
|---|
| >cd01900 YchF YchF subfamily | Back alignment and domain information |
|---|
| >PRK13796 GTPase YqeH; Provisional | Back alignment and domain information |
|---|
| >PTZ00132 GTP-binding nuclear protein Ran; Provisional | Back alignment and domain information |
|---|
| >cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily | Back alignment and domain information |
|---|
| >COG3206 GumC Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >PLN03108 Rab family protein; Provisional | Back alignment and domain information |
|---|
| >cd01885 EF2 EF2 (for archaea and eukarya) | Back alignment and domain information |
|---|
| >cd04167 Snu114p Snu114p subfamily | Back alignment and domain information |
|---|
| >PLN03188 kinesin-12 family protein; Provisional | Back alignment and domain information |
|---|
| >PRK12297 obgE GTPase CgtA; Reviewed | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd01886 EF-G Elongation factor G (EF-G) subfamily | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >cd04143 Rhes_like Rhes_like subfamily | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily | Back alignment and domain information |
|---|
| >PRK09601 GTP-binding protein YchF; Reviewed | Back alignment and domain information |
|---|
| >cd01882 BMS1 Bms1 | Back alignment and domain information |
|---|
| >cd04144 Ras2 Ras2 subfamily | Back alignment and domain information |
|---|
| >PRK09602 translation-associated GTPase; Reviewed | Back alignment and domain information |
|---|
| >PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases | Back alignment and domain information |
|---|
| >PF14915 CCDC144C: CCDC144C protein coiled-coil region | Back alignment and domain information |
|---|
| >cd04169 RF3 RF3 subfamily | Back alignment and domain information |
|---|
| >PRK09554 feoB ferrous iron transport protein B; Reviewed | Back alignment and domain information |
|---|
| >COG3096 MukB Uncharacterized protein involved in chromosome partitioning [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >cd04152 Arl4_Arl7 Arl4/Arl7 subfamily | Back alignment and domain information |
|---|
| >cd04168 TetM_like Tet(M)-like subfamily | Back alignment and domain information |
|---|
| >TIGR01393 lepA GTP-binding protein LepA | Back alignment and domain information |
|---|
| >cd04158 ARD1 ARD1 subfamily | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >KOG2485 consensus Conserved ATP/GTP binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >CHL00071 tufA elongation factor Tu | Back alignment and domain information |
|---|
| >KOG1191 consensus Mitochondrial GTPase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >PTZ00369 Ras-like protein; Provisional | Back alignment and domain information |
|---|
| >cd04131 Rnd Rnd subfamily | Back alignment and domain information |
|---|
| >PRK10869 recombination and repair protein; Provisional | Back alignment and domain information |
|---|
| >cd01892 Miro2 Miro2 subfamily | Back alignment and domain information |
|---|
| >cd04149 Arf6 Arf6 subfamily | Back alignment and domain information |
|---|
| >PRK04004 translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd04128 Spg1 Spg1p | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >PLN03071 GTP-binding nuclear protein Ran; Provisional | Back alignment and domain information |
|---|
| >PRK10218 GTP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK09435 membrane ATPase/protein kinase; Provisional | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >cd04134 Rho3 Rho3 subfamily | Back alignment and domain information |
|---|
| >TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 | Back alignment and domain information |
|---|
| >cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily | Back alignment and domain information |
|---|
| >cd04120 Rab12 Rab12 subfamily | Back alignment and domain information |
|---|
| >cd04151 Arl1 Arl1 subfamily | Back alignment and domain information |
|---|
| >PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function | Back alignment and domain information |
|---|
| >cd04130 Wrch_1 Wrch-1 subfamily | Back alignment and domain information |
|---|
| >PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases | Back alignment and domain information |
|---|
| >PRK09866 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd04129 Rho2 Rho2 subfamily | Back alignment and domain information |
|---|
| >PF14915 CCDC144C: CCDC144C protein coiled-coil region | Back alignment and domain information |
|---|
| >cd01871 Rac1_like Rac1-like subfamily | Back alignment and domain information |
|---|
| >COG1160 Predicted GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed | Back alignment and domain information |
|---|
| >PF09744 Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; InterPro: IPR019143 This entry represents the N-terminal 200 residues of a set of proteins conserved from yeasts to humans | Back alignment and domain information |
|---|
| >PF04880 NUDE_C: NUDE protein, C-terminal conserved region; InterPro: IPR006964 This domain represents the C-terminal conserved region of NUDE proteins | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK05433 GTP-binding protein LepA; Provisional | Back alignment and domain information |
|---|
| >COG0218 Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) | Back alignment and domain information |
|---|
| >TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family | Back alignment and domain information |
|---|
| >cd04102 RabL3 RabL3 (Rab-like3) subfamily | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >PTZ00133 ADP-ribosylation factor; Provisional | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12736 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >cd04121 Rab40 Rab40 subfamily | Back alignment and domain information |
|---|
| >cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance | Back alignment and domain information |
|---|
| >cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import | Back alignment and domain information |
|---|
| >cd01874 Cdc42 Cdc42 subfamily | Back alignment and domain information |
|---|
| >cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK | Back alignment and domain information |
|---|
| >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK12735 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >COG1100 GTPase SAR1 and related small G proteins [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02977 phageshock_pspA phage shock protein A | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd04150 Arf1_5_like Arf1-Arf5-like subfamily | Back alignment and domain information |
|---|
| >COG2262 HflX GTPases [General function prediction only] | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 | Back alignment and domain information |
|---|
| >PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription | Back alignment and domain information |
|---|
| >PRK14250 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor | Back alignment and domain information |
|---|
| >PF15397 DUF4618: Domain of unknown function (DUF4618) | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >TIGR00475 selB selenocysteine-specific elongation factor SelB | Back alignment and domain information |
|---|
| >PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function | Back alignment and domain information |
|---|
| >COG1163 DRG Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02318 phosphoribulokinase/uridine kinase | Back alignment and domain information |
|---|
| >KOG0410 consensus Predicted GTP binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00484 EF-G translation elongation factor EF-G | Back alignment and domain information |
|---|
| >cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >PRK01889 GTPase RsgA; Reviewed | Back alignment and domain information |
|---|
| >PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional | Back alignment and domain information |
|---|
| >KOG0086 consensus GTPase Rab4, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK12317 elongation factor 1-alpha; Reviewed | Back alignment and domain information |
|---|
| >TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI | Back alignment and domain information |
|---|
| >cd04103 Centaurin_gamma Centaurin gamma | Back alignment and domain information |
|---|
| >cd04126 Rab20 Rab20 subfamily | Back alignment and domain information |
|---|
| >PLN03126 Elongation factor Tu; Provisional | Back alignment and domain information |
|---|
| >PRK00300 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
|---|
| >cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily | Back alignment and domain information |
|---|
| >TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK00049 elongation factor Tu; Reviewed | Back alignment and domain information |
|---|
| >PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional | Back alignment and domain information |
|---|
| >COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR00487 IF-2 translation initiation factor IF-2 | Back alignment and domain information |
|---|
| >PRK05306 infB translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily | Back alignment and domain information |
|---|
| >TIGR01166 cbiO cobalt transport protein ATP-binding subunit | Back alignment and domain information |
|---|
| >TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >PF09744 Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; InterPro: IPR019143 This entry represents the N-terminal 200 residues of a set of proteins conserved from yeasts to humans | Back alignment and domain information |
|---|
| >TIGR01394 TypA_BipA GTP-binding protein TypA/BipA | Back alignment and domain information |
|---|
| >TIGR00634 recN DNA repair protein RecN | Back alignment and domain information |
|---|
| >TIGR00503 prfC peptide chain release factor 3 | Back alignment and domain information |
|---|
| >cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >COG1341 Predicted GTPase or GTP-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds | Back alignment and domain information |
|---|
| >cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin | Back alignment and domain information |
|---|
| >COG3172 NadR Predicted ATPase/kinase involved in NAD metabolism [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity | Back alignment and domain information |
|---|
| >COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional | Back alignment and domain information |
|---|
| >PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional | Back alignment and domain information |
|---|
| >cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids | Back alignment and domain information |
|---|
| >PLN03127 Elongation factor Tu; Provisional | Back alignment and domain information |
|---|
| >PLN00223 ADP-ribosylation factor; Provisional | Back alignment and domain information |
|---|
| >COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd01875 RhoG RhoG subfamily | Back alignment and domain information |
|---|
| >TIGR02673 FtsE cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) | Back alignment and domain information |
|---|
| >TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component | Back alignment and domain information |
|---|
| >PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane | Back alignment and domain information |
|---|
| >PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed | Back alignment and domain information |
|---|
| >cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PLN02939 transferase, transferring glycosyl groups | Back alignment and domain information |
|---|
| >cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway | Back alignment and domain information |
|---|
| >TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family | Back alignment and domain information |
|---|
| >TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >TIGR00485 EF-Tu translation elongation factor TU | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 736 | ||||
| 1dg3_A | 592 | Structure Of Human Guanylate Binding Protein-1 In N | 5e-52 | ||
| 2b8w_A | 328 | Crystal-Structure Of The N-Terminal Large Gtpase Do | 1e-47 | ||
| 3q5e_A | 447 | Crystal Structure Of Human Atlastin-1 (Residues 1-4 | 5e-11 | ||
| 4idq_A | 447 | Human Atlastin-1 1-446, N440t, Gdpalf4- Length = 44 | 5e-11 | ||
| 4idn_A | 457 | Human Atlastin-1 1-446, C-his6, Gppnhp Length = 457 | 5e-11 | ||
| 3qnu_A | 459 | Crystal Structure Of The Cytosolic Domain Of Human | 6e-11 | ||
| 4idp_A | 447 | Human Atlastin-1 1-446, N440t, Gppnhp Length = 447 | 1e-09 | ||
| 3q5d_A | 447 | Crystal Structure Of Human Atlastin-1 (Residues 1-4 | 1e-09 |
| >pdb|1DG3|A Chain A, Structure Of Human Guanylate Binding Protein-1 In Nucleotide Free Form Length = 592 | Back alignment and structure |
|
| >pdb|2B8W|A Chain A, Crystal-Structure Of The N-Terminal Large Gtpase Domain Of Human Guanylate Binding Protein 1 (Hgbp1) In Complex With GmpALF4 Length = 328 | Back alignment and structure |
| >pdb|3Q5E|A Chain A, Crystal Structure Of Human Atlastin-1 (Residues 1-447) Bound To Gdp, Crystal Form 2 Length = 447 | Back alignment and structure |
| >pdb|4IDQ|A Chain A, Human Atlastin-1 1-446, N440t, Gdpalf4- Length = 447 | Back alignment and structure |
| >pdb|4IDN|A Chain A, Human Atlastin-1 1-446, C-his6, Gppnhp Length = 457 | Back alignment and structure |
| >pdb|3QNU|A Chain A, Crystal Structure Of The Cytosolic Domain Of Human Atlastin-1 In Complex With Gdp, Hexagonal Form Length = 459 | Back alignment and structure |
| >pdb|4IDP|A Chain A, Human Atlastin-1 1-446, N440t, Gppnhp Length = 447 | Back alignment and structure |
| >pdb|3Q5D|A Chain A, Crystal Structure Of Human Atlastin-1 (Residues 1-447) Bound To Gdp, Crystal Form 1 Length = 447 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 736 | |||
| 1f5n_A | 592 | Interferon-induced guanylate-binding protein 1; GB | 1e-112 | |
| 1f5n_A | 592 | Interferon-induced guanylate-binding protein 1; GB | 1e-06 | |
| 3q5d_A | 447 | Atlastin-1; G protein, GTPase, GDP/GTP binding, hy | 8e-88 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-19 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-12 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-11 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-11 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-06 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 2e-07 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 3e-05 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 1e-06 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 6e-04 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 5e-06 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 1e-05 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 4e-05 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 1e-05 | |
| 4akv_A | 386 | Sorting nexin-33; transport protein, organelle bio | 7e-05 |
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 | Back alignment and structure |
|---|
Score = 351 bits (902), Expect = e-112
Identities = 153/587 (26%), Positives = 278/587 (47%), Gaps = 32/587 (5%)
Query: 40 ARPIRLVYCDEKGKFRMDPEAVAALQLVKEPIGVVSVCGRARQGKSFILNQLLGRSSGFQ 99
P+ L+ + G+ +PEA+ L + +P+ VV++ G R GKS+++N+L G+ GF
Sbjct: 8 TGPMCLIE-NTNGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFS 66
Query: 100 VASTHRPCTKGLWLWSAPLKRTALDGTEYNLLLLDSEGI-DAYDQTGTYSTQIFSLAVLL 158
+ ST + TKG+W+W P + L+LLD+EG+ D + IF+LAVLL
Sbjct: 67 LGSTVQSHTKGIWMWCVPHP----KKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLL 122
Query: 159 SSMFIYNQMGGIDESAIDRLSLVTQMTKHIRIRASGGKTT-----PSELGQFSPIFVWLL 213
SS F+YN +G I++ A+D+L VT++T IR ++S + ++ F P FVW L
Sbjct: 123 SSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSSPDENENEVEDSADFVSFFPDFVWTL 182
Query: 214 RDFYLDLVEDNRKITPRDYLEIALRPVQGSGRDIAAKNEIRDSIRALFPDRECFTLVRPL 273
RDF LDL D + +TP +YL +L+ +G+ + N R IR FP ++CF RP
Sbjct: 183 RDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFVFDRP- 241
Query: 274 SNENELQRLDQISLDRLRPEFRAGLDALTKFVFERTRPKQV-GATVLTGPVLIGITESYL 332
+ +L +L+++ + L PEF + ++F ++ K + G + GP L + +Y+
Sbjct: 242 VHRRKLAQLEKLQDEELDPEFVQQVADFCSYIFSNSKTKTLSGGIQVNGPRLESLVLTYV 301
Query: 333 DAINNGAVPTISSSWQSVEEAECRRAYDSATETY---MSTFDRSKPPEEVALGEAHEAAV 389
+AI++G +P + ++ ++ + E A A Y M + L + H +
Sbjct: 302 NAISSGDLPCMENAVLALAQIENSAAVQKAIAHYEQQMGQKVQLPTESLQELLDLHRDSE 361
Query: 390 QKALAVYNAGAVGVGLARKKYEGLLQKFFRKAFEDHKKNVYMEADIRCSSAIQ----SME 445
++A+ V+ ++ L K +D K + RCS +Q +E
Sbjct: 362 REAIEVFI--RSSFKDVDHLFQKELAAQLEKKRDDFCKQNQEASSDRCSGLLQVIFSPLE 419
Query: 446 RKLRAACHSSDASIDNVVKVLDGLISEY-ETSCHGPGKWQKLATFLQ--QSSEGPILDLV 502
+++A +S V+ L L +Y E G + L T+L+ +S IL
Sbjct: 420 EEVKAGIYSKPGGYRLFVQKLQDLKKKYYEEPRKGIQAEEILQTYLKSKESMTDAILQTD 479
Query: 503 KRLIDQIGSERSSLMLKYRSIEDNMKLLKKQLEDSERYKSEYLKRYDDAINDKKKLADDY 562
+ L ++ E +K S + + K+L + +E+ + + Y + + + ++
Sbjct: 480 QTLTEKE-KEIEVERVKAESAQASAKMLHEMQRKNEQMMEQKERSYQEHLKQLTEKMEND 538
Query: 563 TSRINNLQGENISLREKS------SSLSKTVDSLKNEISDWKRKYDQ 603
++ Q ++L+ + K +KNEI D + K +
Sbjct: 539 RVQLLKEQERTLALKLQEQEQLLKEGFQKESRIMKNEIQDLQTKMRR 585
|
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 | Back alignment and structure |
|---|
| >3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* Length = 447 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 | Back alignment and structure |
|---|
| >4akv_A Sorting nexin-33; transport protein, organelle biogenesis; 2.65A {Homo sapiens} Length = 386 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 736 | |||
| 1f5n_A | 592 | Interferon-induced guanylate-binding protein 1; GB | 100.0 | |
| 4ido_A | 457 | Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HE | 100.0 | |
| 3q5d_A | 447 | Atlastin-1; G protein, GTPase, GDP/GTP binding, hy | 100.0 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 98.98 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 98.55 | |
| 2v66_B | 111 | Nuclear distribution protein NUDE-like 1; structur | 98.52 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 98.47 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 98.41 | |
| 3swk_A | 86 | Vimentin; cytoskeleton, intermediate filament, alp | 98.25 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 97.77 | |
| 3lxw_A | 247 | GTPase IMAP family member 1; immunity, structural | 97.76 | |
| 3iev_A | 308 | GTP-binding protein ERA; ERA, GTPase, KH domain, a | 97.71 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 97.68 | |
| 2xtp_A | 260 | GTPase IMAP family member 2; immune system, G prot | 97.68 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 97.68 | |
| 3lxx_A | 239 | GTPase IMAP family member 4; structural genomics c | 97.61 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 97.6 | |
| 4dhe_A | 223 | Probable GTP-binding protein ENGB; melioidosis, RA | 97.46 | |
| 1wf3_A | 301 | GTP-binding protein; GTPase, riken structural geno | 97.44 | |
| 1ega_A | 301 | Protein (GTP-binding protein ERA); GTPase, RNA-bin | 97.43 | |
| 2qu8_A | 228 | Putative nucleolar GTP-binding protein 1; GTPase, | 97.41 | |
| 3pqc_A | 195 | Probable GTP-binding protein ENGB; rossmann fold, | 97.4 | |
| 2dyk_A | 161 | GTP-binding protein; GTPase, ribosome-binding prot | 97.37 | |
| 1h65_A | 270 | Chloroplast outer envelope protein OEP34; GTPase, | 97.32 | |
| 3trt_A | 77 | Vimentin; cytoskeleton, intermediate filament, alp | 97.31 | |
| 3t5d_A | 274 | Septin-7; GTP-binding protein, cytoskeleton, signa | 97.31 | |
| 3def_A | 262 | T7I23.11 protein; chloroplast, TOC33, GTPase, hydr | 97.23 | |
| 2erx_A | 172 | GTP-binding protein DI-RAS2; GTP hydrolysis, trans | 97.19 | |
| 2j69_A | 695 | Bacterial dynamin-like protein; FZO, FZL, GTPase, | 97.18 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 97.1 | |
| 1svi_A | 195 | GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro | 97.08 | |
| 3tw8_B | 181 | RAS-related protein RAB-35; longin domain, RAB GTP | 97.05 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 97.05 | |
| 1ek0_A | 170 | Protein (GTP-binding protein YPT51); vesicular tra | 97.04 | |
| 3t34_A | 360 | Dynamin-related protein 1A, linker, dynamin-relat | 97.04 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 97.03 | |
| 1z0j_A | 170 | RAB-22, RAS-related protein RAB-22A; RAB GTPase, R | 97.03 | |
| 1wms_A | 177 | RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p | 97.01 | |
| 2g6b_A | 180 | RAS-related protein RAB-26; G-protein, GTP analogu | 97.0 | |
| 2nzj_A | 175 | GTP-binding protein REM 1; GDP/GTP binding, GTP hy | 96.98 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 96.96 | |
| 1u8z_A | 168 | RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH | 96.95 | |
| 1z08_A | 170 | RAS-related protein RAB-21; RAB GTPase, vesicular | 96.95 | |
| 4dsu_A | 189 | GTPase KRAS, isoform 2B; small G-protein, signalin | 96.95 | |
| 3iby_A | 256 | Ferrous iron transport protein B; G protein, G dom | 96.95 | |
| 2y8e_A | 179 | RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti | 96.95 | |
| 1kao_A | 167 | RAP2A; GTP-binding protein, small G protein, GDP, | 96.94 | |
| 1z2a_A | 168 | RAS-related protein RAB-23; RAB GTPase, vesicular | 96.94 | |
| 1vg8_A | 207 | RAS-related protein RAB-7; GTP-binding protein, pr | 96.93 | |
| 2fn4_A | 181 | P23, RAS-related protein R-RAS; GDP/GTP binding, G | 96.93 | |
| 1r2q_A | 170 | RAS-related protein RAB-5A; GTPase, GNP, atomic re | 96.93 | |
| 2zej_A | 184 | Dardarin, leucine-rich repeat kinase 2; parkinson' | 96.92 | |
| 3clv_A | 208 | RAB5 protein, putative; malaria, GTPase, structura | 96.92 | |
| 3a1s_A | 258 | Iron(II) transport protein B; FEOB, iron transport | 96.92 | |
| 3i8s_A | 274 | Ferrous iron transport protein B; GTPase, GPCR, ir | 96.9 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 96.9 | |
| 2oil_A | 193 | CATX-8, RAS-related protein RAB-25; G-protein, GDP | 96.89 | |
| 3k53_A | 271 | Ferrous iron transport protein B; GTPase fold, hel | 96.88 | |
| 2ce2_X | 166 | GTPase HRAS; signaling protein, guanine nucleotide | 96.87 | |
| 1z0f_A | 179 | RAB14, member RAS oncogene family; RAB GTPase, ves | 96.86 | |
| 1g16_A | 170 | RAS-related protein SEC4; G protein RAB, signaling | 96.85 | |
| 1c1y_A | 167 | RAS-related protein RAP-1A; GTP-binding proteins, | 96.83 | |
| 1zbd_A | 203 | Rabphilin-3A; G protein, effector, RABCDR, synapti | 96.82 | |
| 3q85_A | 169 | GTP-binding protein REM 2; G-domain, CAV2 beta, si | 96.82 | |
| 2bov_A | 206 | RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, | 96.8 | |
| 1jwy_B | 315 | Dynamin A GTPase domain; dynamin, GTPase, GDP, myo | 96.79 | |
| 2gf0_A | 199 | GTP-binding protein DI-RAS1; GDP/GTP binding, GTP | 96.77 | |
| 2gj8_A | 172 | MNME, tRNA modification GTPase TRME; G-domain dime | 96.75 | |
| 3t5g_A | 181 | GTP-binding protein RHEB; immunoglobulin-like beta | 96.75 | |
| 3cph_A | 213 | RAS-related protein SEC4; RAB GTPase, prenylation, | 96.74 | |
| 4djt_A | 218 | GTP-binding nuclear protein GSP1; structural genom | 96.74 | |
| 1puj_A | 282 | YLQF, conserved hypothetical protein YLQF; structu | 96.74 | |
| 1x3s_A | 195 | RAS-related protein RAB-18; GTPase, GNP, structura | 96.72 | |
| 1ky3_A | 182 | GTP-binding protein YPT7P; vesicular traffic, GTP | 96.71 | |
| 2bme_A | 186 | RAB4A, RAS-related protein RAB4A; GTP-binding prot | 96.71 | |
| 2gf9_A | 189 | RAS-related protein RAB-3D; G-protein, structural | 96.7 | |
| 1wxq_A | 397 | GTP-binding protein; structural genomics, riken st | 96.7 | |
| 2bcg_Y | 206 | Protein YP2, GTP-binding protein YPT1; RABGTPase, | 96.69 | |
| 2a9k_A | 187 | RAS-related protein RAL-A; bacterial ADP-ribosyltr | 96.69 | |
| 2fg5_A | 192 | RAB-22B, RAS-related protein RAB-31; G-protein, GT | 96.69 | |
| 1z06_A | 189 | RAS-related protein RAB-33B; RAB GTPase, RAB33B GT | 96.69 | |
| 3con_A | 190 | GTPase NRAS; structural genomics consortium, SGC, | 96.67 | |
| 2efe_B | 181 | Small GTP-binding protein-like; GEF, GTPase, VPS9, | 96.66 | |
| 2il1_A | 192 | RAB12; G-protein, GDP, GTPase, predicted, structur | 96.66 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 96.66 | |
| 2e87_A | 357 | Hypothetical protein PH1320; GTP-binding, GTPase, | 96.66 | |
| 2wji_A | 165 | Ferrous iron transport protein B homolog; membrane | 96.64 | |
| 3oes_A | 201 | GTPase rhebl1; small GTPase, structural genomics, | 96.64 | |
| 4a9a_A | 376 | Ribosome-interacting GTPase 1; DRG-DFRP complex, r | 96.64 | |
| 3t1o_A | 198 | Gliding protein MGLA; G domain containing protein, | 96.63 | |
| 3tkl_A | 196 | RAS-related protein RAB-1A; vesicle trafficking, p | 96.63 | |
| 2cxx_A | 190 | Probable GTP-binding protein ENGB; structural geno | 96.62 | |
| 2x2e_A | 353 | Dynamin-1; nitration, hydrolase, membrane fission, | 96.62 | |
| 3bc1_A | 195 | RAS-related protein RAB-27A; RAB27, GTPase, RAB, s | 96.61 | |
| 2ew1_A | 201 | RAS-related protein RAB-30; G-protein, GTP analogu | 96.6 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 96.59 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 96.57 | |
| 2f9l_A | 199 | RAB11B, member RAS oncogene family; RAB11B GTPase, | 96.56 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 96.52 | |
| 3q72_A | 166 | GTP-binding protein RAD; G-domain, CAV2 beta, sign | 96.52 | |
| 1upt_A | 171 | ARL1, ADP-ribosylation factor-like protein 1; hydr | 96.52 | |
| 2yc2_C | 208 | IFT27, small RAB-related GTPase; transport protein | 96.51 | |
| 2p5s_A | 199 | RAS and EF-hand domain containing; G-protein, RAB, | 96.5 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 96.49 | |
| 1mh1_A | 186 | RAC1; GTP-binding, GTPase, small G-protein, RHO fa | 96.48 | |
| 3kkq_A | 183 | RAS-related protein M-RAS; GTP-binding, GTPase, si | 96.47 | |
| 2q3h_A | 201 | RAS homolog gene family, member U; GTPase, structu | 96.47 | |
| 2o52_A | 200 | RAS-related protein RAB-4B; G-protein, GDP, struct | 96.46 | |
| 3qq5_A | 423 | Small GTP-binding protein; hydrogenase, H-cluster, | 96.46 | |
| 2atv_A | 196 | RERG, RAS-like estrogen-regulated growth inhibitor | 96.46 | |
| 2qpt_A | 550 | EH domain-containing protein-2; protein-nucleotide | 96.46 | |
| 2aka_B | 299 | Dynamin-1; fusion protein, GTPase domain, myosin, | 96.46 | |
| 1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 96.43 | |
| 2wjg_A | 188 | FEOB, ferrous iron transport protein B homolog; me | 96.43 | |
| 2lkc_A | 178 | Translation initiation factor IF-2; NMR {Geobacill | 96.4 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 96.4 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 96.39 | |
| 3llu_A | 196 | RAS-related GTP-binding protein C; structural geno | 96.39 | |
| 3reg_A | 194 | RHO-like small GTPase; cytoskeleton, nucleotide-bi | 96.37 | |
| 2qag_A | 361 | Septin-2, protein NEDD5; cell cycle, cell division | 96.36 | |
| 3cbq_A | 195 | GTP-binding protein REM 2; FLJ38964A, structural g | 96.35 | |
| 3c5c_A | 187 | RAS-like protein 12; GDP, GTPase, structural genom | 96.35 | |
| 2hxs_A | 178 | RAB-26, RAS-related protein RAB-28; GTPase, signal | 96.34 | |
| 2gco_A | 201 | H9, RHO-related GTP-binding protein RHOC; GTPase,s | 96.34 | |
| 1ksh_A | 186 | ARF-like protein 2; small GTPase, small GTP-bindin | 96.34 | |
| 2a5j_A | 191 | RAS-related protein RAB-2B; GTPase, signal transdu | 96.33 | |
| 4bas_A | 199 | ADP-ribosylation factor, putative (small GTPase, p | 96.33 | |
| 2qtf_A | 364 | Protein HFLX, GTP-binding protein; beta-alpha-barr | 96.31 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 96.31 | |
| 3l0i_B | 199 | RAS-related protein RAB-1A; GEF-GDF-RAB complex, G | 96.31 | |
| 3zvr_A | 772 | Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito | 96.3 | |
| 2fv8_A | 207 | H6, RHO-related GTP-binding protein RHOB; GDP/GTP | 96.29 | |
| 2f7s_A | 217 | C25KG, RAS-related protein RAB-27B; G-protein, str | 96.28 | |
| 1m7b_A | 184 | RND3/RHOE small GTP-binding protein; small GTPase, | 96.28 | |
| 3ihw_A | 184 | Centg3; RAS, centaurin, GTPase, structural genomic | 96.28 | |
| 3cpj_B | 223 | GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl | 96.28 | |
| 1zj6_A | 187 | ADP-ribosylation factor-like protein 5; ARL, GTP-b | 96.27 | |
| 2h57_A | 190 | ADP-ribosylation factor-like protein 6; GTP, GTPas | 96.27 | |
| 4dcu_A | 456 | GTP-binding protein ENGA; GTPase, GDP, protein bin | 96.26 | |
| 2fu5_C | 183 | RAS-related protein RAB-8A; MSS4:RAB8 protein comp | 96.26 | |
| 1mky_A | 439 | Probable GTP-binding protein ENGA; GTPase, DER, KH | 96.25 | |
| 3cnl_A | 262 | YLQF, putative uncharacterized protein; circular p | 96.23 | |
| 1m2o_B | 190 | GTP-binding protein SAR1, GTP binding protein; zin | 96.22 | |
| 1f6b_A | 198 | SAR1; gtpases, N-terminal helix, Mg-containing com | 96.21 | |
| 3b1v_A | 272 | Ferrous iron uptake transporter protein B; G prote | 96.21 | |
| 2iwr_A | 178 | Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi | 96.2 | |
| 2hup_A | 201 | RAS-related protein RAB-43; G-protein, GDP, struct | 96.2 | |
| 3swk_A | 86 | Vimentin; cytoskeleton, intermediate filament, alp | 96.18 | |
| 1zd9_A | 188 | ADP-ribosylation factor-like 10B; transport protei | 96.17 | |
| 1jal_A | 363 | YCHF protein; nucleotide-binding fold, structural | 96.15 | |
| 1nrj_B | 218 | SR-beta, signal recognition particle receptor beta | 96.14 | |
| 3gee_A | 476 | MNME, tRNA modification GTPase MNME; G protein, cy | 96.14 | |
| 2j0v_A | 212 | RAC-like GTP-binding protein ARAC7; nucleotide-bin | 96.14 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 96.13 | |
| 2atx_A | 194 | Small GTP binding protein TC10; GTPase, P-loop, al | 96.12 | |
| 1gwn_A | 205 | RHO-related GTP-binding protein RHOE; GTPase, inac | 96.11 | |
| 4gzl_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 96.08 | |
| 1r8s_A | 164 | ADP-ribosylation factor 1; protein transport/excha | 96.08 | |
| 2h17_A | 181 | ADP-ribosylation factor-like protein 5A; GDP, GTPa | 96.07 | |
| 3ec1_A | 369 | YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase | 96.04 | |
| 2j1l_A | 214 | RHO-related GTP-binding protein RHOD; GTPase, memb | 96.01 | |
| 2fh5_B | 214 | SR-beta, signal recognition particle receptor beta | 96.0 | |
| 2g3y_A | 211 | GTP-binding protein GEM; small GTPase, GDP, inacti | 95.99 | |
| 1moz_A | 183 | ARL1, ADP-ribosylation factor-like protein 1; GTP- | 95.98 | |
| 2x77_A | 189 | ADP-ribosylation factor; GTP-binding protein, smal | 95.98 | |
| 3bwd_D | 182 | RAC-like GTP-binding protein ARAC6; G domain, cyto | 95.97 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 95.97 | |
| 3s84_A | 273 | Apolipoprotein A-IV; four helix bundle, transport | 95.96 | |
| 1xzp_A | 482 | Probable tRNA modification GTPase TRME; GTP-bindin | 95.95 | |
| 1mky_A | 439 | Probable GTP-binding protein ENGA; GTPase, DER, KH | 95.93 | |
| 2cjw_A | 192 | GTP-binding protein GEM; nucleotide-binding, small | 95.88 | |
| 3dz8_A | 191 | RAS-related protein RAB-3B; GDP, GTPase, structura | 95.86 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 95.86 | |
| 3h2y_A | 368 | GTPase family protein; GTP-binding protein YQEH, p | 95.86 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 95.85 | |
| 2hjg_A | 436 | GTP-binding protein ENGA; GTPase ENGA KH-domain, h | 95.83 | |
| 1fzq_A | 181 | ADP-ribosylation factor-like protein 3; protein-GD | 95.82 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 95.82 | |
| 3geh_A | 462 | MNME, tRNA modification GTPase MNME; G protein, U3 | 95.76 | |
| 3r7w_A | 307 | Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT | 95.75 | |
| 3q3j_B | 214 | RHO-related GTP-binding protein RHO6; RAS-binding | 95.75 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 95.53 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 95.53 | |
| 1ni3_A | 392 | YCHF GTPase, YCHF GTP-binding protein; structural | 95.48 | |
| 4dcu_A | 456 | GTP-binding protein ENGA; GTPase, GDP, protein bin | 95.45 | |
| 2hjg_A | 436 | GTP-binding protein ENGA; GTPase ENGA KH-domain, h | 95.39 | |
| 2b6h_A | 192 | ADP-ribosylation factor 5; membrane trafficking, G | 95.38 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 95.34 | |
| 2qag_C | 418 | Septin-7; cell cycle, cell division, GTP-binding, | 95.31 | |
| 3gj0_A | 221 | GTP-binding nuclear protein RAN; G protein, GDP, a | 95.28 | |
| 2h5e_A | 529 | Peptide chain release factor RF-3; beta barrel, tr | 95.28 | |
| 2ohf_A | 396 | Protein OLA1, GTP-binding protein 9; ATPase, GTPas | 95.17 | |
| 4dkx_A | 216 | RAS-related protein RAB-6A; GTP binding fold, memb | 95.16 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 95.13 | |
| 3sop_A | 270 | Neuronal-specific septin-3; hydrolase; HET: GDP; 2 | 95.1 | |
| 1lnz_A | 342 | SPO0B-associated GTP-binding protein; GTPase, OBG, | 95.09 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 95.07 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 95.06 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 94.93 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 94.92 | |
| 2wkq_A | 332 | NPH1-1, RAS-related C3 botulinum toxin substrate 1 | 94.9 | |
| 3p26_A | 483 | Elongation factor 1 alpha-like protein; GTP/GDP bi | 94.83 | |
| 2qnr_A | 301 | Septin-2, protein NEDD5; structural genomics conso | 94.82 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 94.79 | |
| 3th5_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 93.8 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 94.76 | |
| 3dpu_A | 535 | RAB family protein; roccor, G-domain, COR, GTP-bin | 94.73 | |
| 1u0l_A | 301 | Probable GTPase ENGC; permutation, OB-fold, zinc-f | 94.72 | |
| 2dby_A | 368 | GTP-binding protein; GDP, structural genomics, NPP | 94.7 | |
| 3sjy_A | 403 | Translation initiation factor 2 subunit gamma; zin | 94.7 | |
| 2ywe_A | 600 | GTP-binding protein LEPA; G domain, beta-barrel, f | 94.68 | |
| 2xex_A | 693 | Elongation factor G; GTPase, translation, biosynth | 94.65 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 94.6 | |
| 3cb4_D | 599 | GTP-binding protein LEPA; GTPase, OB-fold, membran | 94.54 | |
| 3tr5_A | 528 | RF-3, peptide chain release factor 3; protein synt | 94.49 | |
| 2b9c_A | 147 | Striated-muscle alpha tropomyosin; alpha-helix, co | 94.46 | |
| 1t9h_A | 307 | YLOQ, probable GTPase ENGC; N-terminal beta-barrel | 94.39 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 94.37 | |
| 1kk1_A | 410 | EIF2gamma; initiation of translation; HET: GNP; 1. | 94.37 | |
| 1udx_A | 416 | The GTP-binding protein OBG; TGS domain, riken str | 94.3 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 94.25 | |
| 2b9c_A | 147 | Striated-muscle alpha tropomyosin; alpha-helix, co | 94.16 | |
| 1wb1_A | 482 | Translation elongation factor SELB; selenocysteine | 94.16 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 94.15 | |
| 2c78_A | 405 | Elongation factor TU-A; hydrolase, GTPase, transla | 94.15 | |
| 1zun_B | 434 | Sulfate adenylate transferase, subunit 1/adenylyls | 94.12 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 94.12 | |
| 3izy_P | 537 | Translation initiation factor IF-2, mitochondrial; | 94.07 | |
| 2yv5_A | 302 | YJEQ protein; hydrolase, GTPase, permutation, stru | 94.04 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 94.01 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 94.0 | |
| 3o47_A | 329 | ADP-ribosylation factor GTPase-activating protein | 94.0 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 93.96 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 93.91 | |
| 3s84_A | 273 | Apolipoprotein A-IV; four helix bundle, transport | 93.89 | |
| 1r5b_A | 467 | Eukaryotic peptide chain release factor GTP-bindi | 93.89 | |
| 2rdo_7 | 704 | EF-G, elongation factor G; elongation factor G, EF | 93.82 | |
| 3izq_1 | 611 | HBS1P, elongation factor 1 alpha-like protein; NO- | 93.82 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 93.77 | |
| 3j2k_7 | 439 | ERF3, eukaryotic polypeptide chain release factor | 93.66 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 93.65 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 93.64 | |
| 1dar_A | 691 | EF-G, elongation factor G; ribosomal translocase, | 93.63 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 93.53 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 93.47 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 93.44 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 93.42 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 93.42 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 93.38 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 93.34 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 93.31 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 93.3 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 93.29 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 93.28 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 93.27 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 93.26 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 93.26 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 93.25 | |
| 2elf_A | 370 | Protein translation elongation factor 1A; tRNA, py | 93.24 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 93.23 | |
| 1s0u_A | 408 | EIF-2-gamma, translation initiation factor 2 gamma | 93.22 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 93.16 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 93.16 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 93.15 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 93.13 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 93.1 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 93.04 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 92.99 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 92.98 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 92.93 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 92.89 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 92.87 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 92.85 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 92.79 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 92.79 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 92.77 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 92.76 | |
| 1n0u_A | 842 | EF-2, elongation factor 2; G-protein, CIS-proline, | 92.75 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 92.7 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 92.7 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 92.67 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 92.65 | |
| 3mca_A | 592 | HBS1, elongation factor 1 alpha-like protein; prot | 92.61 | |
| 1g7s_A | 594 | Translation initiation factor IF2/EIF5B; translati | 92.54 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 92.42 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 92.29 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 92.22 | |
| 1zo1_I | 501 | IF2, translation initiation factor 2; E. coli, rib | 92.18 | |
| 3c5h_A | 255 | Glucocorticoid receptor DNA-binding factor 1; RAS, | 92.1 | |
| 1jny_A | 435 | EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- | 92.09 | |
| 1nij_A | 318 | Hypothetical protein YJIA; structural genomics, P- | 92.05 | |
| 2v66_B | 111 | Nuclear distribution protein NUDE-like 1; structur | 92.02 | |
| 1d2e_A | 397 | Elongation factor TU (EF-TU); G-protein, beta-barr | 91.96 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 91.91 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 91.88 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 91.88 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 91.87 | |
| 2rcn_A | 358 | Probable GTPase ENGC; YJEQ, circularly permuted, G | 91.83 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 91.81 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 91.72 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 91.67 | |
| 3s4r_A | 93 | Vimentin; alpha-helix, cytoskeleton, intermediate | 91.67 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 91.66 | |
| 2dy1_A | 665 | Elongation factor G; translocation, GTP complex, s | 91.66 | |
| 1f60_A | 458 | Elongation factor EEF1A; protein-protein complex, | 91.65 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 91.63 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 91.49 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 91.45 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 91.43 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 91.37 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 91.34 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 91.19 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 91.18 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 91.18 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 91.1 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 91.08 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 91.04 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 90.99 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 90.98 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 90.97 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 90.97 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 90.93 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 90.93 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 90.88 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 90.87 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 90.86 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 90.84 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 90.8 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 90.69 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 90.61 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 90.6 | |
| 2eqb_B | 97 | RAB guanine nucleotide exchange factor SEC2; coile | 90.55 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 90.54 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 90.39 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 90.39 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 90.31 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 90.22 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 90.21 | |
| 2e7s_A | 135 | RAB guanine nucleotide exchange factor SEC2; coile | 90.02 | |
| 2e7s_A | 135 | RAB guanine nucleotide exchange factor SEC2; coile | 90.02 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 89.88 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 89.87 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 89.68 | |
| 3szr_A | 608 | Interferon-induced GTP-binding protein MX1; interf | 89.67 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 89.67 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 89.59 | |
| 3mq9_A | 471 | Bone marrow stromal antigen 2 fused to maltose-BI | 89.55 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 89.34 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 89.29 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 89.16 | |
| 2f1r_A | 171 | Molybdopterin-guanine dinucleotide biosynthesis pr | 89.1 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 89.08 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 89.08 | |
| 1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 89.07 | |
| 2vp4_A | 230 | Deoxynucleoside kinase; ATP-binding, DNA synthesis | 89.05 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 89.02 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 89.01 | |
| 3mq9_A | 471 | Bone marrow stromal antigen 2 fused to maltose-BI | 89.01 | |
| 3i00_A | 120 | HIP-I, huntingtin-interacting protein 1; transcrip | 89.0 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 88.96 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 88.9 | |
| 3s4r_A | 93 | Vimentin; alpha-helix, cytoskeleton, intermediate | 88.89 | |
| 3avx_A | 1289 | Elongation factor TS, elongation factor TU, linke | 88.83 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 88.81 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 88.69 | |
| 3iox_A | 497 | AGI/II, PA; alpha helix, PPII helix, supersandwich | 88.41 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 88.32 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 88.11 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 88.05 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 88.04 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 87.89 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 87.64 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 87.42 | |
| 2a01_A | 243 | Apolipoprotein A-I; four-helix bundle, lipid trans | 87.36 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 87.35 | |
| 3haj_A | 486 | Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, | 87.26 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 87.1 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 87.0 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 86.99 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 86.95 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 86.95 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 86.93 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 86.81 | |
| 2zqm_A | 117 | Prefoldin beta subunit 1; chaperone; HET: CIT; 1.9 | 86.69 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 86.44 | |
| 3euj_A | 483 | Chromosome partition protein MUKB, linker; MUKB, M | 86.44 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 86.4 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 86.35 | |
| 2hf9_A | 226 | Probable hydrogenase nickel incorporation protein | 86.24 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 86.17 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 86.09 | |
| 1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 86.09 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 86.08 | |
| 3exa_A | 322 | TRNA delta(2)-isopentenylpyrophosphate transferase | 86.04 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 86.0 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 85.83 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 85.77 | |
| 3i00_A | 120 | HIP-I, huntingtin-interacting protein 1; transcrip | 85.67 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 85.65 | |
| 3r7w_B | 331 | Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT | 85.58 | |
| 2npi_A | 460 | Protein CLP1; CLP1-PCF11 complex, ATP binding, ter | 85.55 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 85.51 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 85.39 | |
| 1l8d_A | 112 | DNA double-strand break repair RAD50 ATPase; zinc | 85.18 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 85.13 | |
| 3r6n_A | 450 | Desmoplakin; spectrin repeat, SH3 domain, cell adh | 84.92 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 84.76 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 84.74 | |
| 1x8y_A | 86 | Lamin A/C; structural protein, intermediate filame | 84.67 | |
| 3qh9_A | 81 | Liprin-beta-2; coiled-coil, dimerization, structur | 84.67 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 84.63 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 84.61 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 84.4 | |
| 4fla_A | 152 | Regulation of nuclear PRE-mRNA domain-containing 1 | 84.3 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 84.29 | |
| 1fxk_A | 107 | Prefoldin; archaeal protein, chaperone; 2.30A {Met | 84.28 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 84.27 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 84.17 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 84.1 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 84.04 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 83.96 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 83.96 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 83.89 | |
| 3ake_A | 208 | Cytidylate kinase; CMP kinase, CMP complex, open c | 83.87 | |
| 3trt_A | 77 | Vimentin; cytoskeleton, intermediate filament, alp | 83.76 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 83.75 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 83.72 | |
| 1gk4_A | 84 | Vimentin; intermediate filament, dimer, parallel c | 83.6 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 83.56 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 83.52 | |
| 4aby_A | 415 | DNA repair protein RECN; hydrolase, double strand | 83.36 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 83.34 | |
| 2l7b_A | 307 | Apolipoprotein E, APO-E; lipid transport, atherosc | 83.0 | |
| 4gkw_A | 167 | Spindle assembly abnormal protein 6; double helix, | 82.99 | |
| 2grj_A | 192 | Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp | 82.98 | |
| 2obl_A | 347 | ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O | 82.97 | |
| 3cvf_A | 79 | Homer-3, homer protein homolog 3; coiled coil, alt | 82.97 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 82.91 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 82.69 | |
| 1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 82.65 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 82.59 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 82.49 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 82.37 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 82.34 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 82.34 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 82.3 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 82.22 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 82.17 | |
| 3r20_A | 233 | Cytidylate kinase; structural genomics, seattle st | 82.15 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 82.09 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 82.07 | |
| 1m1j_B | 464 | Fibrinogen beta chain; coiled coils, disulfide rin | 82.04 | |
| 3eph_A | 409 | TRNA isopentenyltransferase; transferase, alternat | 81.73 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 81.73 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 81.65 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 81.5 | |
| 3a7p_A | 152 | Autophagy protein 16; coiled-coil, coiled coil, cy | 81.44 | |
| 1qhl_A | 227 | Protein (cell division protein MUKB); SMC, chromos | 81.41 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 81.28 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 81.19 | |
| 3qh9_A | 81 | Liprin-beta-2; coiled-coil, dimerization, structur | 81.0 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 80.9 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 80.74 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 80.68 | |
| 1f2t_A | 149 | RAD50 ABC-ATPase; DNA double-strand break repair, | 80.65 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 80.57 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 80.54 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 80.49 | |
| 1a7j_A | 290 | Phosphoribulokinase; transferase, calvin cycle; 2. | 80.45 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 80.41 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 80.31 |
| >1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=1.5e-90 Score=796.25 Aligned_cols=515 Identities=28% Similarity=0.491 Sum_probs=476.1
Q ss_pred CCCCCeeEEEeCCCCceeeCHHHHHHhhccCCCEEEEEeeCCCCCChhHHHHHHhCCCCcccccCCCCCccceEEeeccc
Q 004698 38 GPARPIRLVYCDEKGKFRMDPEAVAALQLVKEPIGVVSVCGRARQGKSFILNQLLGRSSGFQVASTHRPCTKGLWLWSAP 117 (736)
Q Consensus 38 ~~~~pi~Lv~~d~~~~l~l~~eAl~~L~~i~~~v~vVsv~G~~rtGKS~LlN~l~~~~~gF~~~~~~~~~T~Giw~w~~p 117 (736)
..+.|||||.++ +|.|.+|++|+++|..++.|+.+|+|+|++++|||||+|.|+|...||.+++++.+||+|||+|+.|
T Consensus 6 ~m~~pv~li~~~-~~~l~~~~eal~~L~~i~~~~~~VaivG~pnvGKStLiN~L~g~~~~~~~~~tt~~~T~gi~~~~~~ 84 (592)
T 1f5n_A 6 HMTGPMCLIENT-NGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGIWMWCVP 84 (592)
T ss_dssp -CCSCEEEEEEE-TTEEEECHHHHHHHHTCCSBEEEEEEEEBTTSSHHHHHHHHTTCSSCSCCCCSSSCCCCSEEEEEEE
T ss_pred CCCCCeEEEEeC-CCcEEECHHHHHHHHhccCCCcEEEEECCCCCCHHHHHHhHcCCCCccccCCCCCCceeEEEEeecc
Confidence 356799999987 7999999999999999999999999999999999999999999999999999999999999999988
Q ss_pred cccccCCCCceEEEEeecCCCcccCC-CCccchHHHHHhhhccceEEEccCCCCchHHhhhhHHHHHHHHHHHHHhcC--
Q 004698 118 LKRTALDGTEYNLLLLDSEGIDAYDQ-TGTYSTQIFSLAVLLSSMFIYNQMGGIDESAIDRLSLVTQMTKHIRIRASG-- 194 (736)
Q Consensus 118 ~~~~~~~g~~~~v~llDteG~~~~~~-~~~~d~~IFaLa~LLSS~~IyN~~g~i~e~~l~~L~~v~el~~~i~~k~~~-- 194 (736)
++. +.+..++|+||||+++... +..+|+++|+|+++|||++|||+.|.|++++++.|++++++++.++.++++
T Consensus 85 ~~~----~~~~~i~LiDTpGi~~~~~~~~~~~~~~fala~llss~lv~n~~~~i~~~dl~~l~~v~e~~~~l~~k~~~~~ 160 (592)
T 1f5n_A 85 HPK----KPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSSPDE 160 (592)
T ss_dssp CSS----STTCEEEEEEECCBCCGGGCCCTTHHHHHHHHHHHCSEEEEEEESCSSHHHHHTTHHHHTHHHHCBSCCC---
T ss_pred ccc----CCCceEEEecCCCcCcccccchhHHHHHHHHHHHhcCeEEEECCCCccHHHHHHHHHHHHHhhhhhcccCccc
Confidence 854 2346799999999988776 567899999999999999999999999999999999999999999887652
Q ss_pred ---CCCCCCcccccCCeEEEEeecccccccccCccCChHHHHHHhhccccCCChhhhhhhHHHHHHHhhCCCCceEeccC
Q 004698 195 ---GKTTPSELGQFSPIFVWLLRDFYLDLVEDNRKITPRDYLEIALRPVQGSGRDIAAKNEIRDSIRALFPDRECFTLVR 271 (736)
Q Consensus 195 ---~~~~~~e~~~~~P~f~wlvRDf~l~~~~~g~~~t~~~yLe~~L~~~~g~~~~~~~~n~ir~~i~~~F~~~~cf~l~~ 271 (736)
+..+..+++.|||+|+||||||++++..+|+++|+++||+++|+..+|.++.+...|.+|.+|++|||+++||+|||
T Consensus 161 ~~~~~~~~~~~~~~fP~~~wvvRD~~l~~~~~g~~~t~~eyLe~~L~~~~~~~~~~~~~n~~R~~I~~~F~~~~cf~lp~ 240 (592)
T 1f5n_A 161 NENEVEDSADFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFVFDR 240 (592)
T ss_dssp ----CCGGGGHHHHCCEEEEEEETCCCCCCCSSSCCCHHHHHHHHTCCCCCCSHHHHHHHHHHHHHHHHCSCEEEEECCC
T ss_pred ccccccchhhhhccCCceEEEEecccchhccCCCCCCHHHHHHHHHhhccCCChhhHhhhhHHHHHHHhCCCCcEEEeCC
Confidence 22234567889999999999999999889999999999999999999988889999999999999999999999999
Q ss_pred CCcChhhhhcccCCCcCCCChHHHHHHHHHHHHHhccCCcccc-CCcccchhhHHHHHHHHHHHHhcCCCCCccchHHHH
Q 004698 272 PLSNENELQRLDQISLDRLRPEFRAGLDALTKFVFERTRPKQV-GATVLTGPVLIGITESYLDAINNGAVPTISSSWQSV 350 (736)
Q Consensus 272 P~~~~~~l~~l~~~~~~~l~~eF~~~l~~l~~~i~~~~~pK~~-~g~~ltg~~l~~l~~~yv~ain~g~vP~i~s~~~~~ 350 (736)
|+.+. .+++++.++.++|+|+|+++++.||++|++.++||++ +|.++||++|+.|++.||+|||+|.+|+++|+|.++
T Consensus 241 P~~~~-~l~~L~~~~~~~L~peF~~~l~~l~~~i~~~~~~K~~~gg~~vtG~~L~~l~~~yv~ain~g~vP~~~s~~~a~ 319 (592)
T 1f5n_A 241 PVHRR-KLAQLEKLQDEELDPEFVQQVADFCSYIFSNSKTKTLSGGIQVNGPRLESLVLTYVNAISSGDLPCMENAVLAL 319 (592)
T ss_dssp CSCGG-GGGGGGGSCGGGSCHHHHHHHHHHHHHHHHHCCCCEETTTEECBHHHHHHHHHHHHHHHHHTSCCBHHHHHHHH
T ss_pred CCcHH-HHhhhccCChhhCCHHHHHHHHHHHHHHHccccceeecCCccccHHHHHHHHHHHHHHHhCCCCCCcchHHHHH
Confidence 99988 8999999999999999999999999999999999999 578999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHhhcccC--CCCCh-HHHHHHHHHHHHHHHHHhhhcccCChhhhHHHHHHHHHHHHHHHHHHHH
Q 004698 351 EEAECRRAYDSATETYMSTFDRS--KPPEE-VALGEAHEAAVQKALAVYNAGAVGVGLARKKYEGLLQKFFRKAFEDHKK 427 (736)
Q Consensus 351 ~e~~~~~a~~~A~~~Y~~~m~~~--~p~~e-~~L~~~h~~~~~~Al~~F~~~s~g~~~~~~~~~~~L~~~i~~~~e~~~~ 427 (736)
++.+|.+|++.|+++|.+.|... +|.+. ++|...|..+..+|+++|++.+|+ +..++|+++|...|.+.+++|++
T Consensus 320 a~~e~~~av~~A~~~Y~~~M~~~~~~P~~~~~eL~~~H~~~~~~Al~~F~~~~~~--d~~~~~~~~L~~~i~~~~~~~~~ 397 (592)
T 1f5n_A 320 AQIENSAAVQKAIAHYEQQMGQKVQLPTESLQELLDLHRDSEREAIEVFIRSSFK--DVDHLFQKELAAQLEKKRDDFCK 397 (592)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHCCSSCSSHHHHHHHHHHHHHHHHHHHHHHCCC--CGGGHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHhhcCCCCCCHHHHHHHHHHHHHHHHHHHHHhcch--hhHHHHHHHHHHHHHHHHHHHHH
Confidence 99999999999999999999863 46655 899999999999999999999987 56789999999999999999999
Q ss_pred HHHHHHHHHHHHHHHH----HHHHHHhhccCCCcchhHHHHHHHHHHHHHhccc-CCCchhHHHHHHHH--HhhhhhHHH
Q 004698 428 NVYMEADIRCSSAIQS----MERKLRAACHSSDASIDNVVKVLDGLISEYETSC-HGPGKWQKLATFLQ--QSSEGPILD 500 (736)
Q Consensus 428 ~n~~~s~~~C~~~l~~----le~~l~~~~~~~~~~~~~~~~~~~~ll~~Y~~~~-~Gp~K~~~L~~fLq--~~~~~~il~ 500 (736)
.|+.+|..+|+++|+. |+++|+++.+..+|+|+.|.+.++.+..+|+..+ +||.++.+|++||+ ....++|++
T Consensus 398 ~N~~~s~~~C~~ll~~l~~~l~~~i~~g~~~~p~g~~~~~~~~~~~~~~Y~~~~~kg~~~~~vl~~fl~~~~~~~~~ilq 477 (592)
T 1f5n_A 398 QNQEASSDRCSGLLQVIFSPLEEEVKAGIYSKPGGYRLFVQKLQDLKKKYYEEPRKGIQAEEILQTYLKSKESMTDAILQ 477 (592)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHTTTTSSTTHHHHHHHHHHHHHHHHHHSSCCCTTHHHHHHHHHHHTHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHhcCCcCCCCcHHHHHHHHHHHHHHHHHhcCCcccHHHHHHHHHHHHHHHHHHHHH
Confidence 9999999999999986 5666667788888899999999999999999999 89999999999998 467899999
Q ss_pred HHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 004698 501 LVKRLIDQIGSERSSLMLKYRSIEDNMKLLKKQLEDSERYKSEYLKRYDDAINDKKKLADD 561 (736)
Q Consensus 501 ~~~~l~~~i~~e~~~L~~k~es~e~e~~~lk~~Le~~e~~~~e~~k~~e~~In~lkk~~e~ 561 (736)
+|+.|+++ ++++.+.+++.++++.+...+.+.+...++.+++.+++|+++|.+++.+|+.
T Consensus 478 ~d~~l~~~-~k~~~~~~~~~e~~~~~~~~l~~~~~~~~~~~~~~~~~~~e~~~ql~~kme~ 537 (592)
T 1f5n_A 478 TDQTLTEK-EKEIEVERVKAESAQASAKMLHEMQRKNEQMMEQKERSYQEHLKQLTEKMEN 537 (592)
T ss_dssp HCSSSCHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 99999999 9999999999999999999999999999999999999999999999766554
|
| >4ido_A Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HET: GDP; 2.09A {Homo sapiens} PDB: 4idn_A* 3q5d_A* 3q5e_A* 4idq_A* 4idp_A* 3qnu_A* 3qof_A* | Back alignment and structure |
|---|
| >3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
| >2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
| >3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 | Back alignment and structure |
|---|
| >1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X | Back alignment and structure |
|---|
| >2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A | Back alignment and structure |
|---|
| >2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* | Back alignment and structure |
|---|
| >3trt_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural protein; 2.30A {Homo sapiens} PDB: 3klt_A* | Back alignment and structure |
|---|
| >3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* | Back alignment and structure |
|---|
| >3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* | Back alignment and structure |
|---|
| >2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* | Back alignment and structure |
|---|
| >3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* | Back alignment and structure |
|---|
| >1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* | Back alignment and structure |
|---|
| >2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* | Back alignment and structure |
|---|
| >1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* | Back alignment and structure |
|---|
| >4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* | Back alignment and structure |
|---|
| >3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} | Back alignment and structure |
|---|
| >2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* | Back alignment and structure |
|---|
| >1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* | Back alignment and structure |
|---|
| >1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* | Back alignment and structure |
|---|
| >1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* | Back alignment and structure |
|---|
| >2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* | Back alignment and structure |
|---|
| >1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* | Back alignment and structure |
|---|
| >2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* | Back alignment and structure |
|---|
| >3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A | Back alignment and structure |
|---|
| >3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... | Back alignment and structure |
|---|
| >1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* | Back alignment and structure |
|---|
| >1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A | Back alignment and structure |
|---|
| >1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* | Back alignment and structure |
|---|
| >1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* | Back alignment and structure |
|---|
| >2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} | Back alignment and structure |
|---|
| >1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* | Back alignment and structure |
|---|
| >2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A | Back alignment and structure |
|---|
| >3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* | Back alignment and structure |
|---|
| >3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* | Back alignment and structure |
|---|
| >2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* | Back alignment and structure |
|---|
| >2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* | Back alignment and structure |
|---|
| >1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
|---|
| >2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* | Back alignment and structure |
|---|
| >2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* | Back alignment and structure |
|---|
| >2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* | Back alignment and structure |
|---|
| >3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* | Back alignment and structure |
|---|
| >2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* | Back alignment and structure |
|---|
| >2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* | Back alignment and structure |
|---|
| >3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* | Back alignment and structure |
|---|
| >3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} | Back alignment and structure |
|---|
| >2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A | Back alignment and structure |
|---|
| >3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* | Back alignment and structure |
|---|
| >2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* | Back alignment and structure |
|---|
| >1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* | Back alignment and structure |
|---|
| >2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C | Back alignment and structure |
|---|
| >2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... | Back alignment and structure |
|---|
| >3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* | Back alignment and structure |
|---|
| >2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} | Back alignment and structure |
|---|
| >2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} | Back alignment and structure |
|---|
| >2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} | Back alignment and structure |
|---|
| >2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* | Back alignment and structure |
|---|
| >1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* | Back alignment and structure |
|---|
| >3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* | Back alignment and structure |
|---|
| >2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* | Back alignment and structure |
|---|
| >2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... | Back alignment and structure |
|---|
| >1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* | Back alignment and structure |
|---|
| >2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* | Back alignment and structure |
|---|
| >4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} | Back alignment and structure |
|---|
| >2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A | Back alignment and structure |
|---|
| >2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* | Back alignment and structure |
|---|
| >1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* | Back alignment and structure |
|---|
| >3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* | Back alignment and structure |
|---|
| >2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* | Back alignment and structure |
|---|
| >1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 | Back alignment and structure |
|---|
| >3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* | Back alignment and structure |
|---|
| >1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* | Back alignment and structure |
|---|
| >1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* | Back alignment and structure |
|---|
| >3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* | Back alignment and structure |
|---|
| >2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A | Back alignment and structure |
|---|
| >2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* | Back alignment and structure |
|---|
| >1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
|---|
| >1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* | Back alignment and structure |
|---|
| >2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* | Back alignment and structure |
|---|
| >1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... | Back alignment and structure |
|---|
| >2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* | Back alignment and structure |
|---|
| >3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} | Back alignment and structure |
|---|
| >2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 | Back alignment and structure |
|---|
| >2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} | Back alignment and structure |
|---|
| >3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >3s84_A Apolipoprotein A-IV; four helix bundle, transport protein; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* | Back alignment and structure |
|---|
| >1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 | Back alignment and structure |
|---|
| >2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* | Back alignment and structure |
|---|
| >3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* | Back alignment and structure |
|---|
| >3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} | Back alignment and structure |
|---|
| >3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* | Back alignment and structure |
|---|
| >3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
|---|
| >4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* | Back alignment and structure |
|---|
| >2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... | Back alignment and structure |
|---|
| >2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* | Back alignment and structure |
|---|
| >2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} | Back alignment and structure |
|---|
| >1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* | Back alignment and structure |
|---|
| >3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* | Back alignment and structure |
|---|
| >2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A | Back alignment and structure |
|---|
| >3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* | Back alignment and structure |
|---|
| >2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* | Back alignment and structure |
|---|
| >2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* | Back alignment and structure |
|---|
| >3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* | Back alignment and structure |
|---|
| >1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... | Back alignment and structure |
|---|
| >1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} | Back alignment and structure |
|---|
| >2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >3s84_A Apolipoprotein A-IV; four helix bundle, transport protein; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A | Back alignment and structure |
|---|
| >2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H | Back alignment and structure |
|---|
| >3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* | Back alignment and structure |
|---|
| >1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* | Back alignment and structure |
|---|
| >1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 | Back alignment and structure |
|---|
| >2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* | Back alignment and structure |
|---|
| >1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 | Back alignment and structure |
|---|
| >3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* | Back alignment and structure |
|---|
| >2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A | Back alignment and structure |
|---|
| >3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >2a01_A Apolipoprotein A-I; four-helix bundle, lipid transport; HET: AC9; 2.40A {Homo sapiens} PDB: 3k2s_A* 1av1_A 3j00_0* | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2zqm_A Prefoldin beta subunit 1; chaperone; HET: CIT; 1.90A {Thermococcus SP} PDB: 2zdi_A | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} | Back alignment and structure |
|---|
| >1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
|---|
| >3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* | Back alignment and structure |
|---|
| >2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A | Back alignment and structure |
|---|
| >1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1x8y_A Lamin A/C; structural protein, intermediate filament protein; 2.20A {Homo sapiens} SCOP: h.1.20.1 PDB: 3v5b_A 3v4w_A 3v4q_A | Back alignment and structure |
|---|
| >3qh9_A Liprin-beta-2; coiled-coil, dimerization, structural protein; 2.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >4fla_A Regulation of nuclear PRE-mRNA domain-containing 1B; structural genomics consortium, SGC, transcription; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >1fxk_A Prefoldin; archaeal protein, chaperone; 2.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: a.2.5.1 PDB: 1fxk_B | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* | Back alignment and structure |
|---|
| >3trt_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural protein; 2.30A {Homo sapiens} PDB: 3klt_A* | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
| >1gk4_A Vimentin; intermediate filament, dimer, parallel coiled coil, heptad repeat, stutter; 2.3A {Homo sapiens} SCOP: h.1.20.1 | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >2l7b_A Apolipoprotein E, APO-E; lipid transport, atherosclerosis, alzheime disease; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4gkw_A Spindle assembly abnormal protein 6; double helix, SAS-5, centriole, structural protein; 3.30A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* | Back alignment and structure |
|---|
| >3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B* | Back alignment and structure |
|---|
| >3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3qh9_A Liprin-beta-2; coiled-coil, dimerization, structural protein; 2.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 736 | ||||
| d1f5na2 | 277 | c.37.1.8 (A:7-283) Interferon-induced guanylate-bi | 1e-78 | |
| d1f5na1 | 300 | a.114.1.1 (A:284-583) Interferon-induced guanylate | 1e-22 | |
| d1f5na1 | 300 | a.114.1.1 (A:284-583) Interferon-induced guanylate | 0.001 |
| >d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 277 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: G proteins domain: Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain species: Human (Homo sapiens) [TaxId: 9606]
Score = 251 bits (642), Expect = 1e-78
Identities = 94/279 (33%), Positives = 156/279 (55%), Gaps = 12/279 (4%)
Query: 42 PIRLVYCDEKGKFRMDPEAVAALQLVKEPIGVVSVCGRARQGKSFILNQLLGRSSGFQVA 101
P+ L+ + G+ +PEA+ L + +P+ VV++ G R GKS+++N+L G+ GF +
Sbjct: 4 PMCLIE-NTNGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLG 62
Query: 102 STHRPCTKGLWLWSAPLKRTALDGTEYNLLLLDSEGIDAYDQ-TGTYSTQIFSLAVLLSS 160
ST + TKG+W+W P + L+LLD+EG+ ++ + IF+LAVLLSS
Sbjct: 63 STVQSHTKGIWMWCVPHP----KKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSS 118
Query: 161 MFIYNQMGGIDESAIDRLSLVTQMTKHIRIRAS-----GGKTTPSELGQFSPIFVWLLRD 215
F+YN +G I++ A+D+L VT++T IR ++S ++ F P FVW LRD
Sbjct: 119 TFVYNSIGTINQQAMDQLYYVTELTHRIRSKSSPDENENEVEDSADFVSFFPDFVWTLRD 178
Query: 216 FYLDLVEDNRKITPRDYLEIALRPVQGSGRDIAAKNEIRDSIRALFPDRECFTLVRPLSN 275
F LDL D + +TP +YL +L+ +G+ + N R IR FP ++CF RP+
Sbjct: 179 FSLDLEADGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFVFDRPVHR 238
Query: 276 ENELQRLDQISLDRLRPEFRAGLDALTKFVFERTRPKQV 314
L +L+++ + L PEF + ++F ++ K +
Sbjct: 239 RK-LAQLEKLQDEELDPEFVQQVADFCSYIFSNSKTKTL 276
|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 | Back information, alignment and structure |
|---|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 736 | |||
| d1f5na2 | 277 | Interferon-induced guanylate-binding protein 1 (GB | 100.0 | |
| d1f5na1 | 300 | Interferon-induced guanylate-binding protein 1 (GB | 99.96 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 98.03 | |
| d1tq4a_ | 400 | Interferon-inducible GTPase {Mouse (Mus musculus) | 97.87 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 97.85 | |
| d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 97.62 | |
| d1lnza2 | 185 | Obg GTP-binding protein middle domain {Bacillus su | 97.48 | |
| d2akab1 | 299 | Dynamin G domain {Rat (Rattus norvegicus) [TaxId: | 97.4 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 97.39 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 97.34 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 97.24 | |
| d1jwyb_ | 306 | Dynamin G domain {Dictyostelium discoideum [TaxId: | 97.24 | |
| d1puja_ | 273 | Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 | 97.24 | |
| d1g7sa4 | 227 | Initiation factor IF2/eIF5b, N-terminal (G) domain | 97.24 | |
| d1xzpa2 | 160 | TrmE GTPase domain {Thermotoga maritima [TaxId: 23 | 97.23 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 97.2 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 97.16 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 97.1 | |
| d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 96.96 | |
| d1wb1a4 | 179 | Elongation factor SelB, N-terminal domain {Methano | 96.95 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 96.68 | |
| d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 96.54 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 96.49 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 96.45 | |
| d2g3ya1 | 172 | GTP-binding protein GEM {Human (Homo sapiens) [Tax | 96.45 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 96.42 | |
| d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 96.41 | |
| d1i2ma_ | 170 | Ran {Human (Homo sapiens) [TaxId: 9606]} | 96.38 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 96.36 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 96.23 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 96.18 | |
| d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 96.18 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 96.13 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 96.12 | |
| d2c78a3 | 204 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 96.12 | |
| d1x3sa1 | 177 | Rab18 {Human (Homo sapiens) [TaxId: 9606]} | 96.08 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 96.05 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 96.0 | |
| d2gjsa1 | 168 | Rad {Human (Homo sapiens) [TaxId: 9606]} | 95.99 | |
| d1kk1a3 | 195 | Initiation factor eIF2 gamma subunit, N-terminal ( | 95.99 | |
| d2fu5c1 | 173 | Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | 95.94 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 95.92 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 95.89 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 95.88 | |
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 95.78 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 95.77 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 95.72 | |
| d2erxa1 | 171 | di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 95.71 | |
| d2atva1 | 168 | Ras-like estrogen-regulated growth inhibitor, RERG | 95.68 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 95.67 | |
| d1ek0a_ | 170 | Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T | 95.65 | |
| d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 95.65 | |
| d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 95.57 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 95.51 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 95.5 | |
| d2bmja1 | 175 | Centaurin gamma 1, G domain {Human (Homo sapiens) | 95.49 | |
| d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 95.38 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 95.37 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 95.35 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 95.33 | |
| d1e0sa_ | 173 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 95.3 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 95.25 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 95.19 | |
| d1wxqa1 | 319 | GTP-binding protein PH0525 {Pyrococcus horikoshii | 95.16 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 95.07 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 95.07 | |
| d1u8za_ | 168 | Ras-related protein RalA {Cotton-top tamarin (Sagu | 95.05 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 94.99 | |
| d1kmqa_ | 177 | RhoA {Human (Homo sapiens) [TaxId: 9606]} | 94.78 | |
| d1c1ya_ | 167 | Rap1A {Human (Homo sapiens) [TaxId: 9606]} | 94.77 | |
| d2atxa1 | 185 | RhoQ {Human (Homo sapiens) [TaxId: 9606]} | 94.74 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 94.73 | |
| d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 94.68 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 94.57 | |
| d2qn6a3 | 205 | Initiation factor eIF2 gamma subunit, N-terminal ( | 94.56 | |
| d2ngra_ | 191 | CDC42 {Human (Homo sapiens) [TaxId: 9606]} | 94.55 | |
| d2bv3a2 | 276 | Elongation factor G (EF-G), N-terminal (G) domain | 94.48 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 94.41 | |
| d2dy1a2 | 267 | Elongation factor G (EF-G), N-terminal (G) domain | 94.29 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 94.05 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 93.96 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 93.95 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 93.93 | |
| d1m7ba_ | 179 | RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | 93.77 | |
| d1x1ra1 | 169 | Ras-related protein M-Ras (XRas) {Mouse (Mus muscu | 93.7 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 93.69 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 93.46 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 93.42 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 93.35 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 93.34 | |
| d1mh1a_ | 183 | Rac {Human (Homo sapiens) [TaxId: 9606]} | 93.33 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 93.28 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 93.27 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 93.25 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 93.11 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 93.05 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 93.04 | |
| d1zunb3 | 222 | Sulfate adenylate transferase subunit cysN/C, EF-T | 93.02 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 93.0 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 92.95 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 92.68 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 92.67 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 92.64 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 92.6 | |
| d1zcba2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 92.6 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 92.57 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 92.47 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 92.43 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 92.42 | |
| d1jala1 | 278 | YchF GTP-binding protein N-terminal domain {Haemop | 92.32 | |
| d1d2ea3 | 196 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 92.31 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 92.26 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 92.01 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 91.72 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 91.53 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 91.47 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 91.38 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 91.15 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 91.07 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 90.75 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 90.42 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 90.07 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 89.71 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 89.51 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 89.36 | |
| d1n0ua2 | 341 | Elongation factor 2 (eEF-2), N-terminal (G) domain | 89.35 | |
| d1r5ba3 | 245 | Eukaryotic peptide chain release factor ERF2, G do | 89.34 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 88.94 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 88.9 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 88.66 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 88.4 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 88.31 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 88.28 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 88.17 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 88.16 | |
| d1svsa1 | 195 | Transducin (alpha subunit) {Rat (Rattus norvegicus | 87.14 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 86.72 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 86.39 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 86.12 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 85.97 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 85.96 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 85.92 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 85.83 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 85.81 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 85.72 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 85.56 | |
| d2bcjq2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 85.39 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 85.13 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 84.76 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 84.73 | |
| d1deka_ | 241 | Deoxynucleoside monophosphate kinase {Bacteriophag | 84.65 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 84.54 | |
| d1ni3a1 | 296 | YchF GTP-binding protein N-terminal domain {Fissio | 84.34 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 84.05 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 83.77 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 83.25 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 82.95 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 82.6 | |
| d1fxka_ | 107 | Prefoldin beta subunit {Archaeon Methanobacterium | 82.54 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 82.5 | |
| d2efla1 | 288 | Formin-binding protein 1, FNBP1 {Human (Homo sapie | 82.42 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 82.2 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 81.99 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 81.62 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 81.46 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 81.29 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 81.1 | |
| d1fxka_ | 107 | Prefoldin beta subunit {Archaeon Methanobacterium | 81.04 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 80.95 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 80.17 |
| >d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: G proteins domain: Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=5.6e-62 Score=511.09 Aligned_cols=270 Identities=35% Similarity=0.678 Sum_probs=246.4
Q ss_pred CCCeeEEEeCCCCceeeCHHHHHHhhccCCCEEEEEeeCCCCCChhHHHHHHhCCCCcccccCCCCCccceEEeeccccc
Q 004698 40 ARPIRLVYCDEKGKFRMDPEAVAALQLVKEPIGVVSVCGRARQGKSFILNQLLGRSSGFQVASTHRPCTKGLWLWSAPLK 119 (736)
Q Consensus 40 ~~pi~Lv~~d~~~~l~l~~eAl~~L~~i~~~v~vVsv~G~~rtGKS~LlN~l~~~~~gF~~~~~~~~~T~Giw~w~~p~~ 119 (736)
+.|||||+ +++|+|.++++|+++|+.+++||+||||+|++|||||||||+|+|...||.||+++++||+|||||+.|++
T Consensus 2 ~~p~~li~-~~~~~l~~~~e~l~~l~~~~~~v~vvsi~G~~~sGKS~llN~l~~~~~~f~~~~~~~~~T~Giw~~~~~~~ 80 (277)
T d1f5na2 2 TGPMCLIE-NTNGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGSTVQSHTKGIWMWCVPHP 80 (277)
T ss_dssp CSCEEEEE-EETTEEEECHHHHHHHHTCCSBEEEEEEEEBTTSSHHHHHHHHTTCSSCSCCCCSSSCCCCSEEEEEEECS
T ss_pred CCCeEEEE-cCCCeEEECHHHHHHHHcCCCCEEEEEEECCCCCCHHHHHHHHcCCCCCCccCCCCCCCCCceEEEEeecc
Confidence 57999997 56799999999999999999999999999999999999999999999999999999999999999999985
Q ss_pred cccCCCCceEEEEeecCCCcccCC-CCccchHHHHHhhhccceEEEccCCCCchHHhhhhHHHHHHHHHHHHHhcC----
Q 004698 120 RTALDGTEYNLLLLDSEGIDAYDQ-TGTYSTQIFSLAVLLSSMFIYNQMGGIDESAIDRLSLVTQMTKHIRIRASG---- 194 (736)
Q Consensus 120 ~~~~~g~~~~v~llDteG~~~~~~-~~~~d~~IFaLa~LLSS~~IyN~~g~i~e~~l~~L~~v~el~~~i~~k~~~---- 194 (736)
+|.++.|++|||||+++.+. +..+|.+||+|++||||++|||+++.|++.++++|++++++++.+.++.+.
T Consensus 81 ----~~~~~~~~~lDteG~~~~~~~~~~~~~~i~~l~~llSs~~i~N~~~~~~~~~l~~L~~~~~~~~~~~~~~~~~~~~ 156 (277)
T d1f5na2 81 ----KKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTINQQAMDQLYYVTELTHRIRSKSSPDENE 156 (277)
T ss_dssp ----SSTTCEEEEEEECCBCCGGGCCCTTHHHHHHHHHHHCSEEEEEEESCSSHHHHHTTHHHHTHHHHCBSCCC-----
T ss_pred ----CCCCceEEEEecccccccccccchhHHHHHHHHHHHhCEEEEeccccCcHHHHHHHHHHHHHHHHHHHhhcccccc
Confidence 46778999999999998775 456899999999999999999999999999999999999999988766531
Q ss_pred -CCCCCCcccccCCeEEEEeecccccccccCccCChHHHHHHhhccccCCChhhhhhhHHHHHHHhhCCCCceEeccCCC
Q 004698 195 -GKTTPSELGQFSPIFVWLLRDFYLDLVEDNRKITPRDYLEIALRPVQGSGRDIAAKNEIRDSIRALFPDRECFTLVRPL 273 (736)
Q Consensus 195 -~~~~~~e~~~~~P~f~wlvRDf~l~~~~~g~~~t~~~yLe~~L~~~~g~~~~~~~~n~ir~~i~~~F~~~~cf~l~~P~ 273 (736)
+.....++..++|.|+|+||||++++..+|..+|+.+||+++|+..++.+.++...|.+|++|++||++++||+||||+
T Consensus 157 ~~~~~~~~~~~~~p~l~~vvRD~~~~~~~~~~~~t~~eyLe~~l~~~~~~~~~~~~~N~~R~~i~~~F~dv~cf~Lp~P~ 236 (277)
T d1f5na2 157 NEVEDSADFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKKGTSQKDETFNLPRLCIRKFFPKKKCFVFDRPV 236 (277)
T ss_dssp --CCGGGGHHHHCCEEEEEEETCCCCCCCSSSCCCHHHHHHHHTCCCCCCSHHHHHHHHHHHHHHHHCSCEEEEECCCCS
T ss_pred cccccchhhcccCCceEEEeecccccccccCCcccHHHHHHHHHhcccCchhhhHhhhhHHHHHHHhcCCCeEEeCCCCc
Confidence 1122345567899999999999998877889999999999999999998889999999999999999999999999998
Q ss_pred cChhhhhcccCCCcCCCChHHHHHHHHHHHHHhccCCccccC
Q 004698 274 SNENELQRLDQISLDRLRPEFRAGLDALTKFVFERTRPKQVG 315 (736)
Q Consensus 274 ~~~~~l~~l~~~~~~~l~~eF~~~l~~l~~~i~~~~~pK~~~ 315 (736)
..+ .+++++.++.++|+|+|+++++.||++|+++++||+++
T Consensus 237 ~~~-~l~~l~~~~~~~L~~~F~~~v~~L~k~I~~~~~~K~ln 277 (277)
T d1f5na2 237 HRR-KLAQLEKLQDEELDPEFVQQVADFCSYIFSNSKTKTLS 277 (277)
T ss_dssp CGG-GGGGGGGSCGGGSCHHHHHHHHHHHHHHHHHCCCCEET
T ss_pred chh-hhchhhcCCccccCHHHHHHHHHHHHHHhccCCCcccC
Confidence 654 58899999999999999999999999999999999874
|
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1fxka_ a.2.5.1 (A:) Prefoldin beta subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2efla1 a.238.1.4 (A:1-288) Formin-binding protein 1, FNBP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1fxka_ a.2.5.1 (A:) Prefoldin beta subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|