Citrus Sinensis ID: 004812


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------73
MPGIIMDDIHEEGVVSELNGNSTPVKENSVSNKSPKSTPCPQSPRDQPDGEGVDTSIEQLYENVCDMQSSDQSPSRHSFGSDGEESRIDSELRHLVGGEMREVEIMEEEEVEKPEDDSHSISSSKKGSSSGSKKSGKLEKSQSAGTKSISSGHSKKVSHSGMDSEVSSKTNSKGKSLPEKPPIDKGVKKSNAGATPMKKRKGKLHKGQDVSEAGLDKPGLGPLLLKQARELISSGDNPQKALELALRAAKSFEIGANGKPSLELVMCLHVIAAIYCSLGQYNEAIPVLEQSIEIPVIEEGQEHALAKFAGHMQLGDTYAMLGQLENSLMCYTTGLEVQKQVLGETDPRVGETCRYLAEAHVQALQFSEAQKFCQMALDIHKDNGSPASLEEAADRRLMGLICETKGDHEAALEHLVLASMTMIANDQDAEVASVDCSIGDTYLSLSRYDEAGFAYQKALTAFKTNKGENHPAVASVFVRLADMYNRTGKLRESKSYCENALRIYEKPVPGVPPEEIASGLTDVSSIYESMNELEQAIKLLQKALKIYNDAPGQQSTVAGIEAQMGVMYYMLGNYSDSYDSFKNAISKLRAIGERKSAFFGVALNQMGLACVQRYSINEAVELFEEARSILEQECGPYHPDTLGVYSNLAGTYDAIGRLDDAIEILEFVVGIREEKLGTANPDVDDEKRRLAELLKEAGRVRSRKAQSLETLLDANSRVNNDGIELCYGT
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHcccccHHHHcccHHHHHHHHHHccccccccccccccccHHHHHHHHHccccccccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccccccccc
cccEEEccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccHHHHHHHccccccEEEEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHcccccccccccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccHHHHcccHHHHHHcc
mpgiimddiheegvvselngnstpvkensvsnkspkstpcpqsprdqpdgegvdTSIEQLYENVcdmqssdqspsrhsfgsdgeesriDSELRHlvggemreveimeeeevekpeddshsissskkgsssgskksgkleksqsagtksissghskkvshsgmdsevssktnskgkslpekppidkgvkksnagatpmkkrkgklhkgqdvseagldkpglgpLLLKQARELISSGDNPQKALELALRAAKSfeigangkpsLELVMCLHVIAAIYCSlgqyneaipvleqsieipvieeGQEHALAKFAGHMQLGDTYAMLGQLENSLMCYTTGLEVQkqvlgetdprvGETCRYLAEAHVQALQFSEAQKFCQMALDIhkdngspaslEEAADRRLMGLICETKGDHEAALEHLVLASMTMIAndqdaevasvdcsigdtylslsrydEAGFAYQKALTAFktnkgenhpaVASVFVRLADMYNrtgklreskSYCENALRiyekpvpgvppeeiasgltdVSSIYESMNELEQAIKLLQKALKIyndapgqqstvAGIEAQMGVMYYMLGNYSDSYDSFKNAISKLRAIGERKSAFFGVALNQMGLACVQRYSINEAVELFEEARSILEqecgpyhpdtlgvysnLAGTYDAIGRLDDAIEILEFVVGIREeklgtanpdvdDEKRRLAELLKEAGRVRSRKAQSLETLLDANsrvnndgielcygt
mpgiimddihEEGVVSelngnstpvkensvsnkspkstpcpqsprdqpdGEGVDTSIEQLYENVCDMQSSDQSPSRhsfgsdgeesridsELRHLVGGEMREVEIMEeeevekpeddshsissskkgsssgskksgkleksqsagtksissghskkvshsgmdsevssktnskgkslpekppidkgvkksnagatpmkkrkgklhkgqdvseagldkpgLGPLLLKQARELISSGDNPQKALELALRAAKSFEIGANGKPSLELVMCLHVIAAIYCSLGQYNEAIPVLEQSIEIPVIEEGQEHALAKFAGHMQLGDTYAMLGQLENSLMCYTTGLEVQKQVLGETDPRVGETCRYLAEAHVQALQFSEAQKFCQMALDIHKDNGSPASLEEAADRRLMGLICETKGDHEAALEHLVLASMTMIANDQDAEVASVDCSIGDTYLSLSRYDEAGFAYQKALTAfktnkgenhpAVASVFVRLADMYNRtgklresksyCENALRIyekpvpgvppeEIASGLTDVSSIYESMNELEQAIKLLQKALKIYNDAPGQQSTVAGIEAQMGVMYYMLGNYSDSYDSFKNAISKLRAIGERKSAFFGVALNQMGLACVQRYSINEAVELFEEARSILEQECGPYHPDTLGVYSNLAGTYDAIGRLDDAIEILEFVVGIReeklgtanpdvddeKRRLAELLKeagrvrsrkaqsletlldansrvnndgielcygt
MPGIIMDDIHEEGVVSELNGNSTPVKENSVSNKSPKSTPCPQSPRDQPDGEGVDTSIEQLYENVCDMQSSDQSPSRHSFGSDGEESRIDSELRHLVGGemreveimeeeevekpeDDshsissskkgsssgskksgkleksqsAGTksissghskkvshsgMDSEVSSKTNSKGKSLPEKPPIDKGVKKSNAGATPMKKRKGKLHKGQDVSEAgldkpglgplllkQARELISSGDNPQKALELALRAAKSFEIGANGKPSLELVMCLHVIAAIYCSLGQYNEAIPVLEQSIEIPVIEEGQEHALAKFAGHMQLGDTYAMLGQLENSLMCYTTGLEVQKQVLGETDPRVGETCRYLAEAHVQALQFSEAQKFCQMALDIHKDNGSPASLEEAADRRLMGLICETKGDHEAALEHLVLASMTMIANDQDAEVASVDCSIGDTYLSLSRYDEAGFAYQKALTAFKTNKGENHPAVASVFVRLADMYNRTGKLRESKSYCENALRIYEKPVPGVPPEEIASGLTDVSSIYESMNELEQAIKLLQKALKIYNDAPGQQSTVAGIEAQMGVMYYMLGNYSDSYDSFKNAISKLRAIGERKSAFFGVALNQMGLACVQRYSINEAVELFEEARSILEQECGPYHPDTLGVYSNLAGTYDAIGRLDDAIEILEFVVGIREEKLGTANPDVDDEKRRLAELLKEAGRVRSRKAQSLETLLDANSRVNNDGIELCYGT
***************************************************************************************************************************************************************************************************************************************************LALRAAKSFEIGANGKPSLELVMCLHVIAAIYCSLGQYNEAIPVLEQSIEIPVIEEGQEHALAKFAGHMQLGDTYAMLGQLENSLMCYTTGLEVQKQVLGETDPRVGETCRYLAEAHVQALQFSEAQKFCQMALDIH**************RRLMGLICETKGDHEAALEHLVLASMTMIANDQDAEVASVDCSIGDTYLSLSRYDEAGFAYQKALTAFKTNKGENHPAVASVFVRLADMYNRTGKLRESKSYCENALRIYEKPVPGV****IASGLTDVSSIYESMNELEQAIKLLQKALKIYNDAPGQQSTVAGIEAQMGVMYYMLGNYSDSYDSFKNAISKLRAIGERKSAFFGVALNQMGLACVQRYSINEAVELFEEARSILEQECGPYHPDTLGVYSNLAGTYDAIGRLDDAIEILEFVVGIREE*******************************************************
*PGI****I************************************************EQLYE***********************SRIDSELRHLVGGEMREV***********************GSSSGSKKSGKLE*******************************N*****LPEKPPIDKGVKKSNAGATPMKKRKGKLHKGQDVSEAGLDKPGLGPLLLKQARELISSGDNPQKALELALRAAKSFEIGANGKPSLELVMCLHVIAAIYCSLGQYNEAIPVLEQSIEIPVIEEGQEHALAKFAGHMQLGDTYAMLGQLENSLMCYTTGLEVQKQVLGETDPRVGETCRYLAEAHVQALQFSEAQKFCQMALDIHKDNGSPASLEEAADRRLMGLICETKGDHEAALEHLVLASMTMIANDQDAEVASVDCSIGDTYLSLSRYDEAGFAYQKALTAFKTNKGENHPAVASVFVRLADMYNRTGKLRESKSYCENALRIYEKPVPGVPPEEIASGLTDVSSIYESMNELEQAIKLLQKALKIYNDAPGQQSTVAGIEAQMGVMYYMLGNYSDSYDSFKNAISKLRAIGERKSAFFGVALNQMGLACVQRYSINEAVELFEEARSILEQECGPYHPDTLGVYSNLAGTYDAIGRLDDAIEILEFVVGIREEKLGTANPDVDDEKRRLAELLKEAGRVRSRKAQSLETLLDANS**NNDG****YG*
MPGIIMDDIHEEGVVSELNGN******************************GVDTSIEQLYENVC***********************DSELRHLVGGEMREVEIM*************************************************************************KPPIDKG*************************EAGLDKPGLGPLLLKQARELISSGDNPQKALELALRAAKSFEIGANGKPSLELVMCLHVIAAIYCSLGQYNEAIPVLEQSIEIPVIEEGQEHALAKFAGHMQLGDTYAMLGQLENSLMCYTTGLEVQKQVLGETDPRVGETCRYLAEAHVQALQFSEAQKFCQMALDIHKDNGSPASLEEAADRRLMGLICETKGDHEAALEHLVLASMTMIANDQDAEVASVDCSIGDTYLSLSRYDEAGFAYQKALTAFKTNKGENHPAVASVFVRLADMYNRTGKLRESKSYCENALRIYEKPVPGVPPEEIASGLTDVSSIYESMNELEQAIKLLQKALKIYNDAPGQQSTVAGIEAQMGVMYYMLGNYSDSYDSFKNAISKLRAIGERKSAFFGVALNQMGLACVQRYSINEAVELFEEARSILEQECGPYHPDTLGVYSNLAGTYDAIGRLDDAIEILEFVVGIREEKLGTANPDVDDEKRRLAELLKEAGRVRSRKAQSLETLLDANSRVNNDGIELCYGT
********IHE***********************************QPDGEGVDTSIEQLYENVCDMQ******************RIDSELRHLVGGEMREVEIMEEEEVEK****************************************************************************************************GLDKPGLGPLLLKQARELISSGDNPQKALELALRAAKSFEIGANGKPSLELVMCLHVIAAIYCSLGQYNEAIPVLEQSIEIPVIEEGQEHALAKFAGHMQLGDTYAMLGQLENSLMCYTTGLEVQKQVLGETDPRVGETCRYLAEAHVQALQFSEAQKFCQMALDIHKDNGSPASLEEAADRRLMGLICETKGDHEAALEHLVLASMTMIANDQDAEVASVDCSIGDTYLSLSRYDEAGFAYQKALTAFKTNKGENHPAVASVFVRLADMYNRTGKLRESKSYCENALRIYEKPVPGVPPEEIASGLTDVSSIYESMNELEQAIKLLQKALKIYNDAPGQQSTVAGIEAQMGVMYYMLGNYSDSYDSFKNAISKLRAIGERKSAFFGVALNQMGLACVQRYSINEAVELFEEARSILEQECGPYHPDTLGVYSNLAGTYDAIGRLDDAIEILEFVVGIREEKLGTANPDVDDEKRRLAELLKEAGRVRSRKAQSLETLLDANSRVNNDGIELCYGT
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPGIIMDDIHEEGVVSELNGNSTPVKENSVSNKSPKSTPCPQSPRDQPDGEGVDTSIEQLYENVCDMQSSDQSPSRHSFGSDGEESRIDSELRHLVGGEMREVEIMEEEEVEKPEDDSHSISSSKKGSSSGSKKSGKLEKSQSAGTKSISSGHSKKVSHSGMDSEVSSKTNSKGKSLPEKPPIDKGVKKSNAGATPMKKRKGKLHKGQDVSEAGLDKPGLGPLLLKQARELISSGDNPQKALELALRAAKSFEIGANGKPSLELVMCLHVIAAIYCSLGQYNEAIPVLEQSIEIPVIEEGQEHALAKFAGHMQLGDTYAMLGQLENSLMCYTTGLEVQKQVLGETDPRVGETCRYLAEAHVQALQFSEAQKFCQMALDIHKDNGSPASLEEAADRRLMGLICETKGDHEAALEHLVLASMTMIANDQDAEVASVDCSIGDTYLSLSRYDEAGFAYQKALTAFKTNKGENHPAVASVFVRLADMYNRTGKLRESKSYCENALRIYEKPVPGVPPEEIASGLTDxxxxxxxxxxxxxxxxxxxxxxxxxxxxPGQQSTVAGIEAQMGVMYYMLGNYSDSYDSFKNAISKLRAIGERKSAFFGVALNQMGLACVQRYSINEAVELFEEARSILEQECGPYHPDTLGVYSNLAGTYDAIGRLDDAIEILEFVVGIREEKLGTANPDxxxxxxxxxxxxxxxxxxxxxKAQSLETLLDANSRVNNDGIELCYGT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query729 2.2.26 [Sep-21-2011]
Q7Z4941330 Nephrocystin-3 OS=Homo sa yes no 0.334 0.183 0.240 7e-14
A0JM231311 Nephrocystin-3 OS=Xenopus yes no 0.337 0.187 0.232 9e-13
Q7TNH61325 Nephrocystin-3 OS=Mus mus yes no 0.334 0.184 0.229 6e-12
Q6AZT71300 Nephrocystin-3 OS=Xenopus N/A no 0.358 0.200 0.226 2e-11
Q5PQM2619 Kinesin light chain 4 OS= no no 0.215 0.253 0.276 1e-10
Q9DBS5619 Kinesin light chain 4 OS= no no 0.213 0.252 0.278 3e-10
P46822540 Kinesin light chain OS=Ca no no 0.322 0.435 0.254 3e-10
Q9NSK0619 Kinesin light chain 4 OS= no no 0.215 0.253 0.270 6e-10
P0CI651303 Nephrocystin-3 OS=Danio r yes no 0.355 0.198 0.229 7e-10
Q2HJJ0616 Kinesin light chain 4 OS= no no 0.213 0.253 0.265 9e-10
>sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 Back     alignment and function desciption
 Score = 79.7 bits (195), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 67/279 (24%), Positives = 118/279 (42%), Gaps = 35/279 (12%)

Query: 438  IGDTYLSLSRY-------DEAGFAYQKALTAFKTNKGENHPAVASVFVRLADMYNRTGKL 490
            + D Y +L R+        +A    Q++L   +T    +HP VA    +LA +Y +  K 
Sbjct: 942  LADLYETLGRFLKDLGLLSQAIVPLQRSLEIRETALDPDHPRVAQSLHQLASVYVQWKKF 1001

Query: 491  RESKSYCENALRIYEKPVPGVPPEEIASGLTDVSSIYESMNELEQAIKLLQKALKIYNDA 550
              ++   + AL I E    G      A  L  ++++Y+  N+ EQA    +K+ KI+  A
Sbjct: 1002 GNAEQLYKQALEISENAY-GADHPYTARELEALATLYQKQNKYEQAEHFRKKSFKIHQKA 1060

Query: 551  PGQQSTVAGIEA-------------------------QMGVMYYMLGNYSDSYDSFKNAI 585
              ++  + G                            ++GV+YY+  N   +    K ++
Sbjct: 1061 IKKKGNLYGFALLRRRALQLEELTLGKDTPDNARTLNELGVLYYLQNNLETADQFLKRSL 1120

Query: 586  S-KLRAIGERKSAFFGVALNQMGLACVQRYSINEAVELFEEARSILEQECGPYHPDTLGV 644
              + R +G         +LN +   C ++   ++A EL+E A  I  +   P HP     
Sbjct: 1121 EMRERVLGPDHPDC-AQSLNNLAALCNEKKQYDKAEELYERALDIRRRALAPDHPSLAYT 1179

Query: 645  YSNLAGTYDAIGRLDDAIEILEFVVGIREEKLGTANPDV 683
              +LA  Y  +G+LD A+ + E  V IR++  G  +P V
Sbjct: 1180 VKHLAILYKKMGKLDKAVPLYELAVEIRQKSFGPKHPSV 1218




Required for normal ciliary development and function. Inhibits disheveled-1-induced canonical Wnt-signaling activity and may also play a role in the control of non-canonical Wnt signaling which regulates planar cell polarity. Probably acts as a molecular switch between different Wnt signaling pathways. Required for proper convergent extension cell movements.
Homo sapiens (taxid: 9606)
>sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 Back     alignment and function description
>sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 Back     alignment and function description
>sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 Back     alignment and function description
>sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=2 SV=1 Back     alignment and function description
>sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 Back     alignment and function description
>sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 Back     alignment and function description
>sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 Back     alignment and function description
>sp|P0CI65|NPHP3_DANRE Nephrocystin-3 OS=Danio rerio GN=nphp3 PE=3 SV=1 Back     alignment and function description
>sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query729
255540685767 kinesin light chain, putative [Ricinus c 0.991 0.942 0.791 0.0
359491584757 PREDICTED: uncharacterized protein LOC10 0.983 0.947 0.782 0.0
449477406736 PREDICTED: LOW QUALITY PROTEIN: uncharac 0.987 0.978 0.738 0.0
449440678736 PREDICTED: uncharacterized protein LOC10 0.987 0.978 0.736 0.0
356507244761 PREDICTED: uncharacterized protein LOC10 0.984 0.943 0.707 0.0
356518977753 PREDICTED: uncharacterized protein LOC10 0.983 0.952 0.696 0.0
224133522624 predicted protein [Populus trichocarpa] 0.850 0.993 0.772 0.0
357461993767 Kinesin light chain [Medicago truncatula 0.986 0.937 0.664 0.0
359488843710 PREDICTED: uncharacterized protein LOC10 0.950 0.976 0.678 0.0
357461995795 Kinesin light chain [Medicago truncatula 0.986 0.904 0.664 0.0
>gi|255540685|ref|XP_002511407.1| kinesin light chain, putative [Ricinus communis] gi|223550522|gb|EEF52009.1| kinesin light chain, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1144 bits (2959), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 605/764 (79%), Positives = 660/764 (86%), Gaps = 41/764 (5%)

Query: 1   MPGIIMDDIHEEGVVSELNGNSTPVKENSVSNKSPKSTPCPQSPRDQ---------PDGE 51
           MPGI+MD  +EE +V+E+N NS P+KEN++SNKSP+ST  PQSP            P GE
Sbjct: 1   MPGIVMDGNNEEAIVNEMNDNSVPIKENAMSNKSPRSTLSPQSPCSNSVDLPAGGVPVGE 60

Query: 52  --------------------GVDTSIEQLYENVCDMQSSDQSPSRHSFGSDGEESRIDSE 91
                               GVDTSIEQLYENVCDMQSSD SPSRHSFGSDGEESRIDSE
Sbjct: 61  LTVDEVVVNEVAADETSVHGGVDTSIEQLYENVCDMQSSDLSPSRHSFGSDGEESRIDSE 120

Query: 92  LRHLVGGEMREVEIMEEEEVEKPEDDSHSISSSKKGSSSGSKKSGKLEKSQSAGTKSISS 151
           LRHLVGGEMREVEIM+EEEV+KPE+D+HS SSSKKGSSSGSKKSGKL K+QSA + SISS
Sbjct: 121 LRHLVGGEMREVEIMQEEEVDKPENDTHSNSSSKKGSSSGSKKSGKLNKNQSASSNSISS 180

Query: 152 GHSKKVSHSGMDSEVSSKTNSKGKSLPEKPPIDK----GVKKSNAGATPMKKRKG----- 202
             SKK SH  +DSE SSK + K KS PEKPPIDK      KK+N G    KK +      
Sbjct: 181 NTSKKDSHIILDSEASSKLSPKSKSPPEKPPIDKRNDKNFKKANGGVKSTKKWRNSPLGG 240

Query: 203 -KLHKG-QDVSEAGLDKPGLGPLLLKQARELISSGDNPQKALELALRAAKSFEIGANGKP 260
            KL  G +D S++GL  P LG  LLKQ+R+LISSGDNPQKALELALRA+KSFEI ANGKP
Sbjct: 241 KKLQNGVEDSSDSGLGNPDLGRFLLKQSRDLISSGDNPQKALELALRASKSFEICANGKP 300

Query: 261 SLELVMCLHVIAAIYCSLGQYNEAIPVLEQSIEIPVIEEGQEHALAKFAGHMQLGDTYAM 320
           SLELVM LHV+AAIYCS+GQYNEAIPVLEQSIEIPVIEEGQEHALAKFAGHMQLGDTYAM
Sbjct: 301 SLELVMSLHVVAAIYCSVGQYNEAIPVLEQSIEIPVIEEGQEHALAKFAGHMQLGDTYAM 360

Query: 321 LGQLENSLMCYTTGLEVQKQVLGETDPRVGETCRYLAEAHVQALQFSEAQKFCQMALDIH 380
           LGQLENS  CYTTGLEVQKQVLGETDPRVGETCRYLAEAHVQALQF +A++ CQMALDIH
Sbjct: 361 LGQLENSTKCYTTGLEVQKQVLGETDPRVGETCRYLAEAHVQALQFDDAKRLCQMALDIH 420

Query: 381 KDNGSPASLEEAADRRLMGLICETKGDHEAALEHLVLASMTMIANDQDAEVASVDCSIGD 440
           ++NG+PAS EEAADRRLMGLICETKGDHEAALEHLVLASM M+AN Q+AEVASVDCSIGD
Sbjct: 421 RENGAPASPEEAADRRLMGLICETKGDHEAALEHLVLASMAMVANGQEAEVASVDCSIGD 480

Query: 441 TYLSLSRYDEAGFAYQKALTAFKTNKGENHPAVASVFVRLADMYNRTGKLRESKSYCENA 500
           TYLSLSRYDEA FAYQKALTAFKT KGENHPAVA+VFVRLAD+YN+TGKLR+SKSYCENA
Sbjct: 481 TYLSLSRYDEAVFAYQKALTAFKTTKGENHPAVAAVFVRLADLYNKTGKLRDSKSYCENA 540

Query: 501 LRIYEKPVPGVPPEEIASGLTDVSSIYESMNELEQAIKLLQKALKIYNDAPGQQSTVAGI 560
           LRIYEKP PG+PPEEIASGLTDVS+IYESMNELEQAIKLLQKALKIYNDAPGQQST+AGI
Sbjct: 541 LRIYEKPAPGIPPEEIASGLTDVSAIYESMNELEQAIKLLQKALKIYNDAPGQQSTIAGI 600

Query: 561 EAQMGVMYYMLGNYSDSYDSFKNAISKLRAIGERKSAFFGVALNQMGLACVQRYSINEAV 620
           EAQMGVMYYMLGNYS+SY++FKNA+SKLRA GERKSAFFG+ALNQMGLACVQRYSINEA 
Sbjct: 601 EAQMGVMYYMLGNYSESYNTFKNAVSKLRASGERKSAFFGIALNQMGLACVQRYSINEAA 660

Query: 621 ELFEEARSILEQECGPYHPDTLGVYSNLAGTYDAIGRLDDAIEILEFVVGIREEKLGTAN 680
           ELFEEA+SILEQECGPYHPDTLGVYSNLAGTYDA+GRLDDAIEILE VVG+REEKLGTAN
Sbjct: 661 ELFEEAKSILEQECGPYHPDTLGVYSNLAGTYDAMGRLDDAIEILELVVGMREEKLGTAN 720

Query: 681 PDVDDEKRRLAELLKEAGRVRSRKAQSLETLLDANSR-VNNDGI 723
           PDVDDEK+RLAELLKEAGRVRSRK +SLE LLD+NS  ++  GI
Sbjct: 721 PDVDDEKKRLAELLKEAGRVRSRKGRSLENLLDSNSHSIDKAGI 764




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359491584|ref|XP_002279663.2| PREDICTED: uncharacterized protein LOC100255253 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449477406|ref|XP_004155014.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101208453 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449440678|ref|XP_004138111.1| PREDICTED: uncharacterized protein LOC101208453 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356507244|ref|XP_003522379.1| PREDICTED: uncharacterized protein LOC100791625 [Glycine max] Back     alignment and taxonomy information
>gi|356518977|ref|XP_003528151.1| PREDICTED: uncharacterized protein LOC100783201 [Glycine max] Back     alignment and taxonomy information
>gi|224133522|ref|XP_002321593.1| predicted protein [Populus trichocarpa] gi|222868589|gb|EEF05720.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357461993|ref|XP_003601278.1| Kinesin light chain [Medicago truncatula] gi|355490326|gb|AES71529.1| Kinesin light chain [Medicago truncatula] Back     alignment and taxonomy information
>gi|359488843|ref|XP_002274441.2| PREDICTED: uncharacterized protein LOC100254332 [Vitis vinifera] Back     alignment and taxonomy information
>gi|357461995|ref|XP_003601279.1| Kinesin light chain [Medicago truncatula] gi|355490327|gb|AES71530.1| Kinesin light chain [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query729
TAIR|locus:2015959650 KLCR3 "AT1G27500" [Arabidopsis 0.753 0.844 0.680 5.2e-210
TAIR|locus:2086834663 KLCR2 "kinesin light chain-rel 0.761 0.837 0.641 3.7e-207
TAIR|locus:2123411609 KLCR1 "kinesin light chain-rel 0.670 0.802 0.654 6.5e-177
TAIR|locus:2042506617 AT2G31240 "AT2G31240" [Arabido 0.636 0.752 0.276 1.9e-42
ASPGD|ASPL00000183131288 AN3547 [Emericella nidulans (t 0.572 0.323 0.222 6.9e-20
UNIPROTKB|Q5LU72374 SPO1186 "TPR domain protein" [ 0.352 0.687 0.254 1.5e-13
TIGR_CMR|SPO_1186374 SPO_1186 "TPR domain protein" 0.352 0.687 0.254 1.5e-13
ASPGD|ASPL00000469941262 AN9426 [Emericella nidulans (t 0.641 0.370 0.211 2.7e-13
ASPGD|ASPL00000615671185 AN1071 [Emericella nidulans (t 0.589 0.362 0.223 2.4e-12
ASPGD|ASPL0000010369 1488 tprA [Emericella nidulans (tax 0.600 0.294 0.221 2.5e-12
TAIR|locus:2015959 KLCR3 "AT1G27500" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1897 (672.8 bits), Expect = 5.2e-210, Sum P(2) = 5.2e-210
 Identities = 382/561 (68%), Positives = 450/561 (80%)

Query:   165 EVSSKTNSKGKSL---P---EKPPIDKGVKKSNAGATPMKKRK-G--KLHKGQDVSEAXX 215
             E   K+NS    L   P   EK    K V KSN G   M+K+K G  KL  G +  E   
Sbjct:    84 EFDVKSNSSNLDLEVMPRDMEKQTGKKNVTKSNVGVGGMRKKKVGGTKLQNGNE--EPSS 141

Query:   216 XXXXXXXXXXXQARELISSGDNPQKALELALRAAKSFEIGA-NGKPSLELVMCLHVIAAI 274
                        QAR L+SSGD+  KALEL  RAAK FE  A NGKP LE +MCLHV AA+
Sbjct:   142 ENVELARFLLNQARNLVSSGDSTHKALELTHRAAKLFEASAENGKPCLEWIMCLHVTAAV 201

Query:   275 YCSLGQYNEAIPVLEQSIEIPVIEEGQEHALAKFAGHMQLGDTYAMLGQLENSLMCYTTG 334
             +C L +YNEAIPVL++S+EIPV+EEG+EHALAKFAG MQLGDTYAM+GQLE+S+ CYT G
Sbjct:   202 HCKLKEYNEAIPVLQRSVEIPVVEEGEEHALAKFAGLMQLGDTYAMVGQLESSISCYTEG 261

Query:   335 LEVQKQVLGETDPRVGETCRYLAEAHVQALQFSEAQKFCQMALDIHKDNGSPASLEEAAD 394
             L +QK+VLGE DPRVGETCRYLAEA VQAL+F EAQ+ C+ AL IH+++G P S+ EAAD
Sbjct:   262 LNIQKKVLGENDPRVGETCRYLAEALVQALRFDEAQQVCETALSIHRESGLPGSIAEAAD 321

Query:   395 RRLMGLICETKGDHEAALEHLVLASMTMIANDQDAEVASVDCSIGDTYLSLSRYDEAGFA 454
             RRLMGLICETKGDHE ALEHLVLASM M AN Q++EVA VD SIGD+YLSLSR+DEA  A
Sbjct:   322 RRLMGLICETKGDHENALEHLVLASMAMAANGQESEVAFVDTSIGDSYLSLSRFDEAICA 381

Query:   455 YQKALTAFKTNKGENHPAVASVFVRLADMYNRTGKLRESKSYCENALRIYEKPVPGVPPE 514
             YQK+LTA KT KGENHPAV SV++RLAD+YNRTGK+RE+KSYCENALRIYE     + PE
Sbjct:   382 YQKSLTALKTAKGENHPAVGSVYIRLADLYNRTGKVREAKSYCENALRIYESHNLEISPE 441

Query:   515 EIASGLTDVSSIYESMNELEQAIKLLQKALKIYNDAPGQQSTVAGIEAQMGVMYYMLGNY 574
             EIASGLTD+S I ESMNE+EQAI LLQKALKIY D+PGQ+  +AGIEAQMGV+YYM+G Y
Sbjct:   442 EIASGLTDISVICESMNEVEQAITLLQKALKIYADSPGQKIMIAGIEAQMGVLYYMMGKY 501

Query:   575 SDSYDSFKNAISKLRAIGERKSAFFGVALNQMGLACVQRYSINEAVELFEEARSILEQEC 634
              +SY++FK+AISKLRA G+++S FFG+ALNQMGLAC+Q  +I EAVELFEEA+ ILEQEC
Sbjct:   502 MESYNTFKSAISKLRATGKKQSTFFGIALNQMGLACIQLDAIEEAVELFEEAKCILEQEC 561

Query:   635 GPYHPDTLGVYSNLAGTYDAIGRLDDAIEILEFVVGIREEKLGTANPDVDDEKRRLAELL 694
             GPYHP+TLG+YSNLAG YDAIGRLDDAI++L  VVG+REEKLGTANP  +DEKRRLA+LL
Sbjct:   562 GPYHPETLGLYSNLAGAYDAIGRLDDAIKLLGHVVGVREEKLGTANPVTEDEKRRLAQLL 621

Query:   695 KEAGRVRSRKAQSLETLLDAN 715
             KEAG V  RKA+SL+TL+D++
Sbjct:   622 KEAGNVTGRKAKSLKTLIDSD 642


GO:0005575 "cellular_component" evidence=ND
TAIR|locus:2086834 KLCR2 "kinesin light chain-related 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2123411 KLCR1 "kinesin light chain-related 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2042506 AT2G31240 "AT2G31240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000018313 AN3547 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|Q5LU72 SPO1186 "TPR domain protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_1186 SPO_1186 "TPR domain protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
ASPGD|ASPL0000046994 AN9426 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
ASPGD|ASPL0000061567 AN1071 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
ASPGD|ASPL0000010369 tprA [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query729
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 3e-10
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 1e-09
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 2e-09
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 5e-09
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 6e-08
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 1e-07
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 1e-06
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 5e-06
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 7e-06
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 9e-06
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 1e-05
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 2e-05
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 2e-05
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 2e-05
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 2e-05
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 3e-05
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 3e-05
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 7e-05
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 7e-05
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 7e-05
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 1e-04
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 2e-04
pfam1337442 pfam13374, TPR_10, Tetratricopeptide repeat 5e-04
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 6e-04
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 7e-04
pfam05793528 pfam05793, TFIIF_alpha, Transcription initiation f 0.004
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
 Score = 57.4 bits (139), Expect = 3e-10
 Identities = 29/111 (26%), Positives = 47/111 (42%), Gaps = 17/111 (15%)

Query: 436 CSIGDTYLSLSRYDEAGFAYQKALTAFKTNKGENHPAVASVFVRLADMYNRTGKLRESKS 495
            ++G+ Y  L  YDEA   Y+KAL     N        A  +  LA  Y + GK  E+  
Sbjct: 4   LNLGNLYYKLGDYDEALEYYEKALELDPDN--------ADAYYNLAAAYYKLGKYEEALE 55

Query: 496 YCENALRIYEKPVPGVPPEEIASGLTDVSSIYESMNELEQAIKLLQKALKI 546
             E AL +             A    ++   Y  + + E+A++  +KAL++
Sbjct: 56  DYEKALELDPDN---------AKAYYNLGLAYYKLGKYEEALEAYEKALEL 97


Length = 100

>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|205553 pfam13374, TPR_10, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 729
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 100.0
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 100.0
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.98
KOG0547606 consensus Translocase of outer mitochondrial membr 99.97
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.97
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.97
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.96
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.96
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.96
KOG0547606 consensus Translocase of outer mitochondrial membr 99.95
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.95
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.94
KOG2003 840 consensus TPR repeat-containing protein [General f 99.92
KOG2003 840 consensus TPR repeat-containing protein [General f 99.91
PRK14574 822 hmsH outer membrane protein; Provisional 99.91
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.91
KOG1126638 consensus DNA-binding cell division cycle control 99.91
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.91
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 99.91
PRK11788389 tetratricopeptide repeat protein; Provisional 99.91
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.9
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 99.9
PRK11788389 tetratricopeptide repeat protein; Provisional 99.9
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.9
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.9
KOG1126638 consensus DNA-binding cell division cycle control 99.89
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.88
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.87
PLN03218 1060 maturation of RBCL 1; Provisional 99.87
KOG2076 895 consensus RNA polymerase III transcription factor 99.87
PRK14574 822 hmsH outer membrane protein; Provisional 99.86
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.86
KOG2076 895 consensus RNA polymerase III transcription factor 99.86
PLN03218 1060 maturation of RBCL 1; Provisional 99.85
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.84
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 99.84
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.83
PLN03077 857 Protein ECB2; Provisional 99.82
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.82
PRK04841903 transcriptional regulator MalT; Provisional 99.82
PRK04841 903 transcriptional regulator MalT; Provisional 99.79
KOG1129478 consensus TPR repeat-containing protein [General f 99.78
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.78
PLN03077 857 Protein ECB2; Provisional 99.78
KOG1129478 consensus TPR repeat-containing protein [General f 99.78
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.78
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.77
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.77
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.77
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.75
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.74
KOG1941518 consensus Acetylcholine receptor-associated protei 99.74
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.73
PRK12370553 invasion protein regulator; Provisional 99.73
KOG1941518 consensus Acetylcholine receptor-associated protei 99.73
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.73
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.72
PRK12370553 invasion protein regulator; Provisional 99.72
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.72
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.72
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.71
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.71
PRK11189296 lipoprotein NlpI; Provisional 99.71
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.71
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.7
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.7
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.69
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.69
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.69
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.69
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.68
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.68
KOG1125579 consensus TPR repeat-containing protein [General f 99.68
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.68
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.68
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.68
PRK11189296 lipoprotein NlpI; Provisional 99.68
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.67
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.67
KOG1125579 consensus TPR repeat-containing protein [General f 99.66
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.64
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.62
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.61
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.6
KOG2300629 consensus Uncharacterized conserved protein [Funct 99.52
PLN02789320 farnesyltranstransferase 99.5
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.48
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 99.47
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.46
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.46
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.46
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.43
PLN02789320 farnesyltranstransferase 99.42
KOG2300629 consensus Uncharacterized conserved protein [Funct 99.41
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.39
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 99.38
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.35
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 99.33
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.31
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 99.3
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.29
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.27
PRK15359144 type III secretion system chaperone protein SscB; 99.25
PRK15359144 type III secretion system chaperone protein SscB; 99.23
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 99.23
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.2
PRK10370198 formate-dependent nitrite reductase complex subuni 99.2
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.2
KOG1128777 consensus Uncharacterized conserved protein, conta 99.19
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.19
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.18
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 99.13
KOG1128777 consensus Uncharacterized conserved protein, conta 99.1
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.08
PRK10370198 formate-dependent nitrite reductase complex subuni 99.08
KOG0553 304 consensus TPR repeat-containing protein [General f 99.08
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.04
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.03
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.03
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.03
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 99.01
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 99.01
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.0
KOG0553304 consensus TPR repeat-containing protein [General f 99.0
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 99.0
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.99
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 98.98
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.96
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.95
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.95
KOG1585308 consensus Protein required for fusion of vesicles 98.94
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.93
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.9
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.88
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.87
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.86
KOG2471696 consensus TPR repeat-containing protein [General f 98.84
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.83
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.82
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.81
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.81
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 98.81
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.8
KOG1585308 consensus Protein required for fusion of vesicles 98.8
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.8
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.8
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.78
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.78
KOG1586288 consensus Protein required for fusion of vesicles 98.77
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 98.76
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.76
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.76
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.73
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.73
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.7
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.69
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.69
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.68
PRK10803263 tol-pal system protein YbgF; Provisional 98.66
KOG1586288 consensus Protein required for fusion of vesicles 98.65
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.65
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.65
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.64
COG3898531 Uncharacterized membrane-bound protein [Function u 98.61
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.59
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.59
COG3898 531 Uncharacterized membrane-bound protein [Function u 98.56
KOG2471696 consensus TPR repeat-containing protein [General f 98.56
PF12688120 TPR_5: Tetratrico peptide repeat 98.55
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.51
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.51
PF12688120 TPR_5: Tetratrico peptide repeat 98.51
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.49
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.49
PRK10803263 tol-pal system protein YbgF; Provisional 98.48
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.46
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.45
COG5159421 RPN6 26S proteasome regulatory complex component [ 98.43
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.42
KOG4234271 consensus TPR repeat-containing protein [General f 98.41
KOG1463411 consensus 26S proteasome regulatory complex, subun 98.39
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.38
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.37
KOG4555175 consensus TPR repeat-containing protein [Function 98.36
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.36
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 98.35
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.33
KOG4234271 consensus TPR repeat-containing protein [General f 98.32
KOG4555175 consensus TPR repeat-containing protein [Function 98.31
PRK11906458 transcriptional regulator; Provisional 98.29
PF13512142 TPR_18: Tetratricopeptide repeat 98.28
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.28
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.28
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.27
PRK11906458 transcriptional regulator; Provisional 98.25
KOG4648 536 consensus Uncharacterized conserved protein, conta 98.24
PRK15331165 chaperone protein SicA; Provisional 98.24
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.23
PRK15331165 chaperone protein SicA; Provisional 98.23
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.22
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.21
COG4700251 Uncharacterized protein conserved in bacteria cont 98.2
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.16
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.15
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.14
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 98.13
KOG1463411 consensus 26S proteasome regulatory complex, subun 98.12
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 98.11
PF13512142 TPR_18: Tetratricopeptide repeat 98.09
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.09
KOG2796366 consensus Uncharacterized conserved protein [Funct 98.08
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 98.07
KOG2796366 consensus Uncharacterized conserved protein [Funct 98.07
PF1337173 TPR_9: Tetratricopeptide repeat 98.05
KOG4648 536 consensus Uncharacterized conserved protein, conta 98.05
COG4700251 Uncharacterized protein conserved in bacteria cont 98.05
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 98.04
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 98.03
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.0
COG5159421 RPN6 26S proteasome regulatory complex component [ 97.96
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 97.92
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.9
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.9
PF1337173 TPR_9: Tetratricopeptide repeat 97.89
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.89
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.86
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 97.83
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.82
KOG2610491 consensus Uncharacterized conserved protein [Funct 97.81
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.81
KOG20411189 consensus WD40 repeat protein [General function pr 97.77
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 97.72
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.72
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.71
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.67
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.65
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.64
KOG1550552 consensus Extracellular protein SEL-1 and related 97.61
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.6
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 97.57
KOG4507 886 consensus Uncharacterized conserved protein, conta 97.56
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.54
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.52
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.5
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 97.49
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 97.47
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 97.46
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 97.45
KOG2610491 consensus Uncharacterized conserved protein [Funct 97.44
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 97.43
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.42
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.41
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 97.4
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 97.39
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 97.38
PF06552186 TOM20_plant: Plant specific mitochondrial import r 97.38
KOG1550552 consensus Extracellular protein SEL-1 and related 97.37
PF09986214 DUF2225: Uncharacterized protein conserved in bact 97.3
KOG20411189 consensus WD40 repeat protein [General function pr 97.3
PF09986214 DUF2225: Uncharacterized protein conserved in bact 97.28
PF1342844 TPR_14: Tetratricopeptide repeat 97.25
PF1342844 TPR_14: Tetratricopeptide repeat 97.24
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 97.22
KOG1258577 consensus mRNA processing protein [RNA processing 97.19
KOG3783546 consensus Uncharacterized conserved protein [Funct 97.11
PF1343134 TPR_17: Tetratricopeptide repeat 97.1
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.09
KOG1258577 consensus mRNA processing protein [RNA processing 97.01
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.01
PF06552186 TOM20_plant: Plant specific mitochondrial import r 96.98
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 96.97
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.96
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 96.91
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 96.9
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 96.89
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 96.84
PF1286294 Apc5: Anaphase-promoting complex subunit 5 96.77
KOG4814872 consensus Uncharacterized conserved protein [Funct 96.76
PF1343134 TPR_17: Tetratricopeptide repeat 96.7
PF1286294 Apc5: Anaphase-promoting complex subunit 5 96.69
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.64
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 96.58
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.52
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 96.27
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.26
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 96.22
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.17
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 96.07
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.04
KOG4814872 consensus Uncharacterized conserved protein [Funct 96.03
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 95.91
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 95.9
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 95.8
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 95.74
KOG0128 881 consensus RNA-binding protein SART3 (RRM superfami 95.59
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 95.5
KOG4322482 consensus Anaphase-promoting complex (APC), subuni 95.5
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 95.5
PF00244236 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 95.49
KOG2581493 consensus 26S proteasome regulatory complex, subun 95.47
KOG1308 377 consensus Hsp70-interacting protein Hip/Transient 95.41
KOG4322482 consensus Anaphase-promoting complex (APC), subuni 95.29
KOG3783546 consensus Uncharacterized conserved protein [Funct 95.29
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 95.26
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 95.1
PRK14707 2710 hypothetical protein; Provisional 95.04
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 95.04
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 95.01
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 94.98
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 94.92
KOG2581493 consensus 26S proteasome regulatory complex, subun 94.92
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 94.89
PF12739414 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 94.67
COG5187412 RPN7 26S proteasome regulatory complex component, 94.66
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 94.66
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 94.55
PF12739414 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 94.53
PRK14707 2710 hypothetical protein; Provisional 94.5
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 94.45
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 94.21
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 94.19
PRK10941269 hypothetical protein; Provisional 93.92
KOG0687393 consensus 26S proteasome regulatory complex, subun 93.88
KOG4507 886 consensus Uncharacterized conserved protein, conta 93.84
PF00244236 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 93.7
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 93.65
KOG0687393 consensus 26S proteasome regulatory complex, subun 93.61
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 93.6
COG4649221 Uncharacterized protein conserved in bacteria [Fun 93.54
COG5187412 RPN7 26S proteasome regulatory complex component, 93.34
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 92.97
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 92.93
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 92.84
COG3629280 DnrI DNA-binding transcriptional activator of the 92.83
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 92.74
COG3947361 Response regulator containing CheY-like receiver a 92.74
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 92.7
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 92.68
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 92.32
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 92.26
COG4976 287 Predicted methyltransferase (contains TPR repeat) 91.95
smart00101244 14_3_3 14-3-3 homologues. 14-3-3 homologues mediat 91.93
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 91.64
KOG0686466 consensus COP9 signalosome, subunit CSN1 [Posttran 91.61
PF10255404 Paf67: RNA polymerase I-associated factor PAF67; I 91.41
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 91.28
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 91.24
smart00101244 14_3_3 14-3-3 homologues. 14-3-3 homologues mediat 90.92
PF15015569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 90.86
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 90.71
COG4649221 Uncharacterized protein conserved in bacteria [Fun 90.66
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 90.66
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 90.65
KOG1497399 consensus COP9 signalosome, subunit CSN4 [Posttran 90.51
KOG4014248 consensus Uncharacterized conserved protein (conta 90.28
KOG2422665 consensus Uncharacterized conserved protein [Funct 90.18
PF15015 569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 89.98
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 89.96
KOG2561568 consensus Adaptor protein NUB1, contains UBA domai 89.74
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 89.63
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 89.37
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 89.32
cd0268275 MIT_AAA_Arch MIT: domain contained within Microtub 89.19
PRK10941269 hypothetical protein; Provisional 89.01
KOG1310758 consensus WD40 repeat protein [General function pr 88.8
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 88.77
PF08311126 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro 88.53
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 88.46
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 88.05
KOG0686466 consensus COP9 signalosome, subunit CSN1 [Posttran 88.05
PF08626 1185 TRAPPC9-Trs120: Transport protein Trs120 or TRAPPC 87.92
KOG3364149 consensus Membrane protein involved in organellar 87.81
COG1747 711 Uncharacterized N-terminal domain of the transcrip 87.58
KOG1497399 consensus COP9 signalosome, subunit CSN4 [Posttran 87.47
KOG0128 881 consensus RNA-binding protein SART3 (RRM superfami 87.4
COG3629280 DnrI DNA-binding transcriptional activator of the 87.14
PF09670379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 87.11
KOG4014248 consensus Uncharacterized conserved protein (conta 87.02
PF08311126 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro 86.53
KOG2908380 consensus 26S proteasome regulatory complex, subun 86.5
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 86.49
PF05053618 Menin: Menin; InterPro: IPR007747 MEN1, the gene r 85.89
PF09670379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 85.68
PF08626 1185 TRAPPC9-Trs120: Transport protein Trs120 or TRAPPC 85.59
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 85.56
KOG1310 758 consensus WD40 repeat protein [General function pr 85.32
KOG2422 665 consensus Uncharacterized conserved protein [Funct 85.13
cd0268377 MIT_1 MIT: domain contained within Microtubule Int 85.09
KOG2908380 consensus 26S proteasome regulatory complex, subun 84.37
PF10952140 DUF2753: Protein of unknown function (DUF2753); In 84.37
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 84.22
PF10952140 DUF2753: Protein of unknown function (DUF2753); In 84.03
KOG2561 568 consensus Adaptor protein NUB1, contains UBA domai 83.96
PF0421269 MIT: MIT (microtubule interacting and transport) d 83.02
COG4976 287 Predicted methyltransferase (contains TPR repeat) 82.73
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 82.73
cd0267875 MIT_VPS4 MIT: domain contained within Microtubule 82.21
KOG3807 556 consensus Predicted membrane protein ST7 (tumor su 81.18
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 81.1
PRK09169 2316 hypothetical protein; Validated 81.07
smart0074577 MIT Microtubule Interacting and Trafficking molecu 80.86
KOG0889 3550 consensus Histone acetyltransferase SAGA, TRRAP/TR 80.42
PF10255404 Paf67: RNA polymerase I-associated factor PAF67; I 80.35
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 80.21
KOG4521 1480 consensus Nuclear pore complex, Nup160 component [ 80.02
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=3.7e-45  Score=363.38  Aligned_cols=415  Identities=20%  Similarity=0.285  Sum_probs=255.5

Q ss_pred             CCCCCCChHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHHHhcCCCCCHhHHHHHHHHHHHHHHcCChHHHHHHHHHhc
Q 004812          213 AGLDKPGLGPLLLKQARELISSGDNPQKALELALRAAKSFEIGANGKPSLELVMCLHVIAAIYCSLGQYNEAIPVLEQSI  292 (729)
Q Consensus       213 ~~~~~p~~~~~l~~~a~~~~~~g~~~~~A~~~~~~Al~~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al  292 (729)
                      ....+|.....++.++..+++-.+ +++....-..|++..         |..+.+|.++|.++...|++++|+.+|+.++
T Consensus        74 v~~~d~t~~~~llll~ai~~q~~r-~d~s~a~~~~a~r~~---------~q~ae~ysn~aN~~kerg~~~~al~~y~~ai  143 (966)
T KOG4626|consen   74 VGQEDPTNTERLLLLSAIFFQGSR-LDKSSAGSLLAIRKN---------PQGAEAYSNLANILKERGQLQDALALYRAAI  143 (966)
T ss_pred             hhccCCCcccceeeehhhhhcccc-hhhhhhhhhhhhhcc---------chHHHHHHHHHHHHHHhchHHHHHHHHHHHH
Confidence            334444444444444444444433 444444444444332         4446666666666666666666666666666


Q ss_pred             ccchhhccccchHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHHhCCCCchHHHHHHHHHHHHHHhcCHHHHHHH
Q 004812          293 EIPVIEEGQEHALAKFAGHMQLGDTYAMLGQLENSLMCYTTGLEVQKQVLGETDPRVGETCRYLAEAHVQALQFSEAQKF  372 (729)
Q Consensus       293 ~~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~  372 (729)
                      ++.         +..+.+|.++|.++...|+.+.|..+|..++++        +|...-+...+|.++...|+..+|..+
T Consensus       144 el~---------p~fida~inla~al~~~~~~~~a~~~~~~alql--------nP~l~ca~s~lgnLlka~Grl~ea~~c  206 (966)
T KOG4626|consen  144 ELK---------PKFIDAYINLAAALVTQGDLELAVQCFFEALQL--------NPDLYCARSDLGNLLKAEGRLEEAKAC  206 (966)
T ss_pred             hcC---------chhhHHHhhHHHHHHhcCCCcccHHHHHHHHhc--------CcchhhhhcchhHHHHhhcccchhHHH
Confidence            654         123445666666666666666666666666666        566666666666666666666666666


Q ss_pred             HHHHHHHHHhcCCCCCHHHHHHHHHHHHHHHHhCCHHHHHHHHHHHHHHHHhCCCChhHHHHHHHHHHHHHHcCCHHHHH
Q 004812          373 CQMALDIHKDNGSPASLEEAADRRLMGLICETKGDHEAALEHLVLASMTMIANDQDAEVASVDCSIGDTYLSLSRYDEAG  452 (729)
Q Consensus       373 ~~~al~~~~~~~~~~~~~~a~~~~~lg~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~  452 (729)
                      |.+|++..+..        +.+|.+||.++...|+...|+.+|++|+.      .+|....+|++||.+|...+.|+.|+
T Consensus       207 YlkAi~~qp~f--------AiawsnLg~~f~~~Gei~~aiq~y~eAvk------ldP~f~dAYiNLGnV~ke~~~~d~Av  272 (966)
T KOG4626|consen  207 YLKAIETQPCF--------AIAWSNLGCVFNAQGEIWLAIQHYEEAVK------LDPNFLDAYINLGNVYKEARIFDRAV  272 (966)
T ss_pred             HHHHHhhCCce--------eeeehhcchHHhhcchHHHHHHHHHHhhc------CCCcchHHHhhHHHHHHHHhcchHHH
Confidence            66666655432        34466666666666666666666666654      25555666666666666666666666


Q ss_pred             HHHHHHHHHHHHhcCCCChhHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHhcCCCCCChHHHHHHHHHHHHHHHhcch
Q 004812          453 FAYQKALTAFKTNKGENHPAVASVFVRLADMYNRTGKLRESKSYCENALRIYEKPVPGVPPEEIASGLTDVSSIYESMNE  532 (729)
Q Consensus       453 ~~~~~al~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~~la~~~~~~g~  532 (729)
                      ..|.+|+.+        .|..+.++.++|.+|..+|..+-|+..|++++++         .|....++++||..+...|+
T Consensus       273 s~Y~rAl~l--------rpn~A~a~gNla~iYyeqG~ldlAI~~Ykral~~---------~P~F~~Ay~NlanALkd~G~  335 (966)
T KOG4626|consen  273 SCYLRALNL--------RPNHAVAHGNLACIYYEQGLLDLAIDTYKRALEL---------QPNFPDAYNNLANALKDKGS  335 (966)
T ss_pred             HHHHHHHhc--------CCcchhhccceEEEEeccccHHHHHHHHHHHHhc---------CCCchHHHhHHHHHHHhccc
Confidence            666666665        5666666666666666666666666666666666         44445566666666666666


Q ss_pred             HHHHHHHHHHHHHHHHhCCCCCCcHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHhCCCCChHHHHHHHHHHHHHHH
Q 004812          533 LEQAIKLLQKALKIYNDAPGQQSTVAGIEAQMGVMYYMLGNYSDSYDSFKNAISKLRAIGERKSAFFGVALNQMGLACVQ  612 (729)
Q Consensus       533 ~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~la~~~~~  612 (729)
                      ..+|..+|.+++.+.+..       +.+.++||.+|..+|.+++|..+|.++++..        +..+.+.++||.+|.+
T Consensus       336 V~ea~~cYnkaL~l~p~h-------adam~NLgni~~E~~~~e~A~~ly~~al~v~--------p~~aaa~nNLa~i~kq  400 (966)
T KOG4626|consen  336 VTEAVDCYNKALRLCPNH-------ADAMNNLGNIYREQGKIEEATRLYLKALEVF--------PEFAAAHNNLASIYKQ  400 (966)
T ss_pred             hHHHHHHHHHHHHhCCcc-------HHHHHHHHHHHHHhccchHHHHHHHHHHhhC--------hhhhhhhhhHHHHHHh
Confidence            666666666666665554       4556666666666666666666666666653        2245566666666666


Q ss_pred             cCCHHHHHHHHHHHHHHHHHhcCCCChhHHHHHHHHHHHHHHcCChHHHHHHHHHHHHHHHHHcCCCChhHHHHHHHHHH
Q 004812          613 RYSINEAVELFEEARSILEQECGPYHPDTLGVYSNLAGTYDAIGRLDDAIEILEFVVGIREEKLGTANPDVDDEKRRLAE  692 (729)
Q Consensus       613 ~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~p~~~~~~~~La~  692 (729)
                      +|++++|+.+|++++.+        .|..++++.++|..|..+|+...|+..|.+|+.+        +|..++++.+||.
T Consensus       401 qgnl~~Ai~~YkealrI--------~P~fAda~~NmGnt~ke~g~v~~A~q~y~rAI~~--------nPt~AeAhsNLas  464 (966)
T KOG4626|consen  401 QGNLDDAIMCYKEALRI--------KPTFADALSNMGNTYKEMGDVSAAIQCYTRAIQI--------NPTFAEAHSNLAS  464 (966)
T ss_pred             cccHHHHHHHHHHHHhc--------CchHHHHHHhcchHHHHhhhHHHHHHHHHHHHhc--------CcHHHHHHhhHHH
Confidence            66666666666666666        6666666666666666666666666666666655        5666666666666


Q ss_pred             HHHHhCCHhHHHHHHHHHHHhhccc
Q 004812          693 LLKEAGRVRSRKAQSLETLLDANSR  717 (729)
Q Consensus       693 ~~~~~g~~~~A~~~~l~~al~~~p~  717 (729)
                      +|...|+..+|+ ..|+++|++.|+
T Consensus       465 i~kDsGni~~AI-~sY~~aLklkPD  488 (966)
T KOG4626|consen  465 IYKDSGNIPEAI-QSYRTALKLKPD  488 (966)
T ss_pred             HhhccCCcHHHH-HHHHHHHccCCC
Confidence            666666666666 666666666666



>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>KOG4322 consensus Anaphase-promoting complex (APC), subunit 5 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4322 consensus Anaphase-promoting complex (APC), subunit 5 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>PRK14707 hypothetical protein; Provisional Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF12739 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 85 kDa subunit; InterPro: IPR024420 This entry represents Trs85, a subunit of the TRAPP III complex [] Back     alignment and domain information
>COG5187 RPN7 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF12739 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 85 kDa subunit; InterPro: IPR024420 This entry represents Trs85, a subunit of the TRAPP III complex [] Back     alignment and domain information
>PRK14707 hypothetical protein; Provisional Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG0687 consensus 26S proteasome regulatory complex, subunit RPN7/PSMD6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG0687 consensus 26S proteasome regulatory complex, subunit RPN7/PSMD6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG5187 RPN7 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>smart00101 14_3_3 14-3-3 homologues Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>smart00101 14_3_3 14-3-3 homologues Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG1497 consensus COP9 signalosome, subunit CSN4 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4014 consensus Uncharacterized conserved protein (contains TPR repeat) [Function unknown] Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PF08311 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro: IPR013212 Proteins containing this domain are checkpoint proteins involved in cell division Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF08626 TRAPPC9-Trs120: Transport protein Trs120 or TRAPPC9, TRAPP II complex subunit; InterPro: IPR013935 The trafficking protein particle complex TRAPP is a multi-protein complex needed in the early stages of the secretory pathway Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>KOG1497 consensus COP9 signalosome, subunit CSN4 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information
>KOG4014 consensus Uncharacterized conserved protein (contains TPR repeat) [Function unknown] Back     alignment and domain information
>PF08311 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro: IPR013212 Proteins containing this domain are checkpoint proteins involved in cell division Back     alignment and domain information
>KOG2908 consensus 26S proteasome regulatory complex, subunit RPN9/PSMD13 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF05053 Menin: Menin; InterPro: IPR007747 MEN1, the gene responsible for multiple endocrine neoplasia type 1, is a tumour suppressor gene that encodes a protein called Menin which may be an atypical GTPase stimulated by nm23 [] Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information
>PF08626 TRAPPC9-Trs120: Transport protein Trs120 or TRAPPC9, TRAPP II complex subunit; InterPro: IPR013935 The trafficking protein particle complex TRAPP is a multi-protein complex needed in the early stages of the secretory pathway Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd02683 MIT_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG2908 consensus 26S proteasome regulatory complex, subunit RPN9/PSMD13 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10952 DUF2753: Protein of unknown function (DUF2753); InterPro: IPR020206 This entry represents a group of uncharacterised proteins Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PF10952 DUF2753: Protein of unknown function (DUF2753); InterPro: IPR020206 This entry represents a group of uncharacterised proteins Back     alignment and domain information
>KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF04212 MIT: MIT (microtubule interacting and transport) domain; InterPro: IPR007330 The MIT domain is found in vacuolar sorting proteins, spastin (probable ATPase involved in the assembly or function of nuclear protein complexes), and a sorting nexin, which may play a role in intracellular trafficking Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd02678 MIT_VPS4 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PRK09169 hypothetical protein; Validated Back     alignment and domain information
>smart00745 MIT Microtubule Interacting and Trafficking molecule domain Back     alignment and domain information
>KOG0889 consensus Histone acetyltransferase SAGA, TRRAP/TRA1 component, PI-3 kinase superfamily [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4521 consensus Nuclear pore complex, Nup160 component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query729
3ceq_A283 The Tpr Domain Of Human Kinesin Light Chain 2 (Hklc 6e-10
3ceq_A 283 The Tpr Domain Of Human Kinesin Light Chain 2 (Hklc 8e-05
3edt_B283 Crystal Structure Of The Mutated S328n Hklc2 Tpr Do 9e-10
3edt_B 283 Crystal Structure Of The Mutated S328n Hklc2 Tpr Do 7e-05
3nf1_A311 Crystal Structure Of The Tpr Domain Of Kinesin Ligh 1e-08
3nf1_A311 Crystal Structure Of The Tpr Domain Of Kinesin Ligh 1e-04
2wqh_A125 Crystal Structure Of Ctpr3y3 Length = 125 7e-05
>pdb|3CEQ|A Chain A, The Tpr Domain Of Human Kinesin Light Chain 2 (Hklc2) Length = 283 Back     alignment and structure

Iteration: 1

Score = 62.8 bits (151), Expect = 6e-10, Method: Compositional matrix adjust. Identities = 42/159 (26%), Positives = 80/159 (50%), Gaps = 2/159 (1%) Query: 430 EVASVDCSIGDTYLSLSRYDEAGFAYQKALTAFKTNKGENHPAVASVFVRLADMYNRTGK 489 +VA++ + Y ++Y EA AL + G++HPAVA+ LA +Y + GK Sbjct: 41 DVATMLNILALVYRDQNKYKEAAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGK 100 Query: 490 LRESKSYCENALRIYEKPVPGVPPEEIASGLTDVSSIYESMNELEQAIKLLQKALKIYND 549 +E++ C+ AL I EK + P ++A L++++ + ++ + E+ ++AL+IY Sbjct: 101 YKEAEPLCKRALEIREKVLGKFHP-DVAKQLSNLALLCQNQGKAEEVEYYYRRALEIYAT 159 Query: 550 APG-QQSTVAGIEAQMGVMYYMLGNYSDSYDSFKNAISK 587 G VA + + Y G Y D+ +K +++ Sbjct: 160 RLGPDDPNVAKTKNNLASCYLKQGKYQDAETLYKEILTR 198
>pdb|3CEQ|A Chain A, The Tpr Domain Of Human Kinesin Light Chain 2 (Hklc2) Length = 283 Back     alignment and structure
>pdb|3EDT|B Chain B, Crystal Structure Of The Mutated S328n Hklc2 Tpr Domain Length = 283 Back     alignment and structure
>pdb|3EDT|B Chain B, Crystal Structure Of The Mutated S328n Hklc2 Tpr Domain Length = 283 Back     alignment and structure
>pdb|3NF1|A Chain A, Crystal Structure Of The Tpr Domain Of Kinesin Light Chain 1 Length = 311 Back     alignment and structure
>pdb|3NF1|A Chain A, Crystal Structure Of The Tpr Domain Of Kinesin Light Chain 1 Length = 311 Back     alignment and structure
>pdb|2WQH|A Chain A, Crystal Structure Of Ctpr3y3 Length = 125 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query729
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 2e-42
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 4e-29
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 9e-25
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 1e-19
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 1e-08
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 4e-38
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 3e-37
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 4e-17
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 1e-13
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 1e-36
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 5e-30
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 6e-30
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 6e-23
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 3e-15
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 2e-09
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 5e-36
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 1e-32
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 3e-32
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 2e-31
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 2e-08
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 6e-34
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 9e-30
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 8e-21
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 8e-09
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 7e-33
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-25
3q15_A378 PSP28, response regulator aspartate phosphatase H; 3e-26
3q15_A378 PSP28, response regulator aspartate phosphatase H; 4e-26
3q15_A378 PSP28, response regulator aspartate phosphatase H; 7e-23
3q15_A378 PSP28, response regulator aspartate phosphatase H; 5e-20
3q15_A378 PSP28, response regulator aspartate phosphatase H; 1e-18
3q15_A378 PSP28, response regulator aspartate phosphatase H; 5e-16
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 3e-26
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 2e-23
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 1e-19
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 1e-18
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 3e-26
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 1e-24
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 4e-23
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 4e-18
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 1e-15
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-23
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-23
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-20
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 6e-18
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-16
4g1t_A472 Interferon-induced protein with tetratricopeptide 3e-23
4g1t_A472 Interferon-induced protein with tetratricopeptide 3e-21
4g1t_A472 Interferon-induced protein with tetratricopeptide 2e-10
4g1t_A 472 Interferon-induced protein with tetratricopeptide 3e-04
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 9e-23
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 6e-20
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-17
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-16
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-22
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-16
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 9e-09
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 8e-05
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-22
2gw1_A514 Mitochondrial precursor proteins import receptor; 5e-20
2gw1_A514 Mitochondrial precursor proteins import receptor; 7e-20
2gw1_A514 Mitochondrial precursor proteins import receptor; 8e-16
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 2e-22
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 1e-21
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 4e-21
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 4e-17
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 5e-14
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 9e-07
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 5e-04
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 4e-21
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 9e-17
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-16
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 2e-18
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 3e-18
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 3e-17
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 1e-16
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 2e-15
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 7e-13
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 3e-10
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 4e-09
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-17
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 8e-11
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 3e-08
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-04
3u4t_A272 TPR repeat-containing protein; structural genomics 3e-17
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-12
3u4t_A 272 TPR repeat-containing protein; structural genomics 2e-05
3u4t_A272 TPR repeat-containing protein; structural genomics 2e-05
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 9e-16
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 2e-15
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 9e-08
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-06
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 1e-15
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 4e-15
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 2e-10
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 3e-10
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 1e-07
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 3e-06
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 6e-05
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 2e-15
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 3e-11
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 7e-10
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 9e-10
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 2e-15
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 6e-14
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 1e-12
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 7e-09
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 2e-08
4eqf_A365 PEX5-related protein; accessory protein, tetratric 4e-14
4eqf_A365 PEX5-related protein; accessory protein, tetratric 8e-13
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 4e-07
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 1e-05
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 5e-13
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 5e-07
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 3e-06
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 1e-05
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 6e-13
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 5e-11
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 7e-09
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 2e-12
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 6e-09
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 2e-07
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 6e-12
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 1e-07
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 2e-06
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-11
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-10
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-10
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 6e-07
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-05
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-04
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 1e-11
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 2e-11
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 8e-10
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 1e-07
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 2e-07
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 1e-11
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 9e-10
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 6e-09
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 2e-08
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 1e-07
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 2e-10
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 3e-08
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 1e-06
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 4e-05
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 6e-10
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 4e-07
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 6e-04
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 9e-10
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 4e-07
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 9e-06
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 1e-09
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 2e-07
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 4e-05
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 2e-09
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 2e-09
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 4e-09
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 1e-08
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-08
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 4e-07
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 1e-08
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 5e-04
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 2e-08
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 1e-06
3k9i_A117 BH0479 protein; putative protein binding protein, 3e-08
3k9i_A117 BH0479 protein; putative protein binding protein, 3e-07
3k9i_A117 BH0479 protein; putative protein binding protein, 2e-06
3k9i_A117 BH0479 protein; putative protein binding protein, 3e-05
3k9i_A117 BH0479 protein; putative protein binding protein, 1e-04
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 1e-07
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 2e-06
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 2e-06
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 8e-05
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 1e-07
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 8e-05
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 3e-07
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 3e-04
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 8e-04
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 5e-07
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 2e-06
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 8e-06
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 3e-05
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 7e-07
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 1e-06
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 9e-06
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 6e-04
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 2e-06
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 5e-06
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 4e-04
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 8e-06
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 4e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
2kat_A115 Uncharacterized protein; NESG, structure, structur 2e-05
2kat_A115 Uncharacterized protein; NESG, structure, structur 8e-05
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 3e-05
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 3e-05
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 9e-04
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 5e-05
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 4e-04
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 8e-05
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 4e-04
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 2e-04
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 2e-04
3qww_A433 SET and MYND domain-containing protein 2; methyltr 8e-04
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 8e-04
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
 Score =  158 bits (401), Expect = 2e-42
 Identities = 67/421 (15%), Positives = 132/421 (31%), Gaps = 42/421 (9%)

Query: 266 MCLHVIAAIYCSLGQYNEAIPVLEQSIEIPVIEEGQEHALAKFAGHMQLGDTYAMLGQLE 325
           + L +     C  G     +   E ++++     G E      A + QLG+ Y  L    
Sbjct: 10  LELALEGERLCKSGDCRAGVSFFEAAVQV-----GTEDLKTLSAIYSQLGNAYFYLHDYA 64

Query: 326 NSLMCYTTGLEVQKQVLGETDPRVGETCRYLAEAHVQALQFSEAQKFCQMALDIHKDNGS 385
            +L  +   L + + +  +      +    L         F EA   CQ  LDI ++   
Sbjct: 65  KALEYHHHDLTLARTIGDQLG--EAKASGNLGNTLKVLGNFDEAIVCCQRHLDISRELND 122

Query: 386 PASLEEAADRRLMGLICETKGDHEAALEHLVLASMTMIANDQDAEVASVDCSIGDTYLSL 445
                EA     +G +   KG          +        D                   
Sbjct: 123 KVG--EARALYNLGNVYHAKGKSFGCPGPQDVGEFPEEVRDA------------------ 162

Query: 446 SRYDEAGFAYQKALTAFKTNKGENHPAVASVFVRLADMYNRTGKLRESKSYCENALRIYE 505
                A   Y++ L+        +  A    F  L + +   G  R++    E  L I +
Sbjct: 163 --LQAAVDFYEENLSLVT--ALGDRAAQGRAFGNLGNTHYLLGNFRDAVIAHEQRLLIAK 218

Query: 506 KPVPGVPPEEIASGLTDVSSIYESMNELEQAIKLLQKALKIYNDAPGQQSTVAGIEAQMG 565
           +   G    E     +++ + Y  + E E A +  +K L +       ++  A     +G
Sbjct: 219 E--FGDKAAE-RRAYSNLGNAYIFLGEFETASEYYKKTLLLARQL-KDRAVEAQSCYSLG 274

Query: 566 VMYYMLGNYSDSYDSFKNAISKLRAIGERKSAFFGVALNQMGLACVQRYSINEAVELFEE 625
             Y +L +Y  + D     ++  + + +R     G A   +G A     + ++A+   E+
Sbjct: 275 NTYTLLQDYEKAIDYHLKHLAIAQELNDRIGE--GRACWSLGNAYTALGNHDQAMHFAEK 332

Query: 626 ARSILEQECGPY-----HPDTLGVYSNLAGTYDAIGRLDDAIEILEFVVGIREEKLGTAN 680
              I  +            +   +   L  +Y     +      ++  +     KLG  +
Sbjct: 333 HLEISREVGDKSGELTARLNLSDLQMVLGLSYSTNNSIMSENTEIDSSLNGVRPKLGRRH 392

Query: 681 P 681
            
Sbjct: 393 S 393


>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Length = 429 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Length = 429 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Length = 490 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Length = 490 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Length = 433 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query729
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2gw1_A514 Mitochondrial precursor proteins import receptor; 100.0
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 100.0
2gw1_A514 Mitochondrial precursor proteins import receptor; 100.0
4g1t_A472 Interferon-induced protein with tetratricopeptide 100.0
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.97
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.97
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.97
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.97
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.97
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.97
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.97
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.97
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.96
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.96
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.96
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.96
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.96
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.95
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.95
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.95
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.95
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.94
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.94
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.94
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.94
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.94
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.92
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.92
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.92
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.92
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.92
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.91
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.91
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.9
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.9
3u4t_A272 TPR repeat-containing protein; structural genomics 99.9
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.9
3u4t_A272 TPR repeat-containing protein; structural genomics 99.89
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.89
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.89
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.89
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.89
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.88
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.88
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.88
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.88
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.87
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.87
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.85
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.85
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.84
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.84
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.83
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.83
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.83
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.83
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.83
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.82
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.82
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.82
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.81
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.81
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.81
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.81
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.81
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.8
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.8
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.8
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.8
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.79
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.79
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.77
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.76
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.75
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.74
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.73
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.72
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 99.7
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.7
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.68
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.68
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.67
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.66
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 99.66
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.66
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.65
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.64
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.64
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.64
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.64
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.64
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.64
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.64
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.63
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.63
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.63
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 99.62
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.61
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.61
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.6
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.57
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.57
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 99.56
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.55
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.53
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.53
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.52
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.5
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.5
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.49
3qww_A433 SET and MYND domain-containing protein 2; methyltr 99.49
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.49
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.49
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.48
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.47
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 99.47
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.47
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.46
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.46
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.46
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.43
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.43
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.43
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.42
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.41
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.39
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.39
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.36
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.36
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.36
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.35
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.34
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.33
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.33
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.33
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.33
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.32
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.32
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.31
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.31
3qww_A433 SET and MYND domain-containing protein 2; methyltr 99.31
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.3
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.3
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.3
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.3
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.3
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 99.29
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.28
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.28
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.27
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.27
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.27
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.26
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.25
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.23
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.23
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.23
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.22
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.21
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.21
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.19
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.19
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.18
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.17
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.17
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.16
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.14
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.14
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.14
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.12
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.1
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.1
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.1
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.1
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.09
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.09
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.08
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.08
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.08
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.07
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.06
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.05
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.04
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.04
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.02
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.01
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.01
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.97
3k9i_A117 BH0479 protein; putative protein binding protein, 98.96
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.96
3k9i_A117 BH0479 protein; putative protein binding protein, 98.95
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.87
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.85
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.82
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.81
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.77
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.7
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.69
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.65
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.62
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.56
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.56
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.56
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.55
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.44
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.39
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 98.32
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.24
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 98.18
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.17
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.14
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.14
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.1
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.08
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.03
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 98.02
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 98.02
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 97.99
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.98
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 97.98
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.84
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.7
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 97.63
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 97.48
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.14
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 96.84
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 96.74
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 96.45
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 95.89
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 95.74
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 95.73
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.56
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 95.52
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 95.47
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 95.38
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.3
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 95.29
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 95.16
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 95.01
4b4t_S523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 94.87
4b4t_S523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 94.85
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 94.58
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 94.47
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 94.07
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 93.98
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 93.88
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 93.81
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 93.63
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 93.63
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 92.89
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 92.21
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 91.92
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 90.51
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 89.62
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 89.49
4b4t_O393 26S proteasome regulatory subunit RPN9; hydrolase, 88.38
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 87.6
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 87.55
4b4t_O393 26S proteasome regulatory subunit RPN9; hydrolase, 86.84
1o9d_A260 14-3-3-like protein C; protein-binding, fusicoccin 86.32
3re2_A472 Predicted protein; menin, multiple endocrine neopl 86.13
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 85.44
2o8p_A227 14-3-3 domain containing protein; signaling protei 84.78
3esl_A202 Checkpoint serine/threonine-protein kinase BUB1; m 84.16
1o9d_A260 14-3-3-like protein C; protein-binding, fusicoccin 84.11
3u84_A550 Menin; MLL, JUND, ledgf, TPR, transglutaminase-lik 83.63
4a5x_A86 MITD1, MIT domain-containing protein 1; protein tr 83.04
2o8p_A227 14-3-3 domain containing protein; signaling protei 82.85
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 82.19
3ubw_A261 14-3-3E, 14-3-3 protein epsilon; adapter protein, 82.18
4gq4_A489 Menin; tumor suppressor, nucleus, transcription-tr 81.13
3uzd_A248 14-3-3 protein gamma; structural genomics, SGC, st 80.87
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 80.81
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
Probab=100.00  E-value=5.4e-37  Score=324.82  Aligned_cols=385  Identities=19%  Similarity=0.210  Sum_probs=345.6

Q ss_pred             HHHHHHHHcCCCHHHHHHHHHHHHHHHHHhcCCCCCHhHHHHHHHHHHHHHHcCChHHHHHHHHHhcccchhhccccchH
Q 004812          226 KQARELISSGDNPQKALELALRAAKSFEIGANGKPSLELVMCLHVIAAIYCSLGQYNEAIPVLEQSIEIPVIEEGQEHAL  305 (729)
Q Consensus       226 ~~a~~~~~~g~~~~~A~~~~~~Al~~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~  305 (729)
                      .+|..++..|+ +++|+..+.++++..         |+...++..+|.++...|++++|+.++++++...     +..  
T Consensus         4 ~~a~~~~~~g~-~~~A~~~~~~~~~~~---------p~~~~~~~~l~~~~~~~~~~~~a~~~~~~a~~~~-----p~~--   66 (388)
T 1w3b_A            4 ELAHREYQAGD-FEAAERHCMQLWRQE---------PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQN-----PLL--   66 (388)
T ss_dssp             THHHHHHHHTC-HHHHHHHHHHHHHHC---------TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-----TTC--
T ss_pred             hHHHHHHHCCC-HHHHHHHHHHHHHhC---------CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcC-----CCc--
Confidence            56888999997 999999999988763         4456778899999999999999999999999875     333  


Q ss_pred             HHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHHhCCCCchHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHHHHhcCC
Q 004812          306 AKFAGHMQLGDTYAMLGQLENSLMCYTTGLEVQKQVLGETDPRVGETCRYLAEAHVQALQFSEAQKFCQMALDIHKDNGS  385 (729)
Q Consensus       306 ~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~  385 (729)
                        ..++..+|.++...|++++|+..|++++.+        +|....++..+|.++...|++++|+..|+++++..|... 
T Consensus        67 --~~~~~~lg~~~~~~g~~~~A~~~~~~al~~--------~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~-  135 (388)
T 1w3b_A           67 --AEAYSNLGNVYKERGQLQEAIEHYRHALRL--------KPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLY-  135 (388)
T ss_dssp             --HHHHHHHHHHHHHHTCHHHHHHHHHHHHHH--------CTTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCT-
T ss_pred             --hHHHHHHHHHHHHCCCHHHHHHHHHHHHHc--------CcchHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCcH-
Confidence              345999999999999999999999999998        788899999999999999999999999999999876543 


Q ss_pred             CCCHHHHHHHHHHHHHHHHhCCHHHHHHHHHHHHHHHHhCCCChhHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHh
Q 004812          386 PASLEEAADRRLMGLICETKGDHEAALEHLVLASMTMIANDQDAEVASVDCSIGDTYLSLSRYDEAGFAYQKALTAFKTN  465 (729)
Q Consensus       386 ~~~~~~a~~~~~lg~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~  465 (729)
                             .++..+|.++...|++++|+..|++++..      .|....++..+|.++...|++++|+.+|++++.+    
T Consensus       136 -------~~~~~l~~~~~~~g~~~~A~~~~~~al~~------~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~----  198 (388)
T 1w3b_A          136 -------CVRSDLGNLLKALGRLEEAKACYLKAIET------QPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTL----  198 (388)
T ss_dssp             -------HHHHHHHHHHHTTSCHHHHHHHHHHHHHH------CTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHH----
T ss_pred             -------HHHHHHHHHHHHccCHHHHHHHHHHHHHh------CCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhc----
Confidence                   56889999999999999999999999864      4556778999999999999999999999999998    


Q ss_pred             cCCCChhHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHhcCCCCCChHHHHHHHHHHHHHHHhcchHHHHHHHHHHHHH
Q 004812          466 KGENHPAVASVFVRLADMYNRTGKLRESKSYCENALRIYEKPVPGVPPEEIASGLTDVSSIYESMNELEQAIKLLQKALK  545 (729)
Q Consensus       466 ~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~  545 (729)
                          .|....++..+|.++...|++++|+..|++++.+         .|....++..+|.++...|++++|+..|++++.
T Consensus       199 ----~p~~~~~~~~lg~~~~~~~~~~~A~~~~~~al~~---------~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~  265 (388)
T 1w3b_A          199 ----DPNFLDAYINLGNVLKEARIFDRAVAAYLRALSL---------SPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIE  265 (388)
T ss_dssp             ----CTTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHH---------CTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHH
T ss_pred             ----CCCcHHHHHHHHHHHHHcCCHHHHHHHHHHHHhh---------CcCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHh
Confidence                7888899999999999999999999999999998         344467899999999999999999999999998


Q ss_pred             HHHhCCCCCCcHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHhCCCCChHHHHHHHHHHHHHHHcCCHHHHHHHHHH
Q 004812          546 IYNDAPGQQSTVAGIEAQMGVMYYMLGNYSDSYDSFKNAISKLRAIGERKSAFFGVALNQMGLACVQRYSINEAVELFEE  625 (729)
Q Consensus       546 ~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~  625 (729)
                      +.+..       ..++..+|.++...|++++|+.+|++++++.        +....++..+|.++...|++++|+.+|++
T Consensus       266 ~~p~~-------~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~--------p~~~~~~~~l~~~~~~~g~~~~A~~~~~~  330 (388)
T 1w3b_A          266 LQPHF-------PDAYCNLANALKEKGSVAEAEDCYNTALRLC--------PTHADSLNNLANIKREQGNIEEAVRLYRK  330 (388)
T ss_dssp             TCSSC-------HHHHHHHHHHHHHHSCHHHHHHHHHHHHHHC--------TTCHHHHHHHHHHHHTTTCHHHHHHHHHH
T ss_pred             hCCCC-------HHHHHHHHHHHHHcCCHHHHHHHHHHHHhhC--------cccHHHHHHHHHHHHHcCCHHHHHHHHHH
Confidence            75543       4678999999999999999999999999862        12356889999999999999999999999


Q ss_pred             HHHHHHHhcCCCChhHHHHHHHHHHHHHHcCChHHHHHHHHHHHHHHHHHcCCCChhHHHHHHHHHHHHHHhCC
Q 004812          626 ARSILEQECGPYHPDTLGVYSNLAGTYDAIGRLDDAIEILEFVVGIREEKLGTANPDVDDEKRRLAELLKEAGR  699 (729)
Q Consensus       626 al~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~p~~~~~~~~La~~~~~~g~  699 (729)
                      ++++        +|+...++..+|.+|...|++++|+.+|++++++        +|....+++.+|.++...|+
T Consensus       331 al~~--------~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~a~~~--------~p~~~~a~~~lg~~~~~~~~  388 (388)
T 1w3b_A          331 ALEV--------FPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRI--------SPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             HTTS--------CTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTT--------CTTCHHHHHHHHHHHHHTCC
T ss_pred             HHhc--------CCCcHHHHHHHHHHHHHcCCHHHHHHHHHHHHhh--------CCCCHHHHHhHHHHHHHccC
Confidence            9987        7888899999999999999999999999999975        68889999999999998874



>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4b4t_O 26S proteasome regulatory subunit RPN9; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_O 26S proteasome regulatory subunit RPN9; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1o9d_A 14-3-3-like protein C; protein-binding, fusicoccin, 14-3-3 family, activating drug; HET: TPO; 2.3A {Nicotiana tabacum} SCOP: a.118.7.1 PDB: 1o9c_A* 1o9e_A* 1o9f_A* 3e6y_A* Back     alignment and structure
>3re2_A Predicted protein; menin, multiple endocrine neoplasia 1, tumor suppressor, MIX lineage leukemia, unknown function; 1.95A {Nematostella vectensis} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>2o8p_A 14-3-3 domain containing protein; signaling protein, 14-3-3, cell regulator protein, cryptospo parvum, structural genomics; HET: MSE; 1.82A {Cryptosporidium parvum} SCOP: a.118.7.1 Back     alignment and structure
>3esl_A Checkpoint serine/threonine-protein kinase BUB1; mitotic spindle checkpoint, TPR motif, all-alpha domain, MAD3-like domain; HET: NHE; 1.74A {Saccharomyces cerevisiae} Back     alignment and structure
>1o9d_A 14-3-3-like protein C; protein-binding, fusicoccin, 14-3-3 family, activating drug; HET: TPO; 2.3A {Nicotiana tabacum} SCOP: a.118.7.1 PDB: 1o9c_A* 1o9e_A* 1o9f_A* 3e6y_A* Back     alignment and structure
>3u84_A Menin; MLL, JUND, ledgf, TPR, transglutaminase-like, transcription, epigenetics, cancer; 2.50A {Homo sapiens} PDB: 3u85_A 3u86_A 3u88_A* Back     alignment and structure
>4a5x_A MITD1, MIT domain-containing protein 1; protein transport, ESCRT, cytokinesis, midbody; HET: P15; 1.91A {Homo sapiens} Back     alignment and structure
>2o8p_A 14-3-3 domain containing protein; signaling protein, 14-3-3, cell regulator protein, cryptospo parvum, structural genomics; HET: MSE; 1.82A {Cryptosporidium parvum} SCOP: a.118.7.1 Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>3ubw_A 14-3-3E, 14-3-3 protein epsilon; adapter protein, signaling protein, signaling protein-protei complex; HET: SEP; 1.90A {Homo sapiens} Back     alignment and structure
>4gq4_A Menin; tumor suppressor, nucleus, transcription-transcription inhib complex; HET: 0RT EPE PE4; 1.27A {Homo sapiens} PDB: 4gq3_A* 4gpq_A* 4gq6_A* Back     alignment and structure
>3uzd_A 14-3-3 protein gamma; structural genomics, SGC, structural genomics consortium, MA alpha, phosphoserine, phosphothreonine; HET: SEP; 1.86A {Homo sapiens} PDB: 4e2e_A 2b05_A* 2c63_A* 2c74_A* 4dnk_A 4gnt_A 2bq0_A 2c23_A 2c1n_A* 2c1j_A* 2btp_A* Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 729
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 5e-23
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 0.004
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 1e-21
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 4e-21
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 3e-18
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 1e-06
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 1e-10
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 2e-10
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 2e-06
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 6e-10
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 7e-07
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 7e-05
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 2e-09
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 1e-07
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 0.001
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 0.004
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 2e-06
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 4e-06
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 2e-05
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 7e-05
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 2e-04
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 1e-04
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 0.004
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 1e-04
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 0.001
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 0.001
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 0.002
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 0.001
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 0.001
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 99.7 bits (247), Expect = 5e-23
 Identities = 57/475 (12%), Positives = 138/475 (29%), Gaps = 89/475 (18%)

Query: 224 LLKQARELISSGDNPQKALELALRAAKSFEIGANGKPSLELVMCLHVIAAIYCSLGQYNE 283
            ++ A     +GD  + A    ++  +            +    L ++++I+    + + 
Sbjct: 2   PMELAHREYQAGDF-EAAERHCMQLWRQEP---------DNTGVLLLLSSIHFQCRRLDR 51

Query: 284 AIPVLEQSIEIPVIEEGQEHALAKFAGHMQLGDTYAMLGQLENSLMCYTTGLEVQKQVLG 343
           +      +I+                 +  L + Y+ LG +          +E  +  L 
Sbjct: 52  SAHFSTLAIKQ----------------NPLLAEAYSNLGNVYKERGQLQEAIEHYRHALR 95

Query: 344 ETDPRVGETCRYLAEAHVQALQFSEAQKFCQMALDIHKDNGSPASLEEAADRRLMGLICE 403
                +       A            Q +                           +  +
Sbjct: 96  LKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDL---------------YCVRSD 140

Query: 404 TKGDHEAALEHLVLASMTMIANDQDAEVASVDCSIGDTYLSLSRYDEAGFAYQKALTAFK 463
                +A        +  + A +     A    ++G  + +      A   ++KA+    
Sbjct: 141 LGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAV---- 196

Query: 464 TNKGENHPAVASVFVRLADMYNRTGKLRESKSYCENALRIYEKPVPGVPPEEIASGLTDV 523
                  P     ++ L ++         + +    AL +             A    ++
Sbjct: 197 ----TLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNH---------AVVHGNL 243

Query: 524 SSIYESMNELEQAIKLLQKALKIYNDAPGQQSTVAGIEAQMGVMYYMLGNYSDSYDSFKN 583
           + +Y     ++ AI   ++A+++                 +       G+ +++ D +  
Sbjct: 244 ACVYYEQGLIDLAIDTYRRAIELQPH-------FPDAYCNLANALKEKGSVAEAEDCYNT 296

Query: 584 AISKLRAIGERKSAFFGVALNQMGLACVQRYSINEAVELFEEARSILEQECGPYHPDTLG 643
           A+        R       +LN +     ++ +I EAV L+ +A  +         P+   
Sbjct: 297 AL--------RLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEV--------FPEFAA 340

Query: 644 VYSNLAGTYDAIGRLDDAIEILEFVVGIREEKLGTANPDVDDEKRRLAELLKEAG 698
            +SNLA      G+L +A+   +  + I        +P   D    +   LKE  
Sbjct: 341 AHSNLASVLQQQGKLQEALMHYKEAIRI--------SPTFADAYSNMGNTLKEMQ 387


>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query729
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.92
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.91
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.9
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.9
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.8
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.79
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.75
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.73
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.72
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.72
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.71
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.71
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.49
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.46
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.42
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.38
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.37
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.35
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.34
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.33
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.31
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.31
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.28
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.27
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.26
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.26
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.26
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.25
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.24
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.23
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.23
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.23
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.23
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.22
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.22
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.21
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.2
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.2
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.17
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.16
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.08
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.01
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.94
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.93
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.91
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.81
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.61
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.48
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.44
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.21
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.76
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.73
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.4
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.18
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 95.54
d2o8pa1220 14-3-3 domain containing protein cgd7_2470 {Crypto 95.52
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 94.74
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 94.59
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 94.59
d1o9da_236 14-3-3-like protein C {Common tobacco (Nicotiana t 92.49
d2o02a1230 zeta isoform {Cow (Bos taurus) [TaxId: 9913]} 92.37
d2o02a1230 zeta isoform {Cow (Bos taurus) [TaxId: 9913]} 89.92
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 89.73
d1wfda_93 Hypothetical protein 1500032H18Rik {Mouse (Mus mus 88.24
d1o9da_236 14-3-3-like protein C {Common tobacco (Nicotiana t 86.18
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 83.27
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=3e-33  Score=292.58  Aligned_cols=387  Identities=19%  Similarity=0.213  Sum_probs=335.3

Q ss_pred             HHHHHHHHHHcCCCHHHHHHHHHHHHHHHHHhcCCCCCHhHHHHHHHHHHHHHHcCChHHHHHHHHHhcccchhhccccc
Q 004812          224 LLKQARELISSGDNPQKALELALRAAKSFEIGANGKPSLELVMCLHVIAAIYCSLGQYNEAIPVLEQSIEIPVIEEGQEH  303 (729)
Q Consensus       224 l~~~a~~~~~~g~~~~~A~~~~~~Al~~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~  303 (729)
                      ++.+|..+++.|+ |++|+..|+++++..         |....++..+|.+|...|++++|+.+|++++++.     +..
T Consensus         2 ll~la~~~~~~G~-~~~A~~~~~~~l~~~---------p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~-----p~~   66 (388)
T d1w3ba_           2 PMELAHREYQAGD-FEAAERHCMQLWRQE---------PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQN-----PLL   66 (388)
T ss_dssp             CCTHHHHHHHHTC-HHHHHHHHHHHHHHC---------TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-----TTC
T ss_pred             hHHHHHHHHHcCC-HHHHHHHHHHHHHhC---------CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-----CCC
Confidence            3568999999997 999999999999863         4456789999999999999999999999999885     443


Q ss_pred             hHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHHhCCCCchHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHHHHhc
Q 004812          304 ALAKFAGHMQLGDTYAMLGQLENSLMCYTTGLEVQKQVLGETDPRVGETCRYLAEAHVQALQFSEAQKFCQMALDIHKDN  383 (729)
Q Consensus       304 ~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~  383 (729)
                      +    .++..+|.+|..+|++++|+..+..++..        .+.........+........+..+..............
T Consensus        67 ~----~a~~~l~~~~~~~g~~~~A~~~~~~~~~~--------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  134 (388)
T d1w3ba_          67 A----EAYSNLGNVYKERGQLQEAIEHYRHALRL--------KPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDL  134 (388)
T ss_dssp             H----HHHHHHHHHHHHHTCHHHHHHHHHHHHHH--------CTTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTC
T ss_pred             H----HHHHHHHHHhhhhcccccccccccccccc--------cccccccccccccccccccccccccccccccccccccc
Confidence            3    35899999999999999999999999988        56777777888888888888888777776655544333


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHhCCHHHHHHHHHHHHHHHHhCCCChhHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHH
Q 004812          384 GSPASLEEAADRRLMGLICETKGDHEAALEHLVLASMTMIANDQDAEVASVDCSIGDTYLSLSRYDEAGFAYQKALTAFK  463 (729)
Q Consensus       384 ~~~~~~~~a~~~~~lg~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~  463 (729)
                      .        ......+......+....+...+.+.+..      .+....++..+|.++...|++++|...+++++.+  
T Consensus       135 ~--------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~--  198 (388)
T d1w3ba_         135 Y--------CVRSDLGNLLKALGRLEEAKACYLKAIET------QPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTL--  198 (388)
T ss_dssp             T--------HHHHHHHHHHHTTSCHHHHHHHHHHHHHH------CTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHH--
T ss_pred             c--------cccccccccccccchhhhhHHHHHHhhcc------CcchhHHHHhhcccccccCcHHHHHHHHHHHHHh--
Confidence            2        34667778888889999999988877643      4556678899999999999999999999999998  


Q ss_pred             HhcCCCChhHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHhcCCCCCChHHHHHHHHHHHHHHHhcchHHHHHHHHHHH
Q 004812          464 TNKGENHPAVASVFVRLADMYNRTGKLRESKSYCENALRIYEKPVPGVPPEEIASGLTDVSSIYESMNELEQAIKLLQKA  543 (729)
Q Consensus       464 ~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~a  543 (729)
                            +|....++..+|.++...|++++|+..|+++...         .+.....+..+|.++...|++++|+.+|+++
T Consensus       199 ------~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~---------~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~a  263 (388)
T d1w3ba_         199 ------DPNFLDAYINLGNVLKEARIFDRAVAAYLRALSL---------SPNHAVVHGNLACVYYEQGLIDLAIDTYRRA  263 (388)
T ss_dssp             ------CTTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHH---------CTTCHHHHHHHHHHHHHTTCHHHHHHHHHHH
T ss_pred             ------CcccHHHHHHHhhhhhccccHHHHHHHHHHhHHH---------hhhHHHHHHHHHHHHHHCCCHHHHHHHHHHH
Confidence                  7888899999999999999999999999999988         2334667889999999999999999999999


Q ss_pred             HHHHHhCCCCCCcHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHhCCCCChHHHHHHHHHHHHHHHcCCHHHHHHHH
Q 004812          544 LKIYNDAPGQQSTVAGIEAQMGVMYYMLGNYSDSYDSFKNAISKLRAIGERKSAFFGVALNQMGLACVQRYSINEAVELF  623 (729)
Q Consensus       544 l~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~  623 (729)
                      +++.+..       ..++..+|.++...|++++|+..|+.++...        +.....+..+|.++...|++++|+.+|
T Consensus       264 l~~~p~~-------~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~--------~~~~~~~~~l~~~~~~~~~~~~A~~~~  328 (388)
T d1w3ba_         264 IELQPHF-------PDAYCNLANALKEKGSVAEAEDCYNTALRLC--------PTHADSLNNLANIKREQGNIEEAVRLY  328 (388)
T ss_dssp             HHTCSSC-------HHHHHHHHHHHHHHSCHHHHHHHHHHHHHHC--------TTCHHHHHHHHHHHHTTTCHHHHHHHH
T ss_pred             HHhCCCC-------HHHHHHHHHHHHHcCCHHHHHHHHHhhhccC--------CccchhhhHHHHHHHHCCCHHHHHHHH
Confidence            9876544       5788999999999999999999999988752        224578889999999999999999999


Q ss_pred             HHHHHHHHHhcCCCChhHHHHHHHHHHHHHHcCChHHHHHHHHHHHHHHHHHcCCCChhHHHHHHHHHHHHHHhCC
Q 004812          624 EEARSILEQECGPYHPDTLGVYSNLAGTYDAIGRLDDAIEILEFVVGIREEKLGTANPDVDDEKRRLAELLKEAGR  699 (729)
Q Consensus       624 ~~al~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~p~~~~~~~~La~~~~~~g~  699 (729)
                      ++++++        +|+...++..+|.+|..+|++++|+.+|++++++        +|+...++.+||.+|.++||
T Consensus       329 ~~al~~--------~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l--------~P~~~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         329 RKALEV--------FPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRI--------SPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             HHHTTS--------CTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTT--------CTTCHHHHHHHHHHHHHTCC
T ss_pred             HHHHHh--------CCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHh--------CCCCHHHHHHHHHHHHHcCC
Confidence            999998        8899999999999999999999999999999976        78889999999999999986



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o8pa1 a.118.7.1 (A:8-227) 14-3-3 domain containing protein cgd7_2470 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1o9da_ a.118.7.1 (A:) 14-3-3-like protein C {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2o02a1 a.118.7.1 (A:1-230) zeta isoform {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2o02a1 a.118.7.1 (A:1-230) zeta isoform {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o9da_ a.118.7.1 (A:) 14-3-3-like protein C {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure