Citrus Sinensis ID: 004707

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730----

MKVLIVLDDVNKDEQLEGLIGGLDQYGPGSRIVVTTRDKGVLENFGVEKIYRVNGLEFYEAFELFYYFAFKENHCPEDFKRDSRRVVKYADGNPLVLKVLGSSLKRKSHWGNVLDDLNRICESDIHDIHDILKISFNELMPKMKSIFLDIACFFEGEDKDFVTRILDDYGSYGLEVLIDKSLITVSHNCLRMHDLLQEMGREIVRQESEKEPGKRSRLWDPKEIRRVLKHNKLDLRDCRRLKRISTRFCKLKSLVDLFLHGCLNLERFPEILEKMEHLKHIYLQRTAITELPSSFENLLGLESLSVRGCSKLDKLPDNIGNLESLAYILADGSAISQLPSSVADSNVLRYLWFPRCRNLVSLPPLLLSGLSSLECLHLRDCAVTDIPQEIGCLSSLEELDLSGNSFESLPVSIKQLSQLSSLDLSDCNMLRSLPELPSCLGFLNLSGCNMLQSLPELPLRLRRLRAGNCKLLQSLPEIRSSVEELDASVPENLSKYSNNPRVVYPTEISHQFTNCLKLNEKANNRILADLRLRIQHMTIALLRRLDERVKNKKRIAPKACTIALPGSEIPDWFRNQSSGHLMSIQLLSHSFCRNLIGFAFCAVLGFKQDLDFLDTIGDGRQFSSLRDPFVSVRYRFRLETKTVSEAKHVNRYNHFEDLQRPIDSDHVILGFCLCMNVGFPDGNNHTTVSFEFFPAVGNALYGGYGVKRCGLCPVYANPNETKANTFTLNFATEV

cEEEEEEcccccHHHHHHHHccccccccccEEEEEcccHHHHHccccccEEEcccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHccccccHHHHccccccccHHHHHHHHHHHccccccccHHHEEEEEccccccccccEEEEEEEccccccHHHHHHHHHHcccccccccccccccEEEccEEEccHHHHHHHHHHHHHccccccccEEEEcccHHHHHcccccccccccccccccccHHHcccccccEEEEEcccccccccccccccccccEEEccccccccccccccccccccEEEcccccccEEccccccccHHHHHHHccccccEEccccccccccccEEEccccccccccccccccccccccEEEccccccccccccccccccccEEEccccccEEccccccccccccEEEccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEccccccccccccccccEEEEEccccccccccEEEEEEEEEcccccccccccccccccccccccccEEEEEEEEEcccccccccccccccccccccccccccEEEEEEEEccccccccccccEEEEEEEEEccccccccccEEEEEEEEEEEccccccccccccccccccc

cEEEEEEcccccHHHHHHHHccccccccccEEEEEEccHHHHHHcccccEEEEccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHccccHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHEEEccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcEEEEEccccEEHHHHHHHHHHHHHHHcccccccccEEEccHHHHHHHHHccccccccccHccccHHHHHcccccEEEEEEcccccccccccccccHHcEEEEccccccHccccccccccccEEEEcccccHHHHccccccccccccEEEccccccccccccHHHHHHccEEEcccccccccccHHHHHcHHHHcEEEcccccHHccccccccccccEEEEccccccEcccccHHHHHcccEEEcccccHHHccccccHHccEEEccccccHHcccHHHHHccHEEccccccccccccccccHHHEccccccccccccccccHccccccEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEcccccccHHHcccccccEEEEEccccccccccccEEEEEEEEccccccccccccEEEEEccccccEEEEEEEEEcccccccccccEEEccccccccccccccEEEEEEcccccccccccccccEEEEEEEEEccccccccEEEEEcEEEEEEEcccccccccccccccccc

MKVLIVlddvnkdeQLEGLiggldqygpgsrivvttrdkgvlenfgvekiyrvnglefYEAFELFYYFAfkenhcpedfkrdsrrvvkyadgnpLVLKVLGSslkrkshwgnVLDDLNRICESDIHDIHDILKISFNELMPKMKSIFLDIAcffegedkDFVTRILDDYGSYGLEVLIDKSLITVSHNCLRMHDLLQEMGREIVRqesekepgkrsrlwdpkEIRRVLKHnkldlrdcrRLKRISTRFCKLKSLVDLFLHGCLNLERFPEILEKMEHLKHIYLQRTAITELPSSFENLLgleslsvrgcskldklpdnigNLESLAYILADgsaisqlpssvadsnvlrylwfprcrnlvslpplllsglssleclhlrdcavtdipqeigclssleeldlsgnsfesLPVSIKQLSqlssldlsdcnmlrslpelpsclgflnlsgcnmlqslpelpLRLRRLRAGNCKLLQSLPEIRSSVEeldasvpenlskysnnprvvypteiSHQFTNCLKLNEKANNRILADLRLRIQHMTIALLRRLDERVKNkkriapkactialpgseipdwfrnqssghlmSIQLLSHSFCRNLIGFAFCAVLgfkqdldfldtigdgrqfsslrdpfvsvryRFRLETKTVSEAkhvnrynhfedlqrpidsdhVILGFCLcmnvgfpdgnnhttvsfeffpavgnalyggygvkrcglcpvyanpnetkantFTLNFATEV

MKVLIVLDDVNKDEQLEGliggldqygpgsrIVVTtrdkgvlenfgvekiyrvNGLEFYEAFELFYYFAFKENHCPEDFKRDSRRVVKYADGNPLVLKvlgsslkrkshWGNVLDDLNRICESDIHDIHDILKISFNELMPKMKSIFLDIACFFEGEDKDFVTRILDDYGSYGLEVLIDKSLITVSHNCLRMHDLLQEMGREIvrqesekepgkrsrlwdpkeirrvlkhnkldlrdcrrlkRISTRFCKLKSLVDLFLHGCLNLERFPEILEKMEHLKHIYLQRTAITELPSSFENLLGLESLSVRGCSKLDKLPDNIGNLESLAYILADGSAISQLPSSVADSNVLRYLWFPRCRNLVSLPPLLLSGLSSLECLHLRDCAVTDIPQEIGCLSSLEELDLSGNSFESLPVSIKQLSQLSSLDLSDCNMLRSLPELPSCLGFLNLSGCNMLQSLPELPLRLRRLRAGNCKLLQSLPEIRSSVEELDasvpenlskysnnpRVVYPTEISHQFTNCLKLNEKANNRILADLRLRIQHMTIALLRRldervknkkriapkactialpgseipDWFRNQSSGHLMSIQLLSHSFCRNLIGFAFCAVLGFKQDLDFLDTIGdgrqfsslrdpfvsvrYRFRLetktvseakhvnrynhFEDLQRPIDSDHVILGFCLCMNVGFPDGNNHTTVSFEFFPAVGNALYGGYGVKRCGLCPVYANpnetkantftlnfatev

MKVLIVLDDVNKDEQLEGLIGGLDQYGPGSRIVVTTRDKGVLENFGVEKIYRVNGlefyeafelfyyfafKENHCPEDFKRDSRRVVKYADGNPLVLKVLGSSLKRKSHWGNVLDDLNRICESDIHDIHDILKISFNELMPKMKSIFLDIACFFEGEDKDFVTRILDDYGSYGLEVLIDKSLITVSHNCLRMHDLLQEMGREIVRQESEKEPGKRSRLWDPKEIRRVLKHNkldlrdcrrlkrISTRFCKLKSLVDLFLHGCLNLERFPEILEKMEHLKHIYLQRTAITELPSSFENLLGLESLSVRGCSKLDKLPDNIGNLESLAYILADGSAISQLPSSVADSNVLRYLWFPRCRNlvslpplllsglssleclhlRDCAVTDIPQEIGCLSSLEELDLSGNSFESLPVSIKqlsqlssldlsdCNMLRSLPELPSCLGFLNLSGCNMLQSlpelplrlrrlrAGNCKLLQSLPEIRSSVEELDASVPENLSKYSNNPRVVYPTEISHQFTNCLKLNEKANNRILADLRLRIQHMTIALLRRLDERVKNKKRIAPKACTIALPGSEIPDWFRNQSSGHLMSIQLLSHSFCRNLIGFAFCAVLGFKQDLDFLDTIGDGRQFSSLRDPFVSVRYRFRLETKTVSEAKHVNRYNHFEDLQRPIDSDHVILGFCLCMNVGFPDGNNHTTVSFEFFPAVGNALYGGYGVKRCGLCPVYANPNETKANTFTLNFATEV

**VLIVLDDVNKDEQLEGLIGGLDQYGPGSRIVVTTRDKGVLENFGVEKIYRVNGLEFYEAFELFYYFAFKENHCPEDFKRDSRRVVKYADGNPLVLKVLGSSLKRKSHWGNVLDDLNRICESDIHDIHDILKISFNELMPKMKSIFLDIACFFEGEDKDFVTRILDDYGSYGLEVLIDKSLITVSHNCLRMHDLLQEM**********************KEIRRVLKHNKLDLRDCRRLKRISTRFCKLKSLVDLFLHGCLNLERFPEILEKMEHLKHIYLQRTAITELPSSFENLLGLESLSVRGCSKLDKLPDNIGNLESLAYILADGSAISQLPSSVADSNVLRYLWFPRCRNLVSLPPLLLSGLSSLECLHLRDCAVTDIPQEIGCLSSLEELDLSGNSFESLPVSIKQLSQLSSLDLSDCNMLRSLPELPSCLGFLNLSGCNMLQSLPELPLRLRRLRAGNCKLLQSL************************PRVVYPTEISHQFTNCLKLNEKANNRILADLRLRIQHMTIALLRRLDERVKNKKRIAPKACTIALPGSEIPDWFRNQSSGHLMSIQLLSHSFCRNLIGFAFCAVLGFKQDLDFLDTIGDGRQFSSLRDPFVSVRYRFRLETKTVSEAKHVNRYNHFEDLQRPIDSDHVILGFCLCMNVGFPDGNNHTTVSFEFFPAVGNALYGGYGVKRCGLCPVYANPNETKANTFTLN*****

MKVLIVLDDVNKDEQLEGLIGGLDQYGPGSRIVVTTRDKGVLENFGVEKIYRVNGLEFYEAFELFYYFAFKENHCPEDFKRDSRRVVKYADGNPLVLKVLGSSLKRKSHWGNVLDDLNRICESDIHDIHDILKISFNELMPKMKSIFLDIACFFEGEDKDFVTRILDDYGSYGLEVLIDKSLITVSHNCLRMHDLLQEMGREIV************RLWDPKEIRRVLKHNKLDLRDCRRLKRISTRFCKLKSLVDLFLHGCLNLERFPEILEKMEHLKHIYLQRTAITELPSSFENLLGLESLSVRGCSKLDKLPDNIGNLESLAYILADGSAISQLPSSVADSNVLRYLWFPRCRNLVSLPPLLLSGLSSLECLHLRDCAVTDIPQEIGCLSSLEELDLSGNSFESLPVSIKQLSQLSSLDLSDCNMLRSLPELPSCLGFLNLSGCNMLQSLPELPLRLRRLRAGNCKLLQSLPEIRSSVEELDASVPENLSKYSNNPRVVYPTEISHQFTNCLKLNEKANNRILADLRLRIQHMTIALLRRLDERVKNKKRIAPKACTIALPGSEIPDWFRNQSSGHLMSIQLLSHSFCRNLIGFAFCAVLGFKQDLDFLDTIGDGRQFSSLRDPFVSVRYRFRLETKTVSEAKHVNRYNHFEDLQRPIDSDHVILGFCLCMNVGFPDGNNHTTVSFEFFPAVGNALYGGYGVKRCGLCPVYANPNETKANTFTLNFATEV

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		734	2.2.26 [Sep-21-2011]
Q40392		1144	TMV resistance protein N	N/A	no	0.615	0.395	0.345	8e-56
Q9FL92		1372	Probable WRKY transcripti	no	no	0.931	0.498	0.263	2e-48
O82500		1095	Putative disease resistan	no	no	0.806	0.540	0.282	2e-44
Q9FH83		1288	Probable WRKY transcripti	no	no	0.649	0.370	0.302	6e-43
Q9SZ67		1895	Probable WRKY transcripti	no	no	0.613	0.237	0.314	8e-40
O23530		1301	Protein SUPPRESSOR OF npr	no	no	0.644	0.363	0.296	8e-37
Q9FKN7		1613	Protein DA1-related 4 OS=	no	no	0.915	0.416	0.239	1e-35
Q9LVT1		623	Putative disease resistan	no	no	0.549	0.646	0.249	1e-15
Q9FW44		787	Disease resistance protei	no	no	0.628	0.585	0.263	9e-14
Q9T048		985	Disease resistance protei	no	no	0.528	0.393	0.274	1e-13

>sp\|Q40392\|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1	Back alignment and function desciption

 Score =  219 bits (557), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 175/507 (34%), Positives = 271/507 (53%), Gaps = 55/507 (10%)

Query: 2   KVLIVLDDV-NKDEQLEGLIGGLDQYGPGSRIVVTTRDKGVLENFGVEKIYRVNGLEFYE 60
           KVLIVLDD+ NKD  LE L G LD +G GSRI++TTRDK ++E   +  IY V  L  +E
Sbjct: 295 KVLIVLDDIDNKDHYLEYLAGDLDWFGNGSRIIITTRDKHLIEKNDI--IYEVTALPDHE 352

Query: 61  AFELFYYFAFKENHCPEDFKRDSRRVVKYADGNPLVLKVLGSSLK--RKSHWGNVLDDLN 118
           + +LF   AF +    E+F++ S  VV YA G PL LKV GS L   R + W + ++ + 
Sbjct: 353 SIQLFKQHAFGKEVPNENFEKLSLEVVNYAKGLPLALKVWGSLLHNLRLTEWKSAIEHMK 412

Query: 119 RICESDIHDIHDILKISFNELMPKMKSIFLDIACFFEGEDKDFVTRILDD---YGSYGLE 175
               S I D    LKIS++ L PK + +FLDIACF  GE+KD++ +IL+       YGL 
Sbjct: 413 NNSYSGIIDK---LKISYDGLEPKQQEMFLDIACFLRGEEKDYILQILESCHIGAEYGLR 469

Query: 176 VLIDKSLITVS-HNCLRMHDLLQEMGREIVRQESEKEPGKRSRLWDPKEIRRVLKHNKLD 234
           +LIDKSL+ +S +N ++MHDL+Q+MG+ IV    +K+PG+RSRLW  KE+  V+ +N   
Sbjct: 470 ILIDKSLVFISEYNQVQMHDLIQDMGKYIVN--FQKDPGERSRLWLAKEVEEVMSNNTGT 527

Query: 235 L---------------------RDCRRLK-----RISTRFCKLKSLVDLFLHGCLN--LE 266
           +                     ++ +RL+     R ST +       +L    C N   E
Sbjct: 528 MAMEAIWVSSYSSTLRFSNQAVKNMKRLRVFNMGRSSTHYAIDYLPNNLRCFVCTNYPWE 587

Query: 267 RFPEILEKMEHLKHIYLQRTAITELPSSFENLLGLESLSVRGCSKLDKLPDNIGNLESLA 326
            FP   E ++ L H+ L+  ++  L +  ++L  L  + +    +L + PD  G + +L 
Sbjct: 588 SFPSTFE-LKMLVHLQLRHNSLRHLWTETKHLPSLRRIDLSWSKRLTRTPDFTG-MPNLE 645

Query: 327 YI-LADGSAISQLPSSVADSNVLRYLWFPRCRNLVSLPPLLLSGLSSLECLHLRDC-AVT 384
           Y+ L   S + ++  S+   + +  L+   C++L   P +    + SLE L LR C ++ 
Sbjct: 646 YVNLYQCSNLEEVHHSLGCCSKVIGLYLNDCKSLKRFPCV---NVESLEYLGLRSCDSLE 702

Query: 385 DIPQEIGCLSSLEELDLSGNSFESLPVSIKQL-SQLSSLDLSDCNMLRSLPE----LPSC 439
            +P+  G +    ++ + G+    LP SI Q  + ++ L L +   L +LP     L S 
Sbjct: 703 KLPEIYGRMKPEIQIHMQGSGIRELPSSIFQYKTHVTKLLLWNMKNLVALPSSICRLKSL 762

Query: 440 LGFLNLSGCNMLQSLPELPLRLRRLRA 466
           +  L++SGC+ L+SLPE    L  LR 
Sbjct: 763 VS-LSVSGCSKLESLPEEIGDLDNLRV 788

Disease resistance protein. Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via a direct or indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth.
Nicotiana glutinosa (taxid: 35889)

>sp\|Q9FL92\|WRK16_ARATH Probable WRKY transcription factor 16 OS=Arabidopsis thaliana GN=WRKY16 PE=2 SV=1	Back alignment and function description

>sp\|O82500\|Y4117_ARATH Putative disease resistance protein At4g11170 OS=Arabidopsis thaliana GN=At4g11170 PE=2 SV=1	Back alignment and function description

>sp\|Q9FH83\|WRK52_ARATH Probable WRKY transcription factor 52 OS=Arabidopsis thaliana GN=WRKY52 PE=2 SV=3	Back alignment and function description

>sp\|Q9SZ67\|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1	Back alignment and function description

>sp\|O23530\|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3	Back alignment and function description

>sp\|Q9FKN7\|DAR4_ARATH Protein DA1-related 4 OS=Arabidopsis thaliana GN=DAR4 PE=1 SV=2	Back alignment and function description

>sp\|Q9LVT1\|DRL39_ARATH Putative disease resistance protein At5g47280 OS=Arabidopsis thaliana GN=At5g47280 PE=3 SV=1	Back alignment and function description

>sp\|Q9FW44\|ADR1_ARATH Disease resistance protein ADR1 OS=Arabidopsis thaliana GN=ADR1 PE=2 SV=2	Back alignment and function description

>sp\|Q9T048\|DRL27_ARATH Disease resistance protein At4g27190 OS=Arabidopsis thaliana GN=At4g27190 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		734
359496034		1132	PREDICTED: TMV resistance protein N-like	0.888	0.575	0.324	3e-88
147802475		1244	hypothetical protein VITISV_027841 [Viti	0.807	0.476	0.347	2e-83
255579570		1116	TMV resistance protein N, putative [Rici	0.809	0.532	0.357	3e-82
255537139		1137	leucine-rich repeat-containing protein,	0.925	0.597	0.318	2e-81
255547494		1082	TMV resistance protein N, putative [Rici	0.821	0.557	0.360	1e-79
359486092		919	PREDICTED: TMV resistance protein N-like	0.682	0.545	0.369	9e-78
255563202		1158	leucine-rich repeat containing protein,	0.795	0.504	0.345	1e-76
296090597		1201	unnamed protein product [Vitis vinifera]	0.940	0.574	0.318	3e-76
225460354		1174	PREDICTED: TMV resistance protein N-like	0.810	0.506	0.322	1e-74
359493489		1092	PREDICTED: TMV resistance protein N-like	0.814	0.547	0.338	2e-72

>gi\|359496034\|ref\|XP_002277500.2\| PREDICTED: TMV resistance protein N-like [Vitis vinifera]	Back alignment and taxonomy information

 Score =  333 bits (853), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 276/851 (32%), Positives = 396/851 (46%), Gaps = 199/851 (23%)

Query: 2    KVLIVLDDVNKDEQLEGLIGGLDQYGPGSRIVVTTRDKGVLENFGVEKIYRVNGLEFYEA 61
            +V IVLD+V   + LE L+G  D +G GSRI++TTRDK +L + GV  +Y V  L   EA
Sbjct: 286  EVFIVLDNVYDQDILECLVGSHDWFGQGSRIIITTRDKRLLMSHGVRVVYEVKKLVHTEA 345

Query: 62   FELFYYFAFKENHCPEDFKRDSRRVVKYADGNPLVLKVLGSSL--KRKSHWGNVLDDLNR 119
             E    +A K+    ++F   S  ++ YA G PLVLKVLGS L    K  W + LD L  
Sbjct: 346  IEFLGRYASKQQIVIDEFMELSNSIITYAQGLPLVLKVLGSFLFSMSKHEWRSELDKLK- 404

Query: 120  ICESDIHDIHDILKISFNELMPKMKSIFLDIACFFEGEDKDFVTRILDDYGSY---GLEV 176
              ++    I ++L+IS++ L  K K+IFLDIACFF+GEDKD V +ILD  G +   G+  
Sbjct: 405  --DTPHGRIQEVLRISYDGLDDKEKNIFLDIACFFKGEDKDHVIKILDGCGFFAVCGIRG 462

Query: 177  LIDKSLITVSHN-CLRMHDLLQEMGREIVRQESEKEPGKRSRLWDPKEIRRVLKHNK--- 232
            LIDKSLIT+S+N  + MHDLLQEMGR+I+RQ S KEPGKRSRLW  K+   VL  N    
Sbjct: 463  LIDKSLITISNNDKIVMHDLLQEMGRKIIRQTSPKEPGKRSRLWIYKDAYHVLSKNTGTQ 522

Query: 233  ------LDLRDCRRLKRISTRF---------------------------CKL------KS 253
                   +L D   +   +  F                           CKL      K+
Sbjct: 523  EVEGIFFNLSDIEEIHFTTKAFAGMDKLRLLKFYDYSPSTNSECTSKRKCKLPHDFSPKN 582

Query: 254  LVDLFLHGCLNLERFPEILEKMEHLKHIYLQRTAITELPSSFENLLGLESLSVRG----- 308
            LVDL L  C ++++  + ++ ++ LK + L  +       +F  +  LE L + G     
Sbjct: 583  LVDLSL-SCSDVKQLWKGIKVLDKLKFMDLSHSKYLVETPNFSGISNLEKLDLTGCTYLR 641

Query: 309  -------------------------------------------CSKLDKLPDNIGNLESL 325
                                                       CSK++  P+N GNLE L
Sbjct: 642  EVHPTLGVLGKLSFLSLRDCKMLKNIPNSICKLKSLETFIFSGCSKVENFPENFGNLEQL 701

Query: 326  AYILADGSAISQLPSSVADSNVLRYLWFPRCRNLVSLPPLL----------------LSG 369
              + AD +AIS LPSS+    +L+ L F  C+   S   L                 LSG
Sbjct: 702  KELYADETAISALPSSICHLRILQVLSFNGCKGPPSASWLTLLPRKSSNSGKFLLSPLSG 761

Query: 370  LSSLECLHLRDCAVTDIP--QEIGCLSSLEELDLSGNSFESLPVSIKQLSQLSSLDLSDC 427
            L SL+ L+LRDC +++      +  LSSLE LDLSGN+F SLP S+ QLSQL SL L +C
Sbjct: 762  LGSLKELNLRDCNISEGADLSHLAILSSLEYLDLSGNNFISLPSSMSQLSQLVSLKLQNC 821

Query: 428  NMLRSLPELPSCLGFLNLSGCNMLQSLPELPLRLRRLRAGNCKLLQSLPEIRSSVEELDA 487
              L++L ELPS                      ++ + A NC  L+++            
Sbjct: 822  RRLQALSELPS---------------------SIKEIDAHNCMSLETISN---------- 850

Query: 488  SVPENLSKYSNNPRVVYPTEISHQFTNCLKLNEKANNRILADLRLRIQHMTIALLRRLDE 547
                         R ++P+     F  CLK+    NN         I  M  AL   L  
Sbjct: 851  -------------RSLFPSLRHVSFGECLKIKTYQNN---------IGSMLQALATFLQT 888

Query: 548  RVKNK-KRIAPKACTI----ALPGSEIPDWFRNQSSGHLMSIQLLSHSFCRNLIGFAFCA 602
              +++  R  P++ TI     +PGSEIPDWF  QSSG++++I+L  + F  N +GFA  A
Sbjct: 889  HKRSRYARDNPESVTIEFSTVVPGSEIPDWFSYQSSGNVVNIELPPNWFNSNFLGFALSA 948

Query: 603  VLGFKQDLDFLDTIGDGRQFSSLRDPFVSVRYRFRLETKTVSEAKHVNRYNHFEDLQRPI 662
            V GF    D+              +P   V   F + +   S A + +   H+      I
Sbjct: 949  VFGFDPLPDY--------------NPNHKVFCLFCIFSFQNSAASYRDNVFHYNSGPALI 994

Query: 663  DSDHVILGFCLCMNVGFPDGNNHTTVSFEFFPAVGNALYG-GYGVKRCGLCPVYANPNET 721
            +SDH+ LG+   ++       NH   +F+        +YG  + VKRCG+  VY++ + +
Sbjct: 995  ESDHLWLGYAPVVSSFKWHEVNHFKAAFQ--------IYGRHFVVKRCGIHLVYSSEDVS 1046

Query: 722  KANTFTLNFAT 732
              N   + + +
Sbjct: 1047 DNNPTMIQYIS 1057

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|147802475\|emb\|CAN61853.1\| hypothetical protein VITISV_027841 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255579570\|ref\|XP_002530627.1\| TMV resistance protein N, putative [Ricinus communis] gi\|223529837\|gb\|EEF31770.1\| TMV resistance protein N, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|255537139\|ref\|XP_002509636.1\| leucine-rich repeat-containing protein, putative [Ricinus communis] gi\|223549535\|gb\|EEF51023.1\| leucine-rich repeat-containing protein, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|255547494\|ref\|XP_002514804.1\| TMV resistance protein N, putative [Ricinus communis] gi\|223545855\|gb\|EEF47358.1\| TMV resistance protein N, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|359486092\|ref\|XP_002274052.2\| PREDICTED: TMV resistance protein N-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255563202\|ref\|XP_002522604.1\| leucine-rich repeat containing protein, putative [Ricinus communis] gi\|223538080\|gb\|EEF39691.1\| leucine-rich repeat containing protein, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|296090597\|emb\|CBI40966.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225460354\|ref\|XP_002263146.1\| PREDICTED: TMV resistance protein N-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359493489\|ref\|XP_002264004.2\| PREDICTED: TMV resistance protein N-like [Vitis vinifera]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		734
UNIPROTKB\|Q40392		1144	N "TMV resistance protein N" [	0.303	0.194	0.438	1e-57
TAIR\|locus:2122965		1210	AT4G19510 [Arabidopsis thalian	0.212	0.128	0.371	5.6e-49
TAIR\|locus:2163426		1187	TAO1 "target of AVRB operation	0.303	0.187	0.356	6.4e-45
TAIR\|locus:2158475		1217	RPS4 "RESISTANT TO P. SYRINGAE	0.290	0.175	0.362	1.3e-44
TAIR\|locus:2118106		1219	AT4G12010 [Arabidopsis thalian	0.268	0.161	0.389	4.2e-44
TAIR\|locus:2081810		1226	AT3G51570 [Arabidopsis thalian	0.306	0.183	0.346	4.8e-43
TAIR\|locus:2153363		1261	AT5G45200 [Arabidopsis thalian	0.604	0.352	0.261	3.9e-42
TAIR\|locus:2167457		1191	AT5G36930 [Arabidopsis thalian	0.306	0.188	0.394	8.3e-42
TAIR\|locus:2827629		1355	AT2G17050 [Arabidopsis thalian	0.303	0.164	0.343	1.3e-40
TAIR\|locus:2153072		1229	AT5G51630 [Arabidopsis thalian	0.309	0.184	0.357	1.3e-39

UNIPROTKB\|Q40392 N "TMV resistance protein N" [Nicotiana glutinosa (taxid:35889)]	Back alignment and assigned GO terms

 Score = 441 (160.3 bits), Expect = 1.0e-57, Sum P(2) = 1.0e-57
 Identities = 104/237 (43%), Positives = 146/237 (61%)

Query:     2 KVLIVLDDV-NKDEQLEGLIGGLDQYGPGSRIVVTTRDKGVLENFGVEKIYRVNGXXXXX 60
             KVLIVLDD+ NKD  LE L G LD +G GSRI++TTRDK ++E   +  IY V       
Sbjct:   295 KVLIVLDDIDNKDHYLEYLAGDLDWFGNGSRIIITTRDKHLIEKNDI--IYEVTALPDHE 352

Query:    61 XXXXXXXXXXKENHCPEDFKRDSRRVVKYADGNPLVLKVLGSSLK--RKSHWGNVLDDLN 118
                        +    E+F++ S  VV YA G PL LKV GS L   R + W + ++ + 
Sbjct:   353 SIQLFKQHAFGKEVPNENFEKLSLEVVNYAKGLPLALKVWGSLLHNLRLTEWKSAIEHMK 412

Query:   119 RICESDIHDIHDILKISFNELMPKMKSIFLDIACFFEGEDKDFVTRILDD--YGS-YGLE 175
                 +    I D LKIS++ L PK + +FLDIACF  GE+KD++ +IL+    G+ YGL 
Sbjct:   413 N---NSYSGIIDKLKISYDGLEPKQQEMFLDIACFLRGEEKDYILQILESCHIGAEYGLR 469

Query:   176 VLIDKSLITVS-HNCLRMHDLLQEMGREIVRQESEKEPGKRSRLWDPKEIRRVLKHN 231
             +LIDKSL+ +S +N ++MHDL+Q+MG+ IV    +K+PG+RSRLW  KE+  V+ +N
Sbjct:   470 ILIDKSLVFISEYNQVQMHDLIQDMGKYIVN--FQKDPGERSRLWLAKEVEEVMSNN 524

GO:0005515 "protein binding" evidence=IPI

TAIR\|locus:2122965 AT4G19510 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2163426 TAO1 "target of AVRB operation1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2158475 RPS4 "RESISTANT TO P. SYRINGAE 4" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2118106 AT4G12010 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2081810 AT3G51570 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2153363 AT5G45200 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2167457 AT5G36930 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2827629 AT2G17050 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2153072 AT5G51630 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00001784001	SubName- Full=Chromosome chr18 scaffold_122, whole genome shotgun sequence; (1102 aa)
		(Vitis vinifera)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		734
PLN03210		1153	PLN03210, PLN03210, Resistant to P	1e-51
pfam00931		285	pfam00931, NB-ARC, NB-ARC domain	8e-25
PLN03210		1153	PLN03210, PLN03210, Resistant to P	1e-20
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	1e-12
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	1e-08
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	7e-08
PRK15386		426	PRK15386, PRK15386, type III secretion protein Gog	8e-07
PRK15370		754	PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl	3e-06
PRK15387		788	PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss	5e-06
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	7e-06
pfam13855		60	pfam13855, LRR_8, Leucine rich repeat	8e-06
PLN03150		623	PLN03150, PLN03150, hypothetical protein; Provisio	8e-05
PRK15387		788	PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss	1e-04
pfam13855		60	pfam13855, LRR_8, Leucine rich repeat	2e-04
pfam12799		43	pfam12799, LRR_4, Leucine Rich repeats (2 copies)	5e-04
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	0.001
pfam12799		43	pfam12799, LRR_4, Leucine Rich repeats (2 copies)	0.001
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	0.002
PLN03150		623	PLN03150, PLN03150, hypothetical protein; Provisio	0.003

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

 Score =  193 bits (493), Expect = 1e-51
 Identities = 173/549 (31%), Positives = 269/549 (48%), Gaps = 69/549 (12%)

Query: 2   KVLIVLDDVNKDEQLEGLIGGLDQYGPGSRIVVTTRDKGVLENFGVEKIYRVNGLEFYEA 61
           KVLI +DD++  + L+ L G    +G GSRI+V T+DK  L   G++ IY V       A
Sbjct: 297 KVLIFIDDLDDQDVLDALAGQTQWFGSGSRIIVITKDKHFLRAHGIDHIYEVCLPSNELA 356

Query: 62  FELFYYFAFKENHCPEDFKRDSRRVVKYADGNPLVLKVLGSSLKRKSHWGNVLDDLNRIC 121
            E+F   AFK+N  P+ F   +  V   A   PL L VLGS L R     + +D L R+ 
Sbjct: 357 LEMFCRSAFKKNSPPDGFMELASEVALRAGNLPLGLNVLGSYL-RGRDKEDWMDMLPRLR 415

Query: 122 ESDIHDIHDILKISFNELM-PKMKSIFLDIACFFEGEDKDFVTRILDDYG---SYGLEVL 177
                 I   L++S++ L   K K+IF  IAC F GE  + +  +L +     + GL+ L
Sbjct: 416 NGLDGKIEKTLRVSYDGLNNKKDKAIFRHIACLFNGEKVNDIKLLLANSDLDVNIGLKNL 475

Query: 178 IDKSLITVSHNCLRMHDLLQEMGREIVRQESEKEPGKRSRLWDPKEIRRVLKHNK----- 232
           +DKSLI V  + + MH LLQEMG+EIVR +S  EPG+R  L D K+I  VL+ N      
Sbjct: 476 VDKSLIHVREDIVEMHSLLQEMGKEIVRAQSN-EPGEREFLVDAKDICDVLEDNTGTKKV 534

Query: 233 ----LDLRDCRRLKRISTRFCKLKSLVDLFLHGCLNLER------FPEILEKMEH-LKHI 281
               LD+ +   L      F  +++L+ L  +     ++       PE  + +   L+ +
Sbjct: 535 LGITLDIDEIDELHIHENAFKGMRNLLFLKFYTKKWDQKKEVRWHLPEGFDYLPPKLRLL 594

Query: 282 YLQRTAITELPSSF--ENLLGLESLSVRGCSKLDKLPDNIGNLESLAYILADGSAISQLP 339
              +  +  +PS+F  ENL+ L+   ++G SKL+KL D + +L  L  I   GS      
Sbjct: 595 RWDKYPLRCMPSNFRPENLVKLQ---MQG-SKLEKLWDGVHSLTGLRNIDLRGS------ 644

Query: 340 SSVADSNVLRYLWFPRCRNLVSLPPLLLSGLSSLECLHLRDCA-VTDIPQEIGCLSSLEE 398
                            +NL  +P L ++  ++LE L L DC+ + ++P  I  L+ LE+
Sbjct: 645 -----------------KNLKEIPDLSMA--TNLETLKLSDCSSLVELPSSIQYLNKLED 685

Query: 399 LDLSG-NSFESLPVSIKQLSQLSSLDLSDCNMLRSLPELPSCLGFLNLSGCNMLQSLPEL 457
           LD+S   + E LP  I  L  L  L+LS C+ L+S P++ + + +L+L       ++ E 
Sbjct: 686 LDMSRCENLEILPTGI-NLKSLYRLNLSGCSRLKSFPDISTNISWLDLDE----TAIEEF 740

Query: 458 P--LRLRRL-RAGNCKLL-QSLPEIRSSVEELDASVPENLSK--YSNNPRVVYPTEISHQ 511
           P  LRL  L     C++  + L E    +  L   +  +L++   S+ P +V   E+   
Sbjct: 741 PSNLRLENLDELILCEMKSEKLWERVQPLTPLMTMLSPSLTRLFLSDIPSLV---ELPSS 797

Query: 512 FTNCLKLNE 520
             N  KL  
Sbjct: 798 IQNLHKLEH 806

syringae 6; Provisional. Length = 1153

>gnl\|CDD\|216202 pfam00931, NB-ARC, NB-ARC domain	Back alignment and domain information

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|237954 PRK15386, PRK15386, type III secretion protein GogB; Provisional	Back alignment and domain information

>gnl\|CDD\|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>gnl\|CDD\|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|206026 pfam13855, LRR_8, Leucine rich repeat	Back alignment and domain information

>gnl\|CDD\|178695 PLN03150, PLN03150, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>gnl\|CDD\|206026 pfam13855, LRR_8, Leucine rich repeat	Back alignment and domain information

>gnl\|CDD\|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies)	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies)	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|178695 PLN03150, PLN03150, hypothetical protein; Provisional	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		734
PLN03210		1153	Resistant to P. syringae 6; Provisional	100.0
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	100.0
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.92
PF00931		287	NB-ARC: NB-ARC domain; InterPro: IPR002182 This is	99.92
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.92
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.86
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.81
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.81
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.79
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.78
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.78
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.76
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.72
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.71
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.68
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.66
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.65
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.61
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.58
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.57
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.51
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.49
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.48
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	99.2
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	99.17
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	99.16
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.13
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	99.12
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	99.08
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	99.05
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	99.04
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.95
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.92
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.86
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.81
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	98.76
PLN03150		623	hypothetical protein; Provisional	98.66
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	98.63
PLN03150		623	hypothetical protein; Provisional	98.62
PRK15386		426	type III secretion protein GogB; Provisional	98.56
PRK15386		426	type III secretion protein GogB; Provisional	98.49
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	98.4
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.39
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.31
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	98.29
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	98.16
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	98.13
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	98.1
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	98.07
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.92
KOG2982		418	consensus Uncharacterized conserved protein [Funct	97.92
PRK04841		903	transcriptional regulator MalT; Provisional	97.9
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	97.87
KOG2982		418	consensus Uncharacterized conserved protein [Funct	97.79
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.74
KOG4341		483	consensus F-box protein containing LRR [General fu	97.63
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.61
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.44
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.33
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.29
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	97.28
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	97.15
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	96.79
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	96.58
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	96.21
PRK06893		229	DNA replication initiation factor; Validated	96.1
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	96.1
KOG4341		483	consensus F-box protein containing LRR [General fu	95.97
PF05729		166	NACHT: NACHT domain	95.89
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	95.55
KOG1947		482	consensus Leucine rich repeat proteins, some prote	95.4
KOG2123		388	consensus Uncharacterized conserved protein [Funct	95.36
KOG2123		388	consensus Uncharacterized conserved protein [Funct	95.33
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	95.06
KOG1947		482	consensus Leucine rich repeat proteins, some prote	94.92
PRK00080		328	ruvB Holliday junction DNA helicase RuvB; Reviewed	94.7
TIGR00635		305	ruvB Holliday junction DNA helicase, RuvB subunit.	94.49
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	94.43
PF01637		234	Arch_ATPase: Archaeal ATPase; InterPro: IPR011579	94.02
PRK00411		394	cdc6 cell division control protein 6; Reviewed	93.68
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	93.22
TIGR03015		269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	93.01
COG3899		849	Predicted ATPase [General function prediction only	92.08
KOG4308		478	consensus LRR-containing protein [Function unknown	91.99
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	90.95
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	90.95
PRK05564		313	DNA polymerase III subunit delta'; Validated	90.49
TIGR02928		365	orc1/cdc6 family replication initiation protein. M	90.41
PF13173		128	AAA_14: AAA domain	87.86
TIGR01242		364	26Sp45 26S proteasome subunit P45 family. Many pro	87.55
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	87.06
smart00370		26	LRR Leucine-rich repeats, outliers.	87.06
PRK07471		365	DNA polymerase III subunit delta'; Validated	86.39
PRK09087		226	hypothetical protein; Validated	85.59
PRK08727		233	hypothetical protein; Validated	84.81
KOG4308		478	consensus LRR-containing protein [Function unknown	84.01
TIGR00678		188	holB DNA polymerase III, delta' subunit. At positi	83.69
PRK13342		413	recombination factor protein RarA; Reviewed	83.1
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	82.21
smart00370		26	LRR Leucine-rich repeats, outliers.	82.21
PRK05642		234	DNA replication initiation factor; Validated	80.68

>PLN03210 Resistant to P	Back alignment and domain information

Probab=100.00  E-value=2.3e-80  Score=757.75  Aligned_cols=661  Identities=30%  Similarity=0.454  Sum_probs=451.6

Q ss_pred             CEEEEEEeCCCChHHHHhHhccCCCCCCCcEEEEEcCChhHHhhcCCCceEECCCCCHHHHHHHHHHhhcCCCCCchhHH
Q 004707            1 MKVLIVLDDVNKDEQLEGLIGGLDQYGPGSRIVVTTRDKGVLENFGVEKIYRVNGLEFYEAFELFYYFAFKENHCPEDFK   80 (734)
Q Consensus         1 kk~LiVLDDV~~~~~~~~l~~~~~~~~~GSrIivTTR~~~v~~~~~~~~~y~v~~L~~~~s~~Lf~~~af~~~~~~~~~~   80 (734)
                      ||+||||||||+.+||+.+++...|+++|||||||||+++++..++++++|+|+.|+++|||+||+++||++..++++++
T Consensus       296 krvLLVLDdv~~~~~l~~L~~~~~~~~~GsrIIiTTrd~~vl~~~~~~~~~~v~~l~~~ea~~LF~~~Af~~~~~~~~~~  375 (1153)
T PLN03210        296 RKVLIFIDDLDDQDVLDALAGQTQWFGSGSRIIVITKDKHFLRAHGIDHIYEVCLPSNELALEMFCRSAFKKNSPPDGFM  375 (1153)
T ss_pred             CeEEEEEeCCCCHHHHHHHHhhCccCCCCcEEEEEeCcHHHHHhcCCCeEEEecCCCHHHHHHHHHHHhcCCCCCcHHHH
Confidence            79999999999999999999999999999999999999999999999999999999999999999999999988888999


Q ss_pred             HHHHHHHHHhCCCchHHHHHHhhcC--CcccHHHHHHHhhhhcCCCchhHHHHHHhhcccCCh-hhhhhhhhhcccccCC
Q 004707           81 RDSRRVVKYADGNPLVLKVLGSSLK--RKSHWGNVLDDLNRICESDIHDIHDILKISFNELMP-KMKSIFLDIACFFEGE  157 (734)
Q Consensus        81 ~l~~~i~~~c~GlPLal~vlgs~L~--~~~~W~~~l~~l~~~~~~~i~~i~~~L~~Syd~L~~-~~k~~fl~ia~f~~~~  157 (734)
                      +++++|+++|+|+||||+++|+.|+  ++.+|+++++++++.++.+|   +++|++|||+|++ .+|.||+||||||+++
T Consensus       376 ~l~~~iv~~c~GLPLAl~vlgs~L~~k~~~~W~~~l~~L~~~~~~~I---~~~L~~SYd~L~~~~~k~~Fl~ia~ff~~~  452 (1153)
T PLN03210        376 ELASEVALRAGNLPLGLNVLGSYLRGRDKEDWMDMLPRLRNGLDGKI---EKTLRVSYDGLNNKKDKAIFRHIACLFNGE  452 (1153)
T ss_pred             HHHHHHHHHhCCCcHHHHHHHHHHcCCCHHHHHHHHHHHHhCccHHH---HHHHHHhhhccCccchhhhhheehhhcCCC
Confidence            9999999999999999999999999  77899999999998887766   9999999999986 5999999999999999


Q ss_pred             ChhHHHHHHHhhc---cchhHHHhhcCCceeeCCeEEecHHHHHHHHHHHhccccCCCCcceeccCchhHHHHhhcCe--
Q 004707          158 DKDFVTRILDDYG---SYGLEVLIDKSLITVSHNCLRMHDLLQEMGREIVRQESEKEPGKRSRLWDPKEIRRVLKHNK--  232 (734)
Q Consensus       158 ~~~~~~~~l~~~~---~~~i~~L~~ksli~~~~~~~~mHdll~~~~~~i~~~e~~~~~~~~~~l~~~~~i~~l~~l~~--  232 (734)
                      +++++..++++++   ..+++.|++||||++..++++|||++|+||++|+++++ .+|++|+++|+++++.++...++  
T Consensus       453 ~~~~v~~~l~~~~~~~~~~l~~L~~ksLi~~~~~~~~MHdLl~~~~r~i~~~~~-~~~~~r~~l~~~~di~~vl~~~~g~  531 (1153)
T PLN03210        453 KVNDIKLLLANSDLDVNIGLKNLVDKSLIHVREDIVEMHSLLQEMGKEIVRAQS-NEPGEREFLVDAKDICDVLEDNTGT  531 (1153)
T ss_pred             CHHHHHHHHHhcCCCchhChHHHHhcCCEEEcCCeEEhhhHHHHHHHHHHHhhc-CCCCcceeEeCHHHHHHHHHhCccc
Confidence            9999999998877   67899999999999999999999999999999999998 78999999999999988765432  


Q ss_pred             -------eecCCccccccccccccCCCCCcEEEecCCc------------------------------CCCcCchhhhCC
Q 004707          233 -------LDLRDCRRLKRISTRFCKLKSLVDLFLHGCL------------------------------NLERFPEILEKM  275 (734)
Q Consensus       233 -------L~L~~~~~~~~~p~~~~~l~~L~~L~L~~~~------------------------------~~~~~p~~~~~l  275 (734)
                             ++++.......-+..|.+|++|+.|.+..+.                              ....+|..+ ..
T Consensus       532 ~~v~~i~l~~~~~~~~~i~~~aF~~m~~L~~L~~~~~~~~~~~~~~~~lp~~~~~lp~~Lr~L~~~~~~l~~lP~~f-~~  610 (1153)
T PLN03210        532 KKVLGITLDIDEIDELHIHENAFKGMRNLLFLKFYTKKWDQKKEVRWHLPEGFDYLPPKLRLLRWDKYPLRCMPSNF-RP  610 (1153)
T ss_pred             ceeeEEEeccCccceeeecHHHHhcCccccEEEEecccccccccceeecCcchhhcCcccEEEEecCCCCCCCCCcC-Cc
Confidence                   3333222222222334444444444443221                              122333333 24


Q ss_pred             CcCcEEEeecCCCcccCccccCCCCCcEeeecCCCCCCCCCcccCCCCccceeeccCc-ccccCCccccCCCCCcEEEcC
Q 004707          276 EHLKHIYLQRTAITELPSSFENLLGLESLSVRGCSKLDKLPDNIGNLESLAYILADGS-AISQLPSSVADSNVLRYLWFP  354 (734)
Q Consensus       276 ~~L~~L~L~~n~l~~lp~~i~~l~~L~~L~Ls~~~~~~~lp~~l~~l~~L~~L~l~~n-~l~~lp~~i~~l~~L~~L~l~  354 (734)
                      .+|++|+|.++.+..+|..+..+++|+.|+|++|..++.+|. ++.+++|+.|++++| .+..+|.+++.+++|+.|+++
T Consensus       611 ~~L~~L~L~~s~l~~L~~~~~~l~~Lk~L~Ls~~~~l~~ip~-ls~l~~Le~L~L~~c~~L~~lp~si~~L~~L~~L~L~  689 (1153)
T PLN03210        611 ENLVKLQMQGSKLEKLWDGVHSLTGLRNIDLRGSKNLKEIPD-LSMATNLETLKLSDCSSLVELPSSIQYLNKLEDLDMS  689 (1153)
T ss_pred             cCCcEEECcCccccccccccccCCCCCEEECCCCCCcCcCCc-cccCCcccEEEecCCCCccccchhhhccCCCCEEeCC
Confidence            566666666666666666666677777777776666666664 666677777777664 344667667777777777777


Q ss_pred             CCCCCCccCcccCCCCCCccEEEeec---------------------CCCCCCCccCC----------------------
Q 004707          355 RCRNLVSLPPLLLSGLSSLECLHLRD---------------------CAVTDIPQEIG----------------------  391 (734)
Q Consensus       355 ~~~~l~~l~~~~l~~l~~L~~L~Ls~---------------------n~l~~lp~~l~----------------------  391 (734)
                      +|+.+..+|...  ++++|+.|++++                     |.+..+|..+.                      
T Consensus       690 ~c~~L~~Lp~~i--~l~sL~~L~Lsgc~~L~~~p~~~~nL~~L~L~~n~i~~lP~~~~l~~L~~L~l~~~~~~~l~~~~~  767 (1153)
T PLN03210        690 RCENLEILPTGI--NLKSLYRLNLSGCSRLKSFPDISTNISWLDLDETAIEEFPSNLRLENLDELILCEMKSEKLWERVQ  767 (1153)
T ss_pred             CCCCcCccCCcC--CCCCCCEEeCCCCCCccccccccCCcCeeecCCCccccccccccccccccccccccchhhcccccc
Confidence            766666666531  344444444444                     44333443210                      


Q ss_pred             --------CCCCCcEEeeccCC-CCcccccccCCCCCcEEeeecCCCCCCCCCC--CCCCceEEecCCCCCCCCCCCCc-
Q 004707          392 --------CLSSLEELDLSGNS-FESLPVSIKQLSQLSSLDLSDCNMLRSLPEL--PSCLGFLNLSGCNMLQSLPELPL-  459 (734)
Q Consensus       392 --------~l~~L~~L~Ls~n~-l~~lp~~l~~l~~L~~L~L~~n~~l~~lp~~--~~~L~~L~Ls~n~~l~~lp~l~~-  459 (734)
                              .+++|+.|+|++|. +..+|.+++++++|+.|+|++|..++.+|..  +++|+.|++++|..+..+|..+. 
T Consensus       768 ~l~~~~~~~~~sL~~L~Ls~n~~l~~lP~si~~L~~L~~L~Ls~C~~L~~LP~~~~L~sL~~L~Ls~c~~L~~~p~~~~n  847 (1153)
T PLN03210        768 PLTPLMTMLSPSLTRLFLSDIPSLVELPSSIQNLHKLEHLEIENCINLETLPTGINLESLESLDLSGCSRLRTFPDISTN  847 (1153)
T ss_pred             ccchhhhhccccchheeCCCCCCccccChhhhCCCCCCEEECCCCCCcCeeCCCCCccccCEEECCCCCccccccccccc
Confidence                    12356666666663 4467777777888888888887777777653  46677777777766665555443 


Q ss_pred             ----------------------CCceEeccCCcCCCCCcccccccccc---CCCCCccccc------------CCCCCCc
Q 004707          460 ----------------------RLRRLRAGNCKLLQSLPEIRSSVEEL---DASVPENLSK------------YSNNPRV  502 (734)
Q Consensus       460 ----------------------~L~~L~l~~c~~L~~l~~l~~s~n~L---~~~~p~~l~~------------l~~~~~~  502 (734)
                                            +|+.|++++|+.++.+|....++..|   +..-+.+|..            ...+...
T Consensus       848 L~~L~Ls~n~i~~iP~si~~l~~L~~L~L~~C~~L~~l~~~~~~L~~L~~L~l~~C~~L~~~~l~~~~~~~~~~~~n~~~  927 (1153)
T PLN03210        848 ISDLNLSRTGIEEVPWWIEKFSNLSFLDMNGCNNLQRVSLNISKLKHLETVDFSDCGALTEASWNGSPSEVAMATDNIHS  927 (1153)
T ss_pred             cCEeECCCCCCccChHHHhcCCCCCEEECCCCCCcCccCcccccccCCCeeecCCCcccccccCCCCchhhhhhcccccc
Confidence                                  45555566666666555432222222   1111111110            0111112


Q ss_pred             ccCcccccccccccccchhhhhhhHHHHHHHHHHHHHHHHHhhhhhhhcccCCCCCceeeecCCCCCCCCcccCCCCceE
Q 004707          503 VYPTEISHQFTNCLKLNEKANNRILADLRLRIQHMTIALLRRLDERVKNKKRIAPKACTIALPGSEIPDWFRNQSSGHLM  582 (734)
Q Consensus       503 ~~~~~~~~~~~nc~~L~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~Pg~~iP~wf~~q~~g~si  582 (734)
                      .+|......|.||++|++.+..          +               ++    .....+++||.++|+||+||+.|+++
T Consensus       928 ~~p~~~~l~f~nC~~L~~~a~l----------~---------------~~----~~~~~~~l~g~evp~~f~hr~~g~sl  978 (1153)
T PLN03210        928 KLPSTVCINFINCFNLDQEALL----------Q---------------QQ----SIFKQLILSGEEVPSYFTHRTTGASL  978 (1153)
T ss_pred             cCCchhccccccccCCCchhhh----------c---------------cc----ccceEEECCCccCchhccCCccccee
Confidence            3444445567788777653310          0               00    12235789999999999999999999


Q ss_pred             E-EEeeCCCcc-ccccceeEEEEEeecCCCCccCCCCCceeEeeecCCccceeeeeecccccccccccceeecccccCCC
Q 004707          583 S-IQLLSHSFC-RNLIGFAFCAVLGFKQDLDFLDTIGDGRQFSSLRDPFVSVRYRFRLETKTVSEAKHVNRYNHFEDLQR  660 (734)
Q Consensus       583 ~-i~l~~~~~~-~~~~gf~~c~v~~~~~~~~~~~~~~~~~~~c~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  660 (734)
                      + |++ |+.|+ ..|.||++|+|+++........ ....+|.|++.+.+.+..   .       .....+.+.      .
T Consensus       979 ~~i~l-~~~~~~~~~~~f~~c~v~~~~~~~~~~~-~~~~~~~c~~~~~~~~~~---~-------~~~~~~~~~------~ 1040 (1153)
T PLN03210        979 TNIPL-LHISPCQPFFRFRACAVVDSESFFIISV-SFDIQVCCRFIDRLGNHF---D-------SPYQPHVFS------V 1040 (1153)
T ss_pred             eeecc-CCcccCCCccceEEEEEEecCccccCCC-ceeEEEEEEEECCCCCcc---c-------cCCCceeEe------e
Confidence            8 999 88888 6799999999998865432110 012366777664221110   0       000000000      1


Q ss_pred             CCCCCeEEEEeecccccCCC----CCCCeeeEEEEEeeccccccCCcceEeeeeceEeecCCCC
Q 004707          661 PIDSDHVILGFCLCMNVGFP----DGNNHTTVSFEFFPAVGNALYGGYGVKRCGLCPVYANPNE  720 (734)
Q Consensus       661 ~~~sdH~~l~~~~~~~~~~~----~~~~~~~~~f~~~~~~~~~~~~~~~vk~cGv~~vy~~~~~  720 (734)
                      ....+|++++... ......    .+.++.+++++|.....   ...++||+||||++|+.+..
T Consensus      1041 ~~~~~~l~~~~~~-~~~~~~~~~~~~~~~~~~~~~f~~~~~---~~~~~~~~cg~~~~~~~~~~ 1100 (1153)
T PLN03210       1041 TKKGSHLVIFDCC-FPLNEDNAPLAELNYDHVDIQFRLTNK---NSQLKLKGCGIRLSEDDSSL 1100 (1153)
T ss_pred             eccccceEEeccc-ccccccccchhccCCceeeEEEEEecC---CCCeEEEeeeEEEeccCCCc
Confidence            1234455544221 100011    12245555555554322   22479999999999976554

syringae 6; Provisional

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals []	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK04841 transcriptional regulator MalT; Provisional	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>PF05729 NACHT: NACHT domain	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed	Back alignment and domain information

>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP	Back alignment and domain information

>PRK00411 cdc6 cell division control protein 6; Reviewed	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily	Back alignment and domain information

>COG3899 Predicted ATPase [General function prediction only]	Back alignment and domain information

>KOG4308 consensus LRR-containing protein [Function unknown]	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>PRK05564 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR02928 orc1/cdc6 family replication initiation protein	Back alignment and domain information

>PF13173 AAA_14: AAA domain	Back alignment and domain information

>TIGR01242 26Sp45 26S proteasome subunit P45 family	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

>PRK07471 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK09087 hypothetical protein; Validated	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>KOG4308 consensus LRR-containing protein [Function unknown]	Back alignment and domain information

>TIGR00678 holB DNA polymerase III, delta' subunit	Back alignment and domain information

>PRK13342 recombination factor protein RarA; Reviewed	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

>PRK05642 DNA replication initiation factor; Validated	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		734
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	3e-48
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	1e-34
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-34
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	5e-33
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-08
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	5e-30
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	2e-27
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	6e-20
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	1e-16
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-29
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	6e-24
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	2e-22
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	4e-18
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	3e-16
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	1e-12
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	3e-29
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	4e-29
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	2e-28
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	6e-23
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	3e-18
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	4e-09
2a5y_B		549	CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis	2e-28
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	8e-28
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	5e-21
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-10
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	2e-27
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	2e-25
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	2e-14
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	1e-12
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	8e-10
1z6t_A		591	APAF-1, apoptotic protease activating factor 1; ca	1e-25
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	9e-25
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	3e-24
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	8e-19
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	4e-14
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	1e-11
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	1e-07
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	2e-24
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	9e-22
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	4e-24
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	3e-18
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	1e-13
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	1e-22
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	5e-22
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	5e-19
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	2e-06
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	7e-22
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	3e-18
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	7e-06
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	1e-21
1o6v_A		466	Internalin A; bacterial infection, extracellular r	2e-21
1o6v_A		466	Internalin A; bacterial infection, extracellular r	1e-18
1o6v_A		466	Internalin A; bacterial infection, extracellular r	6e-18
1o6v_A		466	Internalin A; bacterial infection, extracellular r	5e-11
1o6v_A		466	Internalin A; bacterial infection, extracellular r	3e-09
1o6v_A		466	Internalin A; bacterial infection, extracellular r	1e-05
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	2e-21
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	3e-15
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	1e-05
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	3e-21
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	5e-17
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	3e-16
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	1e-14
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	7e-21
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	1e-20
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	1e-20
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	2e-14
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	1e-13
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	7e-13
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	2e-20
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	1e-04
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	4e-20
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	1e-19
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	2e-19
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	7e-13
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	5e-20
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-19
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	1e-17
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	1e-16
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	4e-16
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	1e-14
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	4e-05
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	6e-20
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	2e-18
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	8e-14
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	7e-20
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	1e-16
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	3e-11
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	8e-20
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	5e-19
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	6e-16
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	3e-15
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	1e-19
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	1e-18
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	3e-18
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	2e-12
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	3e-06
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	4e-19
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	5e-19
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	2e-13
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	7e-13
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	4e-18
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	2e-16
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	7e-12
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	2e-08
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	5e-18
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	1e-17
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	2e-17
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	8e-13
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	1e-17
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	3e-16
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	6e-14
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	9e-10
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	4e-17
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	7e-16
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	1e-14
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	2e-12
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	6e-17
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	2e-15
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	5e-15
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	5e-10
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	3e-06
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	7e-17
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	3e-14
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	2e-06
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	9e-17
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	6e-13
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	2e-12
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	3e-12
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	4e-10
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	1e-16
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	4e-09
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	2e-16
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	7e-16
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	7e-06
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	5e-16
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	2e-14
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	1e-10
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	2e-06
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	2e-15
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	9e-13
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	7e-10
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	1e-06
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	9e-06
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	4e-15
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	1e-14
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	6e-13
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	1e-11
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	5e-09
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	1e-04
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	1e-14
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	5e-09
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	6e-07
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	8e-06
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	2e-14
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	1e-11
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	1e-05
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	2e-14
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	7e-14
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	3e-07
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	7e-14
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	1e-13
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	2e-13
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	2e-13
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	4e-06
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	1e-05
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	2e-13
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	3e-12
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	6e-10
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	1e-04
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	3e-13
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	9e-11
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	1e-06
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	3e-06
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	7e-13
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	2e-06
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	8e-13
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	2e-10
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	4e-08
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	2e-11
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	5e-05
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	1e-04
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	5e-04
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	5e-10
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	6e-10
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	1e-08
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	1e-07
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	4e-07
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	4e-09
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	5e-06
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	1e-05
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	7e-09
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	5e-05
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	9e-09
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	1e-08
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	2e-06
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	3e-06
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	3e-06
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	2e-08
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	4e-08
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	3e-06
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	6e-06
3m19_A		251	Variable lymphocyte receptor A diversity region; a	6e-08
3m19_A		251	Variable lymphocyte receptor A diversity region; a	2e-04
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	9e-08
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	3e-05
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	9e-07
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	1e-04
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	9e-07
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	2e-05
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	3e-06
3e6j_A		229	Variable lymphocyte receptor diversity region; var	6e-06
3e6j_A		229	Variable lymphocyte receptor diversity region; var	3e-05
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	1e-05
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	7e-05
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	2e-05
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	7e-05
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	9e-05
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	2e-04
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	3e-04
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	4e-04
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	3e-04
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	4e-04
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	4e-04
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	8e-04

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

 Score =  172 bits (437), Expect = 3e-48
 Identities = 70/280 (25%), Positives = 118/280 (42%), Gaps = 26/280 (9%)

Query: 228 LKHNKLDLRDCRRLKRI--STRFCKLKSLVDLFLHGCLNLERFPEILEKMEHLKHIYLQR 285
             + +++ R  R LK              V L L     L +FP+   ++ HL+H+ +  
Sbjct: 55  SNNPQIETRTGRALKATADLLEDATQPGRVALELRSV-PLPQFPDQAFRLSHLQHMTIDA 113

Query: 286 TAITELPSSFENLLGLESLSVRGCSKLDKLPDNIGNLESLAYI-LADGSAISQLPSSVAD 344
             + ELP + +   GLE+L++     L  LP +I +L  L  + +     +++LP  +A 
Sbjct: 114 AGLMELPDTMQQFAGLETLTLARN-PLRALPASIASLNRLRELSIRACPELTELPEPLAS 172

Query: 345 SNV---------LRYLWFPRCRNLVSLPPLLLSGLSSLECLHLRDCAVTDIPQEIGCLSS 395
           ++          L+ L       + SLP  + + L +L+ L +R+  ++ +   I  L  
Sbjct: 173 TDASGEHQGLVNLQSLRL-EWTGIRSLPASI-ANLQNLKSLKIRNSPLSALGPAIHHLPK 230

Query: 396 LEELDLSG-NSFESLPVSIKQLSQLSSLDLSDCNMLRSLPE----LPSCLGFLNLSGCNM 450
           LEELDL G  +  + P      + L  L L DC+ L +LP     L   L  L+L GC  
Sbjct: 231 LEELDLRGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQ-LEKLDLRGCVN 289

Query: 451 LQSLPELPLRLRRLRAGNCKLLQSLPEIRSSVEELDASVP 490
           L  LP L  +L       C +L          +    + P
Sbjct: 290 LSRLPSLIAQLPAN----CIILVPPHLQAQLDQHRPVARP 325

PyMOL of 4fcg

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		734
2a5y_B		549	CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis	99.96
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	99.95
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	99.94
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.94
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.94
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.94
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.94
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.93
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.92
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.92
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	99.92
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.92
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.92
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.91
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.91
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.91
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.91
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.9
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.9
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.9
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.9
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	99.9
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.9
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.9
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.9
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.9
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.9
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.9
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.89
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.89
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.89
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.89
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.89
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.89
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.89
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.89
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.89
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.88
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.88
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.88
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.88
1z6t_A		591	APAF-1, apoptotic protease activating factor 1; ca	99.88
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.88
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.88
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.88
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.88
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.88
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	99.88
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.87
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.87
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.87
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.87
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.87
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.87
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.87
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.87
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.87
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.87
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	99.87
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.87
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.86
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.86
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.86
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.86
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.85
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.85
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.85
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.85
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.85
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.84
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.84
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.84
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.83
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.82
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.82
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.82
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.82
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.81
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.81
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.8
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.8
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.8
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.8
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.79
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.78
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.76
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.76
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.76
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.75
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.75
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.75
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.74
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.74
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.73
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.73
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.73
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.71
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.7
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.69
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.69
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.69
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.68
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.68
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.67
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.67
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.66
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.66
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.66
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.64
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.64
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.62
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.62
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.61
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.61
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.61
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.6
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.59
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.59
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.58
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.55
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.54
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.54
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.53
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.51
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.46
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.45
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.43
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.4
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.39
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.39
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.39
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.38
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.37
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.36
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.35
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	99.33
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	99.31
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.3
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	99.27
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	99.24
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	99.2
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	99.17
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	99.15
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	99.13
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	99.05
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	98.95
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.93
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	98.9
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.79
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	98.75
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	98.65
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	98.63
2fna_A		357	Conserved hypothetical protein; structural genomic	98.24
2qen_A		350	Walker-type ATPase; unknown function; HET: ADP; 2.	98.1
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	98.02
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	97.96
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	97.92
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.85
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	97.77
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	97.76
1w5s_A		412	Origin recognition complex subunit 2 ORC2; replica	97.76
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.74
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	97.59
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	97.57
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	97.55
2qby_B		384	CDC6 homolog 3, cell division control protein 6 ho	97.21
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	97.09
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	97.06
1njg_A		250	DNA polymerase III subunit gamma; rossman-like fol	97.05
2v1u_A		387	Cell division control protein 6 homolog; DNA repli	96.99
2qby_A		386	CDC6 homolog 1, cell division control protein 6 ho	96.69
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	96.06
2chg_A		226	Replication factor C small subunit; DNA-binding pr	95.84
1sxj_B		323	Activator 1 37 kDa subunit; clamp loader, processi	95.48
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	95.12
1fnn_A		389	CDC6P, cell division control protein 6; ORC1, AAA	95.06
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	94.77
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	93.76
1hqc_A		324	RUVB; extended AAA-ATPase domain, complex with nuc	93.3
1iqp_A		327	RFCS; clamp loader, extended AAA-ATPase domain, co	93.24
1jr3_A		373	DNA polymerase III subunit gamma; processivity, pr	87.98
2chq_A		319	Replication factor C small subunit; DNA-binding pr	87.21
1d2n_A		272	N-ethylmaleimide-sensitive fusion protein; hexamer	86.93
3bos_A		242	Putative DNA replication factor; P-loop containing	85.89
2z4s_A		440	Chromosomal replication initiator protein DNAA; AA	81.55
3h4m_A		285	Proteasome-activating nucleotidase; ATPase, PAN, A	80.73

>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A*	Back alignment and structure

Probab=99.96  E-value=8.4e-30  Score=290.32  Aligned_cols=194  Identities=18%  Similarity=0.225  Sum_probs=159.9

Q ss_pred             CEEEEEEeCCCChHHHHhHhccCCCCCCCcEEEEEcCChhHHhhcC-CCceEECCCCCHHHHHHHHHHhhcCCCCCchhH
Q 004707            1 MKVLIVLDDVNKDEQLEGLIGGLDQYGPGSRIVVTTRDKGVLENFG-VEKIYRVNGLEFYEAFELFYYFAFKENHCPEDF   79 (734)
Q Consensus         1 kk~LiVLDDV~~~~~~~~l~~~~~~~~~GSrIivTTR~~~v~~~~~-~~~~y~v~~L~~~~s~~Lf~~~af~~~~~~~~~   79 (734)
                      ||+||||||||+.+++ .+..     .+|||||||||++.|+..++ ...+|+|++|+.+|||+||.++||+... ++++
T Consensus       243 kr~LlVLDdv~~~~~~-~~~~-----~~gs~ilvTTR~~~v~~~~~~~~~~~~l~~L~~~ea~~Lf~~~a~~~~~-~~~~  315 (549)
T 2a5y_B          243 PNTLFVFDDVVQEETI-RWAQ-----ELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMPV-GEKE  315 (549)
T ss_dssp             TTEEEEEEEECCHHHH-HHHH-----HTTCEEEEEESBGGGGGGCCSCEEEEECCCCCHHHHHHHHHHTSCCCC---CHH
T ss_pred             CcEEEEEECCCCchhh-cccc-----cCCCEEEEEcCCHHHHHHcCCCCeEEECCCCCHHHHHHHHHHHhcCCCC-chhH
Confidence            4899999999999986 3322     28999999999999999886 5578999999999999999999997643 4688


Q ss_pred             HHHHHHHHHHhCCCchHHHHHHhhcCCcccHHHHHHHhhhh----cCCCchhHHHHHHhhcccCChhhhhhhh-------
Q 004707           80 KRDSRRVVKYADGNPLVLKVLGSSLKRKSHWGNVLDDLNRI----CESDIHDIHDILKISFNELMPKMKSIFL-------  148 (734)
Q Consensus        80 ~~l~~~i~~~c~GlPLal~vlgs~L~~~~~W~~~l~~l~~~----~~~~i~~i~~~L~~Syd~L~~~~k~~fl-------  148 (734)
                      .+++++|+++|+|+||||+++|+.|+.+ .|+.+ ..+...    ...++   ..+|++||++||.+.|.||+       
T Consensus       316 ~~~~~~I~~~c~GlPLAl~~~g~~l~~~-~w~~~-~~l~~~l~~~~~~~i---~~~l~~Sy~~L~~~lk~~f~~Ls~~er  390 (549)
T 2a5y_B          316 EDVLNKTIELSSGNPATLMMFFKSCEPK-TFEKM-AQLNNKLESRGLVGV---ECITPYSYKSLAMALQRCVEVLSDEDR  390 (549)
T ss_dssp             HHHHHHHHHHHTTCHHHHHHHHTTCCSS-SHHHH-HHHHHHHHHHCSSTT---CCCSSSSSSSHHHHHHHHHHTSCHHHH
T ss_pred             HHHHHHHHHHhCCChHHHHHHHHHhccc-hHHHH-HHhHHHhhcccHHHH---HHHHhcccccccHHHHHHHhccchhhh
Confidence            9999999999999999999999999854 57654 444332    33444   89999999999999999999       


Q ss_pred             ----hhcccccCCChhHHHHHHHhh--c--------------cchhHHHhhcCCceeeC----CeEEecHHHHHHHHHHH
Q 004707          149 ----DIACFFEGEDKDFVTRILDDY--G--------------SYGLEVLIDKSLITVSH----NCLRMHDLLQEMGREIV  204 (734)
Q Consensus       149 ----~ia~f~~~~~~~~~~~~l~~~--~--------------~~~i~~L~~ksli~~~~----~~~~mHdll~~~~~~i~  204 (734)
                          |||+||+++.++ + .+|.+.  |              ..++++|+++||++...    .+|+|||+++++|++++
T Consensus       391 ~l~~~ls~fp~~~~i~-i-~~w~a~~~G~i~~~~~~~~~~~~~~~l~~L~~rsLl~~~~~~~~~~~~mHdlv~~~a~~~~  468 (549)
T 2a5y_B          391 SALAFAVVMPPGVDIP-V-KLWSCVIPVDICSNEEEQLDDEVADRLKRLSKRGALLSGKRMPVLTFKIDHIIHMFLKHVV  468 (549)
T ss_dssp             HHTTGGGSSCTTCCEE-H-HHHHHHSCC-------CCCTHHHHHHHHHTTTBSSCSEEECSSSCEEECCHHHHHHHHTTS
T ss_pred             hHhhheeeeCCCCeee-e-eeeeeeccceeccCCCCCCHHHHHHHHHHHHHcCCeeEecCCCceEEEeChHHHHHHHHHH
Confidence                999999999887 3 333332  1              13799999999999862    47999999999999998


Q ss_pred             hccc
Q 004707          205 RQES  208 (734)
Q Consensus       205 ~~e~  208 (734)
                      .+++
T Consensus       469 ~~~~  472 (549)
T 2a5y_B          469 DAQT  472 (549)
T ss_dssp             CTHH
T ss_pred             HHHH
Confidence            7765

PyMOL of 2a5y

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A*	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A*	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20	Back alignment and structure

>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi}	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A*	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A*	Back alignment and structure

>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix}	Back alignment and structure

>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus}	Back alignment and structure

>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C*	Back alignment and structure

>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B*	Back alignment and structure

>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A	Back alignment and structure

>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A*	Back alignment and structure

>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A	Back alignment and structure

>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A*	Back alignment and structure

>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		734
d2a5yb3		277	c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor	2e-21
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	7e-13
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	6e-11
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	2e-09
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	1e-06
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	2e-05
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	5e-05
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	0.001
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	4e-12
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	6e-09
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	9e-09
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	2e-08
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	6e-12
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	3e-11
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	4e-06
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	4e-05
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	0.001
d2astb2		284	c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1	2e-09
d1ogqa_		313	c.10.2.8 (A:) Polygalacturonase inhibiting protein	7e-09
d1ogqa_		313	c.10.2.8 (A:) Polygalacturonase inhibiting protein	9e-06
d1ogqa_		313	c.10.2.8 (A:) Polygalacturonase inhibiting protein	0.003
d1p9ag_		266	c.10.2.7 (G:) von Willebrand factor binding domain	9e-08
d1p9ag_		266	c.10.2.7 (G:) von Willebrand factor binding domain	1e-05
d1h6ua2		227	c.10.2.1 (A:36-262) Internalin H {Listeria monocyt	2e-06
d1xwdc1		242	c.10.2.7 (C:18-259) Follicle-stimulating hormone r	3e-06
d2ca6a1		344	c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom	9e-06
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	1e-05
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	4e-05
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	1e-04
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	2e-04
d1dcea3		124	c.10.2.2 (A:444-567) Rab geranylgeranyltransferase	1e-04
d1dcea3		124	c.10.2.2 (A:444-567) Rab geranylgeranyltransferase	0.001
d1a9na_		162	c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom	2e-04
d1a9na_		162	c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom	6e-04
d1h6ta2		210	c.10.2.1 (A:31-240) Internalin B {Listeria monocyt	2e-04
d1h6ta2		210	c.10.2.1 (A:31-240) Internalin B {Listeria monocyt	3e-04
d1ozna_		284	c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept	5e-04
d2omxa2		199	c.10.2.1 (A:37-235) Internalin B {Listeria monocyt	0.004

>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

 Score = 92.6 bits (229), Expect = 2e-21
 Identities = 27/147 (18%), Positives = 53/147 (36%), Gaps = 9/147 (6%)

Query: 2   KVLIVLDDVNKDEQLEGLIGGLDQYGPGSRIVVTTRDKGVLENFGVE-KIYRVNGLEFYE 60
             L V DDV ++E +              R +VTTRD  +        +   V  LE  E
Sbjct: 136 NTLFVFDDVVQEETIRWA------QELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDE 189

Query: 61  AFELFYYFAFKENHCPEDFKRDSRRVVKYADGNPLVLKVLGSSLKRKSHWGNVLDDLNRI 120
            ++    +        E  +    + ++ + GNP  L +   S + K+ +  +    N++
Sbjct: 190 CYDFLEAYGMPM-PVGEKEEDVLNKTIELSSGNPATLMMFFKSCEPKT-FEKMAQLNNKL 247

Query: 121 CESDIHDIHDILKISFNELMPKMKSIF 147
               +  +  I   S+  L   ++   
Sbjct: 248 ESRGLVGVECITPYSYKSLAMALQRCV 274

PyMOL of d2a5yb3

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		734
d2a5yb3		277	CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI	99.92
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.89
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.88
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.8
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.79
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.77
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.76
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.76
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.75
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.72
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.7
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.7
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.69
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.68
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.66
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.65
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.61
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.61
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.61
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.6
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.58
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.51
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.41
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.4
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.39
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.36
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.31
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.31
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.29
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	99.18
d2ifga3		156	High affinity nerve growth factor receptor, N-term	99.13
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	99.13
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	99.02
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	99.0
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	98.96
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	98.92
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.88
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.73
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.43
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	97.0
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	96.87
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	96.07
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	95.8
d2fnaa2		283	Archaeal ATPase SSO1545 {Sulfolobus solfataricus [	91.82
d1a5ta2		207	delta prime subunit of DNA polymerase III, N-domai	81.26

>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

Probab=99.92  E-value=4.6e-26  Score=233.43  Aligned_cols=139  Identities=19%  Similarity=0.210  Sum_probs=123.3

Q ss_pred             CEEEEEEeCCCChHHHHhHhccCCCCCCCcEEEEEcCChhHHhhcCCC-ceEECCCCCHHHHHHHHHHhhcCCCCCchhH
Q 004707            1 MKVLIVLDDVNKDEQLEGLIGGLDQYGPGSRIVVTTRDKGVLENFGVE-KIYRVNGLEFYEAFELFYYFAFKENHCPEDF   79 (734)
Q Consensus         1 kk~LiVLDDV~~~~~~~~l~~~~~~~~~GSrIivTTR~~~v~~~~~~~-~~y~v~~L~~~~s~~Lf~~~af~~~~~~~~~   79 (734)
                      ||+||||||||+.++|+.+.      ..|||||||||+++|+..+..+ ++|+|++|+.+|||+||+.+||....+ +..
T Consensus       135 kr~LlVLDDv~~~~~~~~~~------~~~srilvTTR~~~v~~~~~~~~~~~~l~~L~~~ea~~Lf~~~~~~~~~~-~~~  207 (277)
T d2a5yb3         135 PNTLFVFDDVVQEETIRWAQ------ELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMPVG-EKE  207 (277)
T ss_dssp             TTEEEEEEEECCHHHHHHHH------HTTCEEEEEESBGGGGGGCCSCEEEEECCCCCHHHHHHHHHHTSCCCC---CHH
T ss_pred             CCeeEecchhhHHhhhhhhc------ccCceEEEEeehHHHHHhcCCCCceEECCCCCHHHHHHHHHHHhCCccCc-hhh
Confidence            68999999999999999764      3589999999999999987665 689999999999999999999976544 457


Q ss_pred             HHHHHHHHHHhCCCchHHHHHHhhcC--CcccHHHHHHHhhhhcCCCchhHHHHHHhhcccCChhhhhhhhh
Q 004707           80 KRDSRRVVKYADGNPLVLKVLGSSLK--RKSHWGNVLDDLNRICESDIHDIHDILKISFNELMPKMKSIFLD  149 (734)
Q Consensus        80 ~~l~~~i~~~c~GlPLal~vlgs~L~--~~~~W~~~l~~l~~~~~~~i~~i~~~L~~Syd~L~~~~k~~fl~  149 (734)
                      ++++++|+++|+|+||||+++|+.|+  +.++|.+..+++......++   ..+++.||++||.++|.||-+
T Consensus       208 ~~~~~~iv~~c~GlPLAl~~ig~~l~~k~~~~~~~~~~~L~~~~~~~v---~~il~~sY~~L~~~lk~c~~~  276 (277)
T d2a5yb3         208 EDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLESRGLVGV---ECITPYSYKSLAMALQRCVEV  276 (277)
T ss_dssp             HHHHHHHHHHHTTCHHHHHHHHTTCCSSSHHHHHHHHHHHHHHCSSTT---CCCSSSSSSSHHHHHHHHHHT
T ss_pred             HHHHHHHHHHhCCCHHHHHHHHHHhccCCHHHHHHHHHHHhcCcHHHH---HHHHHHHHhcccHHHHHHHHh
Confidence            89999999999999999999999999  56789998888887766666   999999999999999999965

PyMOL of d2a5yb3

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure