Citrus Sinensis ID: 004714


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730----
MDSSSLEGVALDPSKCSKLSMEEKRELVYQLSKQSHSASETLRSWTRQEILQILCAELGKERKYTGLTKLKIIENLLKLVSEKKSGEREAKTDIEPQSSPASSQRPSKRQRKNDNPARLPVPVTDAAMNNSGSDLVNAIYCKNSACRATLRKEDVFCKRCSCCICRKYDDNKDPSLWLTCSSEPPFGGDSCGMSCHLECALKNERSGIGKDRCYSGLDGSFYCISCRKVNDLLGCWKKQLVVAKNTRRVDILCYRLSLGQKLVNATEKYKNLSKIVDDAVKMLEDEVGPLTGLPVKMGRGIVNRLSSGPEVQKLCACAVESLDKMISNTILPNPSVQGSNVIVPNMVKFEDVRATSLTVVLGSEDPSPGNIISYTLWHRRAHEGFPARPTCTLFAPNTRFVVTGLCPATEYQFKVVSSNGTTELGRCEIWFSTGSSRDEVTNCSVIERSQSPATNCSSLSNPSSVEDETNNVTPDRDPNDAQVNNYYTYSKETDKIASTNLCDDAIDCTVLGRGTTPADAVSLLDEERANNIDGSMPDSHVQKLESKHPPEGRIIEEMSTDNGVDTPVPTGMECVPYMRSLEAGLPITPCKIEILKDAQARNGRSKLNSKDMENGTGNRDEPQDGSTSKKRSSESRDEDCTANGLSDMDFEHCVKVIRWLECEGHIERNFRQKFLTWYSLRATPQEVRIVKVFVDTFVEDPASLAEQLMDTFSDCISSRRSSVVPAGFCMKLWH
ccccccccccccccccccccHHHHHHHHHHHHHccccHHHHHcHHcHHHHHHHHHHHHccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccEEEEccccccccccccEEEccccccccccccccHHHHHHHHcccccccccccccccccEEEEEccccccccHHHHHHHHHHHHHHccHHHHHHHHHcccHHHHcccHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHccccHHHHHHHHHHHHHHcccccccccccccccccccccccccEEEEEEEcEEEEEEccccccccccccEEEEEEEcccccccccccEEEcccccEEEEcccccccEEEEEEEEEccccccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEEcccccccccccEEEEEEcccccccEEEHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccccccccccccc
cccccccccEEcccHcccccHHHHHHHHHHHHHccccHHHHHHcccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccHHHHcccccccHHHccEEEEEEcccccccccEEEEEccccccccccccccHHHHHHHHccccccccccccccccEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEEEEcccEEEEEEEccccccccccEEEEEEEcccccccccccEEEEccccEEEEEccccccEEEEEEEEEccccccccEEEEEEcccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccHcccccccccccHHcccccccccccccccccccHHcccccccccccccHccccccccccccEEEEccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccccccccHHHHHcc
mdssslegvaldpskcsklsMEEKRELVYQLSKQSHSASETLRSWTRQEILQILCAELGkerkytglTKLKIIENLLKLVSEKksgereaktdiepqsspassqrpskrqrkndnparlpvpvtdaamnnsgsdLVNAIYCKNSACRATLRKEdvfckrcsccicrkyddnkdpslwltcsseppfggdscgmschLECALknersgigkdrcysgldgsfyciscRKVNDLLGCWKKQLVVAKNTRRVDILCYRLSLGQKLVNATEKYKNLSKIVDDAVKMLEdevgpltglpvkmgrgivnrlssgpEVQKLCACAVESLDKMIsntilpnpsvqgsnvivpnmvkfeDVRATSLTVVlgsedpspgniiSYTLWHrrahegfparptctlfapntrfvvtglcpateyQFKVvssngttelgrceiwfstgssrdevtncsviersqspatncsslsnpssvedetnnvtpdrdpndaqvnnyytysketdkiastnlcddaidctvlgrgttpadaVSLLDeerannidgsmpdshvqkleskhppegriieemstdngvdtpvptgmecvpymrsleaglpitpckIEILKDAQarngrsklnskdmengtgnrdepqdgstskkrssesrdedctanglsdmdfEHCVKVIRWLECEGHIERNFRQKFLtwyslratpqeVRIVKVFVDTFVEDPASLAEQLMDTFSDcissrrssvvpagfcmklwh
mdssslegvaldpskcsklsmEEKRELVYQLSKqshsasetlrswtrQEILQILCAElgkerkytgltkLKIIENLLKLVsekksgereaktdiepqsspassqrpskrqrkndnparlpvpvtdaamnnsGSDLVNAIYCKNSACRATLRKEDVFCKRCSCCICrkyddnkdpsLWLTCSSEPPFGGDSCGMSCHLECALKNERSGIGKDRCYSGLDGSFYCISCRKVNDLLGCWKKQLvvakntrrvDILCyrlslgqklvnatekyknLSKIVDDAVKMLEDEVGpltglpvkmGRGIVNRLSSGPEVQKLCACAVESLDKMISNTilpnpsvqgsnVIVPNMVKFEDVRATSLTvvlgsedpspgNIISYTLWHRRAHEGFPARPTCTLFAPNTRFVVTGLCPATEYQFKvvssngttelGRCEIWfstgssrdevTNCSVIersqspatncsslsnpssvedetnnvtpdrdpndaqVNNYYTYSKETDKIASTNLCDDAIDCTVLGRGTTPADAVSLLDEERANnidgsmpdshvqkLESKHPPEGRIIEemstdngvdtpvPTGMECVPYMRSLEAGLPITPCKIEILKDAqarngrsklnskdmengtgnrdepqdgstskkrssesrdedctanglsdmdfEHCVKVIRWLECEGHIERNFRQKFLTWYSLRATPQEVRIVKVFVDTFVEDPASLAEQLMDTFSDCissrrssvvpagfcmklwh
MDSSSLEGVALDPSKCSKLSMEEKRELVYQLSKQSHSASETLRSWTRQEILQILCAELGKERKYTGLTKLKIIENLLKLVSEKKSGEREAKTDIEpqsspassqrpskrqrkNDNPARLPVPVTDAAMNNSGSDLVNAIYCKNSACRATLRKEDVFCKRCSCCICRKYDDNKDPSLWLTCSSEPPFGGDSCGMSCHLECALKNERSGIGKDRCYSGLDGSFYCISCRKVNDLLGCWKKQLVVAKNTRRVDILCYRLSLGQKLVNATEKYKNLSKIVDDAVKMLEDEVGPLTGLPVKMGRGIVNRLSSGPEVQKLCACAVESLDKMISNTILPNPSVQGSNVIVPNMVKFEDVRATSLTVVLGSEDPSPGNIISYTLWHRRAHEGFPARPTCTLFAPNTRFVVTGLCPATEYQFKVVSSNGTTELGRCEIWFSTGSSRDEVTNCSVIERSQSPATNCSSLSNPSSVEDETNNVTPDRDPNDAQVNNYYTYSKETDKIASTNLCDDAIDCTVLGRGTTPADAVSLLDEERANNIDGSMPDSHVQKLESKHPPEGRIIEEMSTDNGVDTPVPTGMECVPYMRSLEAGLPITPCKIEILKDAQARNGRSKLNSKDMENGTGNRDEPQDGSTSKKRSSESRDEDCTANGLSDMDFEHCVKVIRWLECEGHIERNFRQKFLTWYSLRATPQEVRIVKVFVDTFVEDPASLAEQLMDTFSDCISSRRSSVVPAGFCMKLWH
******************************************RSWTRQEILQILCAELGKERKYTGLTKLKIIENLLKLV*****************************************************DLVNAIYCKNSACRATLRKEDVFCKRCSCCICRKYDDNKDPSLWLTCSSEPPFGGDSCGMSCHLECALKNERSGIGKDRCYSGLDGSFYCISCRKVNDLLGCWKKQLVVAKNTRRVDILCYRLSLGQKLVNATEKYKNLSKIVDDAVKMLEDEVGPLTGLPVKMGRGIVNRLSSGPEVQKLCACAVESLDKMISNTILPNPSVQGSNVIVPNMVKFEDVRATSLTVVLGSEDPSPGNIISYTLWHRRAHEGFPARPTCTLFAPNTRFVVTGLCPATEYQFKVVSSNGTTELGRCEIWFSTG*************************************************NNYYTYSKETDKIASTNLCDDAIDCTVLGRGTTP****************************************************TGMECVPYMRSLEAGLPITPCKIEILK************************************************LSDMDFEHCVKVIRWLECEGHIERNFRQKFLTWYSLRATPQEVRIVKVFVDTFVEDPASLAEQLMDTFSDCISSRRSSVVPAGFCMKLW*
******E*************************K******ETLRSWTRQEILQILCAELGKERKYTGLTKLKIIENLLK********************************************************LVNAIYCKNSACRATLRKEDVFCKRCSCCICRKYDDNKDPSLWLTCSSEPPFGGDSCGMSCHLECALKNE************LDGSFYCISCRKVNDLLGCWKKQLVVAKNTRRVDILCYRLSLGQKLVNATEKYKNLSKIVDDAVKMLEDEVGPLTGLPVKMGRGIVNRLSSGPEVQKLCACAVESLD**********************MVKFEDVRATSLTVVLGSEDPSPGNIISYTLWHRRAHEGFPARPTCTLFAPNTRFVVTGLCPATEYQFKVVSSNGTTELGR******************************************************************************************************************************************************************************************************************************DFEHCVKVIRWLECEGHIERNFRQKFLTWYSLRATPQEVRIVKVFVDTFVEDPASLAEQLMDTFSDCISSRRSSVVPAGFCMKLWH
************PSKCSKLSMEE*******************RSWTRQEILQILCAELGKERKYTGLTKLKIIENLLKLVSEK********************************PARLPVPVTDAAMNNSGSDLVNAIYCKNSACRATLRKEDVFCKRCSCCICRKYDDNKDPSLWLTCSSEPPFGGDSCGMSCHLECALKNERSGIGKDRCYSGLDGSFYCISCRKVNDLLGCWKKQLVVAKNTRRVDILCYRLSLGQKLVNATEKYKNLSKIVDDAVKMLEDEVGPLTGLPVKMGRGIVNRLSSGPEVQKLCACAVESLDKMISNTILPNPSVQGSNVIVPNMVKFEDVRATSLTVVLGSEDPSPGNIISYTLWHRRAHEGFPARPTCTLFAPNTRFVVTGLCPATEYQFKVVSSNGTTELGRCEIWFSTGSSRDEVTNCSVIERSQ***********************PDRDPNDAQVNNYYTYSKETDKIASTNLCDDAIDCTVLGRGTTPADAVSLLDEERANNIDGSMPDSHVQKLESKHPPEGRIIEEMSTDNGVDTPVPTGMECVPYMRSLEAGLPITPCKIEILKDAQARNGRSKLNSKDME****************************ANGLSDMDFEHCVKVIRWLECEGHIERNFRQKFLTWYSLRATPQEVRIVKVFVDTFVEDPASLAEQLMDTFSDCISSRRSSVVPAGFCMKLWH
*******GVALDPSKCSKLSMEEKRELVYQLSKQSHSASETLRSWTRQEILQILCAELGKERKYTGLTKLKIIENLLKLVSE***************************************************DLVNAIYCKNSACRATLRKEDVFCKRCSCCICRKYDDNKDPSLWLTCSSEPPFGGDSCGMSCHLECALKNERSGIGKDRCYSGLDGSFYCISCRKVNDLLGCWKKQLVVAKNTRRVDILCYRLSLGQKLVNATEKYKNLSKIVDDAVKMLEDEVGPLTGLPVKMGRGIVNRLSSGPEVQKLCACAVESLDKMISNT**********NVIVPNMVKFEDVRATSLTVVLGSEDPSPGNIISYTLWHRRAHEGFPARPTCTLFAPNTRFVVTGLCPATEYQFKVVSSNGTTELGRCEIWFSTGSS******************************************************************************************************SH*Q*****HP**GRIIEEMS**************************************************************************************SDMDFEHCVKVIRWLECEGHIERNFRQKFLTWYSLRATPQEVRIVKVFVDTFVEDPASLAEQLMDTFSDCISSRRSSVVPAGFC*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSSSLEGVALDPSKCSKLSMEEKRELVYQLSKQSHSASETLRSWTRQEILQILCAELGKERKYTGLTKLKIIENLLKLVSEKKSGEREAKTDIEPQSSPASSQRPSKRQRKNDNPARLPVPVTDAAMNNSGSDLVNAIYCKNSACRATLRKEDVFCKRCSCCICRKYDDNKDPSLWLTCSSEPPFGGDSCGMSCHLECALKNERSGIGKDRCYSGLDGSFYCISCRKVNDLLGCWKKQLVVAKNTRRVDILCYRLSLGQKLVNATEKYKNLSKIVDDAVKMLEDEVGPLTGLPVKMGRGIVNRLSSGPEVQKLCACAVESLDKMISNTILPNPSVQGSNVIVPNMVKFEDVRATSLTVVLGSEDPSPGNIISYTLWHRRAHEGFPARPTCTLFAPNTRFVVTGLCPATEYQFKVVSSNGTTELGRCEIWFSTGSSRDEVTNCSVIERSQSPATNCSSLSNPSSVEDETNNVTPDRDPNDAQVNNYYTYSKETDKIASTNLCDDAIDCTVLGRGTTPADAVSLLDEERANNIDGSMPDSHVQKLESKHPPEGRIIEEMSTDNGVDTPVPTGMECVPYMRSLEAGLPITPCKIEILKDAQARNGRSKLNSKDMENGTGNRDEPQDGSTSKKRSSESRDEDCTANGLSDMDFEHCVKVIRWLECEGHIERNFRQKFLTWYSLRATPQEVRIVKVFVDTFVEDPASLAEQLMDTFSDCISSRRSSVVPAGFCMKLWH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query734 2.2.26 [Sep-21-2011]
Q9FIE3620 Protein VERNALIZATION INS no no 0.566 0.670 0.470 1e-103
Q84TI31162 Protein OBERON 4 OS=Arabi no no 0.205 0.129 0.232 2e-07
Q84N38549 OBERON-like protein OS=Ni N/A no 0.125 0.167 0.292 0.0003
Q94B71733 Protein OBERON 3 OS=Arabi no no 0.193 0.193 0.236 0.0004
>sp|Q9FIE3|VIN3_ARATH Protein VERNALIZATION INSENSITIVE 3 OS=Arabidopsis thaliana GN=VIN3 PE=2 SV=2 Back     alignment and function desciption
 Score =  378 bits (970), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 226/480 (47%), Positives = 295/480 (61%), Gaps = 64/480 (13%)

Query: 1   MDSSSLE-GVALDPSKCSKLSMEEKRELVYQLSKQSHSASETLRSWTRQEILQILCAELG 59
           MDSSS E    ++  K + L++ E+REL++ LS Q   ASE L SW+R EI++I+CAE+G
Sbjct: 21  MDSSSFEDNECIETCKPNVLNVSERRELIHALSNQPEEASELLNSWSRNEIMKIICAEMG 80

Query: 60  KERKYTGLTKLKIIENLLKLVSEKKSGEREAKTDIEPQSSPASSQRPSKRQRKNDNPARL 119
           KERKYTGL K K+IENLL LVS              P    + S R + R+++      +
Sbjct: 81  KERKYTGLNKPKLIENLLNLVS-------------RPLGETSCSDRRNSRKKEKKMIGYI 127

Query: 120 PVPVTDAAMNNSGSDLVNAIYCKNSACRATLRKEDVFCKRCSCCICRKYDDNKDPSLWLT 179
                              I C+N ACRA L  +D FC+RCSCCIC+K+DDNKDPSLWLT
Sbjct: 128 -------------------ICCENLACRAALGCDDTFCRRCSCCICQKFDDNKDPSLWLT 168

Query: 180 CSSEPPFGGDSCGMSCHLECALKNERSGIGKDRCYSGLDGSFYCISCRKVNDLLGCWKKQ 239
           C        D+CG SCHLEC LK +R GIG D     LDG FYC  C K NDLLGCW+KQ
Sbjct: 169 C--------DACGSSCHLECGLKQDRYGIGSD----DLDGRFYCAYCGKDNDLLGCWRKQ 216

Query: 240 LVVAKNTRRVDILCYRLSLGQKLVNATEKYKNLSKIVDDAVKMLEDEVGPLTGLPVKMGR 299
           + VAK TRRVD+LCYRLSLGQKL+  T KY+NL +++D+AVK LE +VGPL+G  +KM R
Sbjct: 217 VKVAKETRRVDVLCYRLSLGQKLLRGTTKYRNLLELMDEAVKKLEGDVGPLSGWAMKMAR 276

Query: 300 GIVNRLSSGPEVQKLCACAVESLDKMISNTILPNPSVQGSNVIVPNMVKFEDVRATSLTV 359
           GIVNRLSSG  VQKLC+ A+E+LDK++S    P+ SV G    +   V+ E+++A S+TV
Sbjct: 277 GIVNRLSSGVHVQKLCSQAMEALDKVVS----PSESVSGQGDKMT--VRVEEIQARSVTV 330

Query: 360 VLGSEDPSP---GNIISYTLWHRRAH-EGFPARPTCTLFAPNTRFVVTGLCPATEYQFKV 415
            + SE+PS      I  + L+ R++  E   ++  C ++ P T   + GL P TE+  +V
Sbjct: 331 RVDSEEPSSSTQNKITGFRLFCRKSKDEECSSQGNCVVYLPETTSAIQGLEPDTEFCLRV 390

Query: 416 VSSNGTTELGRCEIWFST-GSSRDEVTNCSVIERSQSPATNCSS--LSNPSSVEDETNNV 472
           VS N   +L   E+ F+T     DE  +       QSP TN SS   SNPS  EDE+NNV
Sbjct: 391 VSFNEEGDLDESELRFTTLKDDGDEAGD------QQSPLTNSSSGLCSNPSLPEDESNNV 444




Plays a central role in vernalization by mediating the initial transcriptional repression of the homeotic gene FLC, a floral repressor, after a cold treatment. However, due to its transient expression, it can not maintain repression of FLC, which is then maintained by Polycomb Group complexes containing VRN2 throughout development. Required to deacetylate histones on the FLC promoter.
Arabidopsis thaliana (taxid: 3702)
>sp|Q84TI3|OBE4_ARATH Protein OBERON 4 OS=Arabidopsis thaliana GN=OBE4 PE=1 SV=2 Back     alignment and function description
>sp|Q84N38|PVIP_NICBE OBERON-like protein OS=Nicotiana benthamiana GN=PVIP PE=1 SV=1 Back     alignment and function description
>sp|Q94B71|OBE3_ARATH Protein OBERON 3 OS=Arabidopsis thaliana GN=OBE3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query734
356562279737 PREDICTED: protein VERNALIZATION INSENSI 0.993 0.989 0.661 0.0
356546032736 PREDICTED: protein VERNALIZATION INSENSI 0.991 0.989 0.662 0.0
225446034738 PREDICTED: protein VERNALIZATION INSENSI 0.994 0.989 0.654 0.0
255580419710 conserved hypothetical protein [Ricinus 0.957 0.990 0.668 0.0
357479623730 Protein VERNALIZATION INSENSITIVE [Medic 0.987 0.993 0.630 0.0
449457169737 PREDICTED: protein VERNALIZATION INSENSI 0.997 0.993 0.588 0.0
224126067679 predicted protein [Populus trichocarpa] 0.905 0.979 0.632 0.0
297735403652 unnamed protein product [Vitis vinifera] 0.882 0.993 0.607 0.0
380710177739 vernalization insensitive 3 [Solanum lyc 0.995 0.989 0.578 0.0
449507054734 PREDICTED: protein VERNALIZATION INSENSI 0.989 0.989 0.589 0.0
>gi|356562279|ref|XP_003549399.1| PREDICTED: protein VERNALIZATION INSENSITIVE 3-like [Glycine max] Back     alignment and taxonomy information
 Score =  989 bits (2556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/735 (66%), Positives = 579/735 (78%), Gaps = 6/735 (0%)

Query: 4   SSLEGVALDPSKCSKLSMEEKRELVYQLSKQSHSASETLRSWTRQEILQILCAELGKERK 63
           SS EG+ALDPSKCSKLSMEEKRELVY++SK SH ASE L+SW+RQEILQILCAE+GKERK
Sbjct: 5   SSFEGLALDPSKCSKLSMEEKRELVYEVSKWSHGASEMLQSWSRQEILQILCAEMGKERK 64

Query: 64  YTGLTKLKIIENLLKLVSEKKSGEREAKTDIEPQSSPASSQRPSKRQRKNDNPARLPVPV 123
           YTGLTKLKIIENLLK+VSEKKSG  E  TD EPQSSPA  Q+P+KRQRK++NP+ +PVP 
Sbjct: 65  YTGLTKLKIIENLLKIVSEKKSGGNETATDPEPQSSPAPGQKPAKRQRKSENPSHVPVPA 124

Query: 124 TDAAMNNSGSDLVNAIYCKNSACRATLRKEDVFCKRCSCCICRKYDDNKDPSLWLTCSSE 183
           T   +NN G D VN  YCKNSAC+ATL +   FCKRCSCCIC +YDDNKDPSLWL CSSE
Sbjct: 125 TSITVNNGG-DSVNTAYCKNSACKATLNQSYAFCKRCSCCICHQYDDNKDPSLWLICSSE 183

Query: 184 PPFGGDSCGMSCHLECALKNERSGIGKDRCYSGLDGSFYCISCRKVNDLLGCWKKQLVVA 243
            PF G SCG+SCHLECALK++ SGI KD  +  LDG FYC+SC KVNDLLGCW+KQL+VA
Sbjct: 184 NPFPGVSCGLSCHLECALKHDGSGIAKDGEHPKLDGGFYCVSCGKVNDLLGCWRKQLMVA 243

Query: 244 KNTRRVDILCYRLSLGQKLVNATEKYKNLSKIVDDAVKMLEDEVGPLTGLPVKMGRGIVN 303
           K+TRRVDILCYR+SL Q+L+  TE Y+ L KIVD+AVK LE EVGPL G PVK+GRGIVN
Sbjct: 244 KDTRRVDILCYRVSLSQRLLQGTEVYEELYKIVDEAVKKLEPEVGPLIGSPVKIGRGIVN 303

Query: 304 RLSSGPEVQKLCACAVESLDKMISNTILPN---PSVQGSNVIVPNMVKFEDVRATSLTVV 360
           RLSSGPEVQKLC  A+ESLD ++S  ILP+   P+ Q ++++ PNMV+FEDV AT+LT++
Sbjct: 304 RLSSGPEVQKLCGFALESLDSLLSKRILPSSPKPTTQDAHLLAPNMVRFEDVTATTLTII 363

Query: 361 LGSEDPSPGNIISYTLWHRRAHE-GFPARPTCTLFAPNTRFVVTGLCPATEYQFKVVSSN 419
           LGSE+PS   I  YTLWHR+  +  +P  PTCT   PN RF V+GL P TEY FKVVS N
Sbjct: 364 LGSEEPSGEIIAGYTLWHRKVDDVDYPTDPTCTSLLPNRRFRVSGLIPGTEYSFKVVS-N 422

Query: 420 GTTELGRCEIWFSTGSSRDEVTNCSVIERSQSPATNCSSLSNPSSVEDETNNVTPDRDPN 479
              E G CE+  ST    +EV NCS  ERSQSP TNCSSLSNPSSVEDETNN  P  D  
Sbjct: 423 DLRESGMCEVQVSTEHGEEEVPNCSATERSQSPVTNCSSLSNPSSVEDETNNCNPYSDLT 482

Query: 480 DAQVNNYYTYSKETDKIASTNLCDDAIDCTVLGRGTTPADAVSLLDEERANNIDGSMPDS 539
           D + ++Y +Y K+++++AS NL +D I+C+ LG    P DA SL D++ A     S+P S
Sbjct: 483 DNRADHYPSYHKDSNQLASGNLSNDVINCSNLGSVGLPPDADSLSDKQHAGGTTASIPSS 542

Query: 540 HVQKLESKHPPEGRIIEEMSTDNGVDTPVPTGMECVPYMRSLEAGLPITPCKIEILKDAQ 599
            V KLE+KH PE ++ E+MSTD+G+++P  TG ECVP + S + GLP TPCK+E LKD  
Sbjct: 543 DVLKLENKHSPEEQVTEDMSTDDGLNSPALTGRECVPLVGSSKGGLPNTPCKLETLKDGP 602

Query: 600 ARNGRSKLNSKDMENGTGNRDEPQDGSTSKKRSSESRDEDCTANGLSDMDFEHCVKVIRW 659
            +N RSK + KD EN +G R+ PQDGSTSKKRS E ++E   ANG SD DFE+ VKVIRW
Sbjct: 603 GKNKRSKSSGKDQENVSGKREGPQDGSTSKKRSGERQEEGRVANGFSDRDFEYYVKVIRW 662

Query: 660 LECEGHIERNFRQKFLTWYSLRATPQEVRIVKVFVDTFVEDPASLAEQLMDTFSDCISSR 719
           LECEGHIE+NFRQKFLTWYSLRAT QEVRIVK+++DTF+EDPASLAEQL+DTFS+CISS+
Sbjct: 663 LECEGHIEKNFRQKFLTWYSLRATSQEVRIVKIYIDTFLEDPASLAEQLVDTFSECISSK 722

Query: 720 RSSVVPAGFCMKLWH 734
           R+SVVPAGFCMKLWH
Sbjct: 723 RTSVVPAGFCMKLWH 737




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356546032|ref|XP_003541436.1| PREDICTED: protein VERNALIZATION INSENSITIVE 3-like [Glycine max] Back     alignment and taxonomy information
>gi|225446034|ref|XP_002270335.1| PREDICTED: protein VERNALIZATION INSENSITIVE 3-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255580419|ref|XP_002531036.1| conserved hypothetical protein [Ricinus communis] gi|223529389|gb|EEF31353.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|357479623|ref|XP_003610097.1| Protein VERNALIZATION INSENSITIVE [Medicago truncatula] gi|355511152|gb|AES92294.1| Protein VERNALIZATION INSENSITIVE [Medicago truncatula] Back     alignment and taxonomy information
>gi|449457169|ref|XP_004146321.1| PREDICTED: protein VERNALIZATION INSENSITIVE 3-like [Cucumis sativus] gi|449502927|ref|XP_004161782.1| PREDICTED: protein VERNALIZATION INSENSITIVE 3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224126067|ref|XP_002329653.1| predicted protein [Populus trichocarpa] gi|222870534|gb|EEF07665.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297735403|emb|CBI17843.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|380710177|gb|AFD98847.1| vernalization insensitive 3 [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|449507054|ref|XP_004162921.1| PREDICTED: protein VERNALIZATION INSENSITIVE 3-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query734
TAIR|locus:2173004620 VIN3 "VERNALIZATION INSENSITIV 0.441 0.522 0.495 1.9e-136
TAIR|locus:2128946714 VEL1 "vernalization5/VIN3-like 0.801 0.823 0.435 1.9e-115
TAIR|locus:2044405529 VEL2 "AT2G18880" [Arabidopsis 0.426 0.591 0.439 1e-103
TAIR|locus:2094859602 VRN5 "AT3G24440" [Arabidopsis 0.376 0.458 0.426 1.5e-81
TAIR|locus:2044500239 VEL3 "AT2G18870" [Arabidopsis 0.103 0.317 0.578 1.8e-18
TAIR|locus:20874031162 TTA2 "TITANIA 2" [Arabidopsis 0.193 0.122 0.246 1e-05
UNIPROTKB|Q84N38549 PVIP "OBERON-like protein" [Ni 0.123 0.165 0.294 0.00011
TAIR|locus:2173004 VIN3 "VERNALIZATION INSENSITIVE 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 809 (289.8 bits), Expect = 1.9e-136, Sum P(3) = 1.9e-136
 Identities = 175/353 (49%), Positives = 227/353 (64%)

Query:   139 IYCKNSACRATLRKEDVFCKRCSCCICRKYDDNKDPSLWLTCSSEPPFGGDSCGMSCHLE 198
             I C+N ACRA L  +D FC+RCSCCIC+K+DDNKDPSLWLTC        D+CG SCHLE
Sbjct:   128 ICCENLACRAALGCDDTFCRRCSCCICQKFDDNKDPSLWLTC--------DACGSSCHLE 179

Query:   199 CALKNERSGIGKDRCYSGLDGSFYCISCRKVNDLLGCWKKQLVVAKNTRRVDILCYRLSL 258
             C LK +R GIG D     LDG FYC  C K NDLLGCW+KQ+ VAK TRRVD+LCYRLSL
Sbjct:   180 CGLKQDRYGIGSD----DLDGRFYCAYCGKDNDLLGCWRKQVKVAKETRRVDVLCYRLSL 235

Query:   259 GQKLVNATEKYKNLSKIVDDAVKMLEDEVGPLTGLPVKMGRGIVNRLSSGPEVQKLCACA 318
             GQKL+  T KY+NL +++D+AVK LE +VGPL+G  +KM RGIVNRLSSG  VQKLC+ A
Sbjct:   236 GQKLLRGTTKYRNLLELMDEAVKKLEGDVGPLSGWAMKMARGIVNRLSSGVHVQKLCSQA 295

Query:   319 VESLDKMISNTILPNPSVQGSNVIVPNMVKFEDVRATSLTVVLGSEDPSPGN---IISYT 375
             +E+LDK++S    P+ SV G    +   V+ E+++A S+TV + SE+PS      I  + 
Sbjct:   296 MEALDKVVS----PSESVSGQGDKMT--VRVEEIQARSVTVRVDSEEPSSSTQNKITGFR 349

Query:   376 LWHRRAH-EGFPARPTCTLFAPNTRFVVTGLCPATEYQFKVVSSNGTTELGRCEIWFSTG 434
             L+ R++  E   ++  C ++ P T   + GL P TE+  +VVS N   +L   E+ F+T 
Sbjct:   350 LFCRKSKDEECSSQGNCVVYLPETTSAIQGLEPDTEFCLRVVSFNEEGDLDESELRFTT- 408

Query:   435 SSRDEVTNCSVIERSQSPATNCSS--LSNPSSVEDETNNVTPDRDPNDAQVNN 485
               +D+          QSP TN SS   SNPS  EDE+NNV       +   +N
Sbjct:   409 -LKDDGDEAG---DQQSPLTNSSSGLCSNPSLPEDESNNVNKSCSKGNGDKDN 457


GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA
GO:0009409 "response to cold" evidence=IEP
GO:0010048 "vernalization response" evidence=IEP
GO:0001666 "response to hypoxia" evidence=IMP
GO:0005515 "protein binding" evidence=IPI
TAIR|locus:2128946 VEL1 "vernalization5/VIN3-like 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2044405 VEL2 "AT2G18880" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094859 VRN5 "AT3G24440" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2044500 VEL3 "AT2G18870" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2087403 TTA2 "TITANIA 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q84N38 PVIP "OBERON-like protein" [Nicotiana benthamiana (taxid:4100)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
gw1.121.55.1
hypothetical protein (679 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query734
pfam07227446 pfam07227, DUF1423, Protein of unknown function (D 4e-07
cd0006393 cd00063, FN3, Fibronectin type 3 domain; One of th 5e-06
smart0006083 smart00060, FN3, Fibronectin type 3 domain 2e-04
pfam0004184 pfam00041, fn3, Fibronectin type III domain 2e-04
>gnl|CDD|219342 pfam07227, DUF1423, Protein of unknown function (DUF1423) Back     alignment and domain information
 Score = 52.8 bits (127), Expect = 4e-07
 Identities = 38/160 (23%), Positives = 68/160 (42%), Gaps = 26/160 (16%)

Query: 141 CKNSACRATLRKEDV----------FCKRCSCCICRKYDDNKDPSLWLTCSSEPPFGGDS 190
           C+N AC++ L  +D           FC  C C +C K+D   +   W+ C        D 
Sbjct: 100 CRNIACQSLLPVDDCDCKICSNKKGFCSLCMCVVCSKFDFAVNTCRWVGC--------DV 151

Query: 191 CGMSCHLECALKNE--RSGIGKDRCYSGLDGSFYCISCRKVNDLLGCWKKQLVV--AKNT 246
           C   CH +CA+++   R G          +  F+C +C   +++ G + K +    A N 
Sbjct: 152 CSHWCHTDCAIRDGLIRPGPSLKGGSGTTEMQFHCRACNHTSEMFG-FVKDVFQHCAPNW 210

Query: 247 RRVDILCYRLSLGQKLVNATE--KYKNLSKIVDDAVKMLE 284
            R + L   L   +K+   +E  + K L    ++ ++ L+
Sbjct: 211 DR-ETLIKELDFVRKIFRGSEDARGKKLFWKCEELIEKLK 249


This family represents a conserved region approximately 500 residues long within a number of Arabidopsis thaliana proteins of unknown function. Length = 446

>gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain Back     alignment and domain information
>gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 734
PF07227446 DUF1423: Protein of unknown function (DUF1423); In 100.0
PF0004185 fn3: Fibronectin type III domain; InterPro: IPR003 98.57
cd0006393 FN3 Fibronectin type 3 domain; One of three types 97.97
smart0006083 FN3 Fibronectin type 3 domain. One of three types 97.06
KOG4221 1381 consensus Receptor mediating netrin-dependent axon 95.67
PF09294106 Interfer-bind: Interferon-alpha/beta receptor, fib 95.55
KOG4221 1381 consensus Receptor mediating netrin-dependent axon 94.33
KOG35131051 consensus Neural cell adhesion molecule L1 [Signal 94.23
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 93.83
KOG0196 996 consensus Tyrosine kinase, EPH (ephrin) receptor f 93.24
KOG35131051 consensus Neural cell adhesion molecule L1 [Signal 85.22
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 84.69
PF0749843 Rho_N: Rho termination factor, N-terminal domain; 82.73
>PF07227 DUF1423: Protein of unknown function (DUF1423); InterPro: IPR004082 A total of 715 potential protein-coding genes have been identified in the nucleotide sequence of Arabidopsis thaliana chromosome 5, with an average gene density of 1 gene per 4001 bp [] Back     alignment and domain information
Probab=100.00  E-value=2.2e-52  Score=450.10  Aligned_cols=152  Identities=39%  Similarity=0.770  Sum_probs=143.2

Q ss_pred             CCCCCccccccCccccccccCCc----------CCcCCceeeeeccccCCCCCccEEecCCCCCCCCCcccchhhhhhhh
Q 004714          132 GSDLVNAIYCKNSACRATLRKED----------VFCKRCSCCICRKYDDNKDPSLWLTCSSEPPFGGDSCGMSCHLECAL  201 (734)
Q Consensus       132 ~~~~~~~~~C~N~aCra~L~~ed----------~FCr~CsC~IC~kfD~nkd~~~Wl~C~s~~~~~~~~Cgh~cHleCAL  201 (734)
                      =.++|.+.+|||+||||+||++|          |||++||||||+|||+|+|||+||+||        +||||||+||||
T Consensus        91 LveiFl~~rCrN~aC~s~LP~ddc~C~iC~~~~gFC~~C~C~iC~kfD~~~n~~~Wi~Cd--------~CgH~cH~dCAL  162 (446)
T PF07227_consen   91 LVEIFLYKRCRNLACRSQLPVDDCDCKICCSEPGFCRRCMCCICSKFDDNKNTCSWIGCD--------VCGHWCHLDCAL  162 (446)
T ss_pred             HHHHHHHHhcCCHHhhccCCccccCcchhcCCCCccccCCccccCCcccCCCCeeEEecc--------CCCceehhhhhc
Confidence            35689999999999999999976          999999999999999999999999998        999999999999


Q ss_pred             hcccccccc--CCCccccceeEEeccCCCccchhHHHHHHHHHhhccccchhhhhhhhchhhhccccHH--HHHHHHHHH
Q 004714          202 KNERSGIGK--DRCYSGLDGSFYCISCRKVNDLLGCWKKQLVVAKNTRRVDILCYRLSLGQKLVNATEK--YKNLSKIVD  277 (734)
Q Consensus       202 r~~~~G~~~--~g~~~~lD~~f~C~~Cgk~sdLlg~w~Kql~~ake~rrvD~Lc~rL~l~~kll~GS~~--~k~L~~~ve  277 (734)
                      |+++||+|.  .|+.+++||+|||++|||+|||||||+++|.+|+++||+|+||+||++++|||+||++  ||+||++++
T Consensus       163 r~~~i~~G~s~~g~~g~~d~~f~C~~C~~~seLlG~vk~vf~~ca~~~~~d~L~~eL~l~~rIf~GSed~rgk~L~~~~e  242 (446)
T PF07227_consen  163 RHELIGTGPSVKGSIGTLDMQFHCRACGKTSELLGFVKKVFQTCAKAWRVDVLCKELDLVRRIFRGSEDYRGKELHEKVE  242 (446)
T ss_pred             ccccccCCccCCCCCccCceEEEccCCCChhhHHHHHHHHHHHHHhhhhHHHHHHHHHHHHHHhhCccchhHHHHHHHHH
Confidence            999997765  4666889999999999999999999999999999999999999999999999999994  799999999


Q ss_pred             HHHHHhhhccCCCC
Q 004714          278 DAVKMLEDEVGPLT  291 (734)
Q Consensus       278 ~A~~KLe~evgpl~  291 (734)
                      +|++|||++++++.
T Consensus       243 ~al~KL~~~~~~~~  256 (446)
T PF07227_consen  243 EALAKLENGVIDSS  256 (446)
T ss_pred             HHHHHHhCCCCCHH
Confidence            99999999997653



Amongst the gene products is a well-conserved family of 130.7kDa proteins that share no sequence similarity with any other known proteins, other than in plants. The sequences are characterised by an N-terminal domain of variable length, a central cysteine-rich region and a relatively acidic C-terminal domain. The sequences may possess a PHD finger.

>PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] Back     alignment and domain information
>cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>smart00060 FN3 Fibronectin type 3 domain Back     alignment and domain information
>KOG4221 consensus Receptor mediating netrin-dependent axon guidance [Signal transduction mechanisms] Back     alignment and domain information
>PF09294 Interfer-bind: Interferon-alpha/beta receptor, fibronectin type III; InterPro: IPR015373 Members of this family adopt a secondary structure consisting of seven beta-strands arranged in an immunoglobulin-like beta-sandwich, in a Greek-key topology Back     alignment and domain information
>KOG4221 consensus Receptor mediating netrin-dependent axon guidance [Signal transduction mechanisms] Back     alignment and domain information
>KOG3513 consensus Neural cell adhesion molecule L1 [Signal transduction mechanisms] Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>KOG3513 consensus Neural cell adhesion molecule L1 [Signal transduction mechanisms] Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF07498 Rho_N: Rho termination factor, N-terminal domain; InterPro: IPR011112 The Rho termination factor disengages newly transcribed RNA from its DNA template at certain, specific transcripts Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query734
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 9e-10
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 1e-09
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 1e-09
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 2e-09
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 1e-08
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 2e-08
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 3e-08
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 3e-08
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 5e-08
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 6e-08
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 9e-08
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 1e-07
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 6e-07
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 9e-06
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 2e-07
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 2e-07
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 3e-06
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 2e-07
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 1e-06
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 5e-05
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 2e-07
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 3e-07
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 1e-05
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 3e-07
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 4e-07
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 1e-05
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 5e-07
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 5e-07
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 2e-06
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 2e-06
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 3e-05
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 6e-07
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 8e-07
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 1e-06
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 3e-06
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 1e-05
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 2e-06
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 3e-06
3k2m_C101 Monobody HA4; engineered binding protein, antibody 3e-06
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 4e-06
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 4e-06
3t04_D103 Monobody 7C12; engineered binding protein, antibod 5e-06
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 5e-06
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 6e-06
1x4x_A106 Fibronectin type-III domain containing protein 3A; 7e-06
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 8e-06
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 8e-06
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 8e-06
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 1e-05
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 1e-05
1x3d_A118 Fibronectin type-III domain containing protein 3A; 1e-05
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 2e-05
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 4e-05
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 2e-05
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 2e-05
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 2e-05
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 9e-05
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 2e-05
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 3e-05
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 1e-04
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 3e-05
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 3e-05
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 3e-05
1x5x_A109 Fibronectin type-III domain containing protein 3A; 3e-05
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 4e-05
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 5e-05
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 6e-05
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 7e-05
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 8e-05
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 9e-05
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 1e-04
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 1e-04
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 1e-04
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 1e-04
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 1e-04
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 2e-04
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 2e-04
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 2e-04
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 3e-04
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 3e-04
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 3e-04
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 4e-04
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 4e-04
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 4e-04
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 5e-04
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 7e-04
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 9e-04
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 Back     alignment and structure
 Score = 55.5 bits (134), Expect = 9e-10
 Identities = 21/94 (22%), Positives = 34/94 (36%), Gaps = 4/94 (4%)

Query: 344 PNMVKFEDVRATSLTVVLGSEDPSPGNIISYTLWHRRAHEGFPARPTCTLFAPNTRFVVT 403
           P  +K  ++  T+  V   +  P    I    +             T  L +  T   +T
Sbjct: 5   PFNIKVTNITLTTAVV---TWQPPILPIEGILV-TFGRKNDPSDETTVDLTSSITSLTLT 60

Query: 404 GLCPATEYQFKVVSSNGTTELGRCEIWFSTGSSR 437
            L P T Y+ ++V+ NG          F+TGS  
Sbjct: 61  NLEPNTTYEIRIVARNGQQYSPPVSTTFTTGSLE 94


>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Length = 95 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 127 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query734
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 98.72
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 98.71
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 98.7
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 98.64
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 98.64
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 98.63
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 98.63
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 98.58
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 98.56
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 98.55
3t04_D103 Monobody 7C12; engineered binding protein, antibod 98.54
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 98.53
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 98.52
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 98.49
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 98.49
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 98.48
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 98.46
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 98.45
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 98.45
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 98.44
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 98.44
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 98.42
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 98.42
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 98.41
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 98.41
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 98.41
3k2m_C101 Monobody HA4; engineered binding protein, antibody 98.4
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 98.4
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 98.39
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 98.39
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 98.38
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 98.36
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 98.36
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 98.35
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 98.35
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 98.35
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 98.34
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 98.32
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 98.32
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 98.3
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 98.29
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 98.26
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 98.26
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 98.26
1x4x_A106 Fibronectin type-III domain containing protein 3A; 98.24
1x5x_A109 Fibronectin type-III domain containing protein 3A; 98.23
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 98.23
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 98.21
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 98.19
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 98.17
1x3d_A118 Fibronectin type-III domain containing protein 3A; 98.17
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 98.16
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 98.16
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 98.16
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 98.15
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 98.14
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 98.13
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 98.12
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 98.11
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 98.09
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 98.09
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 98.08
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 98.08
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 98.04
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 98.03
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 98.02
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 98.02
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 98.01
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 98.01
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 98.01
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 98.0
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 98.0
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 97.99
2crz_A110 Fibronectin type-III domain containing protein 3A; 97.98
2crm_A120 Fibronectin type-III domain containing protein 3A; 97.98
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 97.97
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 97.97
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 97.92
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 97.92
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 97.89
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 97.88
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 97.88
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 97.85
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 97.84
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 97.83
1k85_A88 Chitinase A1; fibronectin type III domain, chitin 97.82
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 97.82
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 97.81
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 97.81
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 97.8
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 97.8
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 97.78
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 97.78
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 97.78
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 97.76
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 97.75
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 97.74
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 97.74
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 97.68
3csg_A461 MBP, maltose-binding protein monobody YS1 fusion, 97.67
2dle_A104 Receptor-type tyrosine-protein phosphatase ETA; pr 97.65
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 97.64
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 97.59
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 97.57
4go6_B232 HCF C-terminal chain 1; tandem fibronectin repeat, 97.52
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 97.51
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 97.5
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 97.42
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 97.34
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 97.33
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 97.32
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 97.31
1uc6_A109 CNTF receptor, ciliary neurotrophic factor recepto 97.3
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 97.27
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 97.13
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 97.03
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 97.01
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 97.01
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 96.99
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 96.97
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 96.95
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 96.92
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 96.8
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 96.62
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 96.61
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 96.59
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 96.46
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 96.36
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 96.34
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 96.14
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 96.13
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 96.11
1eer_B227 Epobp, erythropoietin receptor; signal transductio 96.09
4doh_B206 Interleukin-20 receptor subunit beta; IL10 family 96.08
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 95.87
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 95.86
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 95.52
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 95.45
3mpc_A103 FN3-like protein; fibronectin, FN(III), unknown fu 95.09
2gys_A419 Cytokine receptor common beta chain; dimer of inte 95.01
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 94.98
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 94.93
4go6_B232 HCF C-terminal chain 1; tandem fibronectin repeat, 94.79
4doh_R221 Interleukin-20 receptor subunit alpha; IL10 family 94.59
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 94.52
1axi_B236 HGHBP, growth hormone receptor; complex (hormone-r 94.35
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 93.67
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 93.43
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 93.27
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 93.2
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 92.81
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 92.74
3g9v_A211 Interleukin 22 receptor, alpha 2; cytokine, cytoki 92.63
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 92.59
2k16_A75 Transcription initiation factor TFIID subunit 3; p 91.4
3g9v_A211 Interleukin 22 receptor, alpha 2; cytokine, cytoki 89.92
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 89.2
2gys_A419 Cytokine receptor common beta chain; dimer of inte 88.9
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 86.9
1we9_A64 PHD finger family protein; structural genomics, PH 86.68
2erj_C247 Cytokine receptor common gamma chain; immune syste 86.38
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 85.73
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 84.69
1wee_A72 PHD finger family protein; structural genomics, PH 83.8
3dlq_R211 Interleukin-22 receptor subunit alpha-1; cytokine- 82.92
1wew_A78 DNA-binding family protein; structural genomics, P 81.66
3o70_A68 PHD finger protein 13; PHF13, structural genomics 81.64
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Back     alignment and structure
Probab=98.72  E-value=5.1e-08  Score=83.36  Aligned_cols=91  Identities=23%  Similarity=0.244  Sum_probs=72.0

Q ss_pred             cCceEEEEEeeceeEEEEeCcCCCCCCCcceEEEEeeecCCC-CCCCCceeeecCCceeEeecCCcceeeeEEEEeccCC
Q 004714          343 VPNMVKFEDVRATSLTVVLGSEDPSPGNIISYTLWHRRAHEG-FPARPTCTLFAPNTRFVVTGLCPATEYQFKVVSSNGT  421 (734)
Q Consensus       343 ~~~~~rFE~vt~tSv~vvL~~~~~s~~~i~Gy~LWhrks~~~-y~~ept~~~~~p~~r~~vs~L~P~TEY~fkvvsF~~~  421 (734)
                      ++..+++.+++++||+|-+....   ..|.||.|+|+..... ...  ...+....+.+.|.||.|.|+|.|+|.+++..
T Consensus         4 ~P~~l~~~~~~~~sv~lsW~pP~---~~i~~Y~v~y~~~~~~~~~~--~~~~~~~~t~~~i~~L~p~t~Y~~~V~A~n~~   78 (100)
T 3b83_A            4 PPFNIKVTNITLTTAVVTWQPPI---LPIEGILVTFGRKNDPSDET--TVDLTSSITSLTLTNLEPNTTYEIRIVARNGQ   78 (100)
T ss_dssp             CCEEEEEESCCSSCEEEEEECCS---SCCSEEEEEEEESSCTTTCE--EEEECTTEEEEEECSCCTTCEEEEEEEEEETT
T ss_pred             cCCccEEEEecCCEEEEEEcCCc---ccCCEEEEEEEECCCCCCce--EEEECCcceEEEECCCCCCCEEEEEEEEEeCC
Confidence            44568999999999999986553   3699999999977543 211  23466788999999999999999999999999


Q ss_pred             ccCcceeeEEecCcccc
Q 004714          422 TELGRCEIWFSTGSSRD  438 (734)
Q Consensus       422 ~elg~~E~k~~T~s~e~  438 (734)
                      |.=-.......|...+.
T Consensus        79 g~s~p~~~~~~~~~~~~   95 (100)
T 3b83_A           79 QYSPPVSTTFTTGSLEH   95 (100)
T ss_dssp             EECCCEEEEEECCCCCC
T ss_pred             CCCCCEEEEEEEEeeec
Confidence            87667777777765543



>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} SCOP: b.1.2.1 PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Back     alignment and structure
>1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Back     alignment and structure
>3csg_A MBP, maltose-binding protein monobody YS1 fusion, MMBP; engineered binding protein, antibody mimic, synthetic protein interface; 1.80A {Escherichia coli} PDB: 2obg_A 3csb_A* 3a3c_A* 3d4g_A* 3d4c_A* 3ef7_A* Back     alignment and structure
>2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B Back     alignment and structure
>4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Back     alignment and structure
>1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Back     alignment and structure
>4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Back     alignment and structure
>3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Back     alignment and structure
>4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Back     alignment and structure
>1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Back     alignment and structure
>3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 734
d2cuma193 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) 1e-07
d1tdqa292 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicu 2e-07
d1fnfa389 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m 3e-07
d1qr4a288 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallu 7e-07
d1x5la198 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human 9e-07
d1fnaa_91 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 2e-06
d1tdqa193 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) 2e-06
d1wfoa1117 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) 4e-06
d1x5za1102 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p 5e-06
d1x5xa196 b.1.2.1 (A:8-103) Fibronectin type-III domain cont 1e-05
d1j8ka_94 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 1e-05
d1uena_125 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 2e-05
d1fnha389 b.1.2.1 (A:183-271) Fibronectin, different Fn3 mod 2e-05
d1qr4a187 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) 3e-05
d1va9a1109 b.1.2.1 (A:8-116) Down syndrome cell adhesion mole 3e-05
d1tdqa386 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegic 4e-05
d1x4za1108 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { 5e-05
d1x5ka1111 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ 5e-05
d1x5fa1107 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ 5e-05
d1fnfa194 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 m 6e-05
d1x5ga1103 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ 6e-05
d1ueya_127 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 8e-05
d1x4ya1101 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) { 9e-05
d1x5ha1119 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ 1e-04
d1bpva_104 b.1.2.1 (A:) Type I titin module {Human (Homo sapi 1e-04
d2dn7a194 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p 2e-04
d1fnfa291 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 m 2e-04
d1cfba2105 b.1.2.1 (A:710-814) Neuroglian, two amino proximal 2e-04
d1wisa1111 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) 3e-04
d1fnha190 b.1.2.1 (A:3-92) Fibronectin, different Fn3 module 4e-04
d1wfna1106 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) 4e-04
d2ibga195 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit 4e-04
d1fnha290 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modu 6e-04
d1x5ja1100 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [ 7e-04
d1cfba1100 b.1.2.1 (A:610-709) Neuroglian, two amino proximal 7e-04
d2dtge2196 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo 8e-04
d1iarb2101 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha ch 0.001
d1tena_90 b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId 0.001
d1wf5a1108 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) 0.001
d3d48r2104 b.1.2.1 (R:101-204) Prolactin receptor {Human (Hom 0.001
d1x5ya198 b.1.2.1 (A:8-105) Myosin binding protein C, fast-t 0.002
d1uc6a_109 b.1.2.1 (A:) Ciliary neurotrophic factor receptor 0.002
d1uema_117 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 0.002
d1owwa_93 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 0.003
d2ic2a1107 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit 0.003
d1k85a_88 b.1.2.1 (A:) Fibronectin type III domain from chit 0.004
d2b5ib2104 b.1.2.1 (B:104-207) Interleukin-2 receptor beta ch 0.004
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure

class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Fibronectin type III
family: Fibronectin type III
domain: Tenascin-X
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 48.3 bits (114), Expect = 1e-07
 Identities = 18/94 (19%), Positives = 31/94 (32%), Gaps = 6/94 (6%)

Query: 344 PNMVKFEDVRATSLTVVLGSEDPSPGNIISYTLWHRRAHEGFPARPTCTLFAPNTRFVVT 403
           P  ++ ++V   +  +        P     Y L                L    T   + 
Sbjct: 5   PRDLEAKEVTPRTALLTW---TEPPVRPAGYLLSFHTPGGQTQ---EILLPGGITSHQLL 58

Query: 404 GLCPATEYQFKVVSSNGTTELGRCEIWFSTGSSR 437
           GL P+T Y  ++ +  G + L      F+TG  R
Sbjct: 59  GLFPSTSYNARLQAMWGQSLLPPVSTSFTTGGLR 92


>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 88 Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 87 Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 127 Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 105 Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 95 Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 100 Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 107 Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Length = 88 Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query734
d2ibga195 Hedgehog receptor iHog {Fruit fly (Drosophila mela 98.92
d2fnba_95 Fibronectin, different Fn3 modules {Human (Homo sa 98.89
d1fnha389 Fibronectin, different Fn3 modules {Human (Homo sa 98.84
d1tdqa292 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 98.84
d1qr4a288 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 98.83
d1tena_90 Tenascin {Human (Homo sapiens) [TaxId: 9606]} 98.81
d1fnfa389 Fibronectin, different Fn3 modules {Human (Homo sa 98.79
d1fnfa291 Fibronectin, different Fn3 modules {Human (Homo sa 98.77
d1qr4a187 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 98.77
d1j8ka_94 Fibronectin, different Fn3 modules {Human (Homo sa 98.76
d2cuma193 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 98.75
d1fnha290 Fibronectin, different Fn3 modules {Human (Homo sa 98.71
d1fnha190 Fibronectin, different Fn3 modules {Human (Homo sa 98.68
d2dn7a194 Receptor-type tyrosine-protein phosphatase F, PTPR 98.67
d2djsa195 Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta 98.65
d2vkwa293 Neural cell adhesion molecule 1, NCAM {Human (Homo 98.61
d1fnaa_91 Fibronectin, different Fn3 modules {Human (Homo sa 98.61
d1x5ga1103 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 98.59
d1fnfa194 Fibronectin, different Fn3 modules {Human (Homo sa 98.59
d1wfoa1117 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 98.59
d1ujta_120 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 98.55
d1x5la198 Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta 98.54
d1qg3a192 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 98.53
d1x5za1102 Receptor-type tyrosine-protein phosphatase delta, 98.52
d1x4ya1101 Brother of CDO precursor (BOC) {Mouse (Mus musculu 98.52
d1wfna1106 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 98.51
d1x5fa1107 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 98.5
d2cuha1102 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 98.45
d1tdqa193 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 98.45
d1tdqa386 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 98.42
d1x5ka1111 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 98.4
d1x5xa196 Fibronectin type-III domain containing protein 3a, 98.38
d1uema_117 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 98.38
d2b5ib2104 Interleukin-2 receptor beta chain {Human (Homo sap 98.38
d1x5aa194 Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta 98.36
d1qg3a2103 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 98.35
d1x4za1108 Brother of CDO precursor (BOC) {Mouse (Mus musculu 98.33
d1x5ja1100 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 98.33
d1cfba1100 Neuroglian, two amino proximal Fn3 repeats {Drosop 98.31
d1x5ha1119 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 98.31
d2haza1101 Neural cell adhesion molecule 1, NCAM {Human (Homo 98.29
d1wf5a1108 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 98.29
d1bpva_104 Type I titin module {Human (Homo sapiens) [TaxId: 98.27
d1wfta_123 Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T 98.26
d2dtge3125 Insulin receptor {Human (Homo sapiens) [TaxId: 960 98.25
d1x3da1105 Fibronectin type-III domain containing protein 3a, 98.25
d1x5ya198 Myosin binding protein C, fast-type {Mouse (Mus mu 98.22
d1x4xa193 Fibronectin type-III domain containing protein 3a, 98.22
d2cuia1101 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 98.2
d1wfua_120 Fibronectin type 3 and ankyrin repeat domains 1 pr 98.2
d1va9a1109 Down syndrome cell adhesion molecule-like protein 98.19
d1cfba2105 Neuroglian, two amino proximal Fn3 repeats {Drosop 98.19
d1v5ja_108 KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} 98.17
d1wisa1111 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 98.15
d1ueya_127 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 98.14
d2crza197 Fibronectin type-III domain containing protein 3a, 98.1
d1k85a_88 Fibronectin type III domain from chitinase A1. {Ba 98.08
d1owwa_93 Fibronectin, different Fn3 modules {Human (Homo sa 98.07
d2ic2a1107 Hedgehog receptor iHog {Fruit fly (Drosophila mela 98.06
d1x5ia1113 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 98.05
d2crma1107 Fibronectin type-III domain containing protein 3a, 98.03
d1bqua2115 Cytokine receptor gp130 cytokine-binding domains { 97.98
d2d9qb2105 Granulocyte colony-stimulating factor (GC-SF) rece 97.96
d1uena_125 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 97.87
d1wk0a_137 Fibronectin type-III domain containing protein 3a, 97.86
d1wj3a_117 Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI 97.77
d3d48r2104 Prolactin receptor {Human (Homo sapiens) [TaxId: 9 97.76
d1cd9b2106 Granulocyte colony-stimulating factor (GC-SF) rece 97.76
d1iarb2101 Interleukin-4 receptor alpha chain {Human (Homo sa 97.73
d1bqua195 Cytokine receptor gp130 cytokine-binding domains { 97.68
d2dtge1102 Insulin receptor {Human (Homo sapiens) [TaxId: 960 97.62
d1cd9b1107 Granulocyte colony-stimulating factor (GC-SF) rece 97.53
d1n26a3104 Interleukin-6 receptor alpha chain, domains 2 and 97.51
d2gysa4100 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 97.4
d1f6fb2103 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 97.39
d2b5ic195 Cytokine receptor common gamma chain {Human (Homo 97.24
d1erna2105 Erythropoietin (EPO) receptor {Human (Homo sapiens 97.06
d1axib2106 Growth hormone receptor {Human (Homo sapiens) [Tax 96.85
d1uc6a_109 Ciliary neurotrophic factor receptor alpha {Human 96.83
d2gysa2114 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 96.74
d2cspa1117 Rim binding protein 2 {Human (Homo sapiens) [TaxId 96.12
d1fyhb198 Interferon-gamma receptor alpha chain {Human (Homo 96.07
d2dtge2196 Insulin receptor {Human (Homo sapiens) [TaxId: 960 95.74
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 93.73
d2dtge2196 Insulin receptor {Human (Homo sapiens) [TaxId: 960 93.7
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 93.59
d1y6kr199 Interleukin-10 receptor 1, IL-10R1 {Human (Homo sa 93.07
d2c4fu1116 Extracellular region of human tissue factor {Human 90.83
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 88.91
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 87.11
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 82.53
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 81.77
d1xzwa1119 Purple acid phosphatase, N-terminal domain {Sweet 80.95
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Fibronectin type III
family: Fibronectin type III
domain: Hedgehog receptor iHog
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]
Probab=98.92  E-value=7.4e-10  Score=91.55  Aligned_cols=84  Identities=19%  Similarity=0.202  Sum_probs=64.5

Q ss_pred             CcccCceEEEEEeeceeEEEEeCcCCC-CCCCcceEEEEeeecCCCCCCCCceeeecCCceeEeecCCcceeeeEEEEec
Q 004714          340 NVIVPNMVKFEDVRATSLTVVLGSEDP-SPGNIISYTLWHRRAHEGFPARPTCTLFAPNTRFVVTGLCPATEYQFKVVSS  418 (734)
Q Consensus       340 ~l~~~~~~rFE~vt~tSv~vvL~~~~~-s~~~i~Gy~LWhrks~~~y~~ept~~~~~p~~r~~vs~L~P~TEY~fkvvsF  418 (734)
                      .++++..++++.++++||.|.++.... ....|.||+|+||.....-...-..+.....+.++|+||.|.|.|.|||.+|
T Consensus         6 P~~~P~~~~v~~~s~tsv~l~W~~P~~~~~~~i~gY~i~y~~~~~~~~~~~~~~~~~~~~~~~i~~L~p~t~Y~~~V~A~   85 (95)
T d2ibga1           6 PMPVPELLEIEEYSETAVVLHWSLASDADEHLITGYYAYYRPSSSAGEYFKATIEGAHARSFKIAPLETATMYEFKLQSF   85 (95)
T ss_dssp             CCCCCEECCCBCCSSSCEEEEEECCTTCCGGGCCEEEEEEEETTCCSCCEEEEEECTTCCEEEECSCCTTCEEEEEEEEE
T ss_pred             CCCCCcCeEEEEeCCCEEEEEEEeeeeccCCcccccceeEeeeeecceeeeeeccCCceeEEEEeeccCCeEEEEEEEEE
Confidence            345566789999999999999986543 4566999999999876541111112334567889999999999999999999


Q ss_pred             cCCcc
Q 004714          419 NGTTE  423 (734)
Q Consensus       419 ~~~~e  423 (734)
                      ++.|+
T Consensus        86 n~~G~   90 (95)
T d2ibga1          86 SAASA   90 (95)
T ss_dssp             CSSCB
T ss_pred             eCCcc
Confidence            99874



>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fu1 b.1.2.1 (U:91-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xzwa1 b.1.12.1 (A:1-119) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]} Back     information, alignment and structure