Citrus Sinensis ID: 004834
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 728 | 2.2.26 [Sep-21-2011] | |||||||
| O64948 | 888 | Lon protease homolog 2, p | yes | no | 0.997 | 0.817 | 0.862 | 0.0 | |
| O04979 | 887 | Lon protease homolog 2, p | N/A | no | 0.995 | 0.817 | 0.853 | 0.0 | |
| B8BDV1 | 884 | Lon protease homolog 2, p | N/A | no | 0.993 | 0.817 | 0.833 | 0.0 | |
| Q0J032 | 884 | Lon protease homolog 2, p | yes | no | 0.993 | 0.817 | 0.833 | 0.0 | |
| P93647 | 885 | Lon protease homolog 2, p | N/A | no | 0.993 | 0.816 | 0.839 | 0.0 | |
| Q5PQY6 | 840 | Lon protease homolog 2, p | yes | no | 0.936 | 0.811 | 0.499 | 0.0 | |
| Q3SX23 | 852 | Lon protease homolog 2, p | yes | no | 0.938 | 0.801 | 0.502 | 0.0 | |
| Q9DBN5 | 852 | Lon protease homolog 2, p | yes | no | 0.968 | 0.827 | 0.477 | 0.0 | |
| Q3MIB4 | 852 | Lon protease homolog 2, p | yes | no | 0.939 | 0.802 | 0.490 | 0.0 | |
| Q86WA8 | 852 | Lon protease homolog 2, p | yes | no | 0.936 | 0.800 | 0.496 | 0.0 |
| >sp|O64948|LONP2_ARATH Lon protease homolog 2, peroxisomal OS=Arabidopsis thaliana GN=LON2 PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 1263 bits (3268), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 629/729 (86%), Positives = 677/729 (92%), Gaps = 3/729 (0%)
Query: 1 MTKIEMEQVEQDPDFIALSRQFKATAMELISVLEQKQKTGGRTKVLLETVPIHKLADIFV 60
MTK E+EQV+QDPDF+ALSRQFK TAMEL+SVLEQKQKTGGRTKVLLETVPIHKLADIFV
Sbjct: 162 MTKAELEQVKQDPDFVALSRQFKTTAMELVSVLEQKQKTGGRTKVLLETVPIHKLADIFV 221
Query: 61 ASFEISFEEQLVMLDSVDLKVRLSKATELVDRHLQSIRVAEKITQKVEGQLSKSQKEFLL 120
ASFE+SFEEQL MLDSVDLKVRLSKATELVDRHLQSIRVAEKITQKVEGQLSKSQKE+LL
Sbjct: 222 ASFEMSFEEQLSMLDSVDLKVRLSKATELVDRHLQSIRVAEKITQKVEGQLSKSQKEYLL 281
Query: 121 RQQMRAIKEELGDNDDDEDDLVALERKMQSAGMPSNIWKHVQKELRRLKKMQPQQPGYTS 180
RQQMRAIKEELGDNDDDEDD+ ALERKMQ+AGMPSNIWKH Q+ELRRLKKMQPQQPGY S
Sbjct: 282 RQQMRAIKEELGDNDDDEDDVAALERKMQAAGMPSNIWKHAQRELRRLKKMQPQQPGYNS 341
Query: 181 SRVYLELIADLPWEKASEEIDLDLKAAKERLDSDHYGLVRVKQRIIEYLAVRKLKPDARG 240
SRVYLEL+ADLPW+KASEE +LDLKAAKERLDSDHYGL +VKQRIIEYLAVRKLKPDARG
Sbjct: 342 SRVYLELLADLPWDKASEEHELDLKAAKERLDSDHYGLAKVKQRIIEYLAVRKLKPDARG 401
Query: 241 PVLCFVGPPGVGKTSLASSIASALGRKFIRISLGGVKDEADIRGHRRTYIGSMPGRLIDG 300
PVLCFVGPPGVGKTSLASSIA+ALGRKF+R+SLGGVKDEADIRGHRRTYIGSMPGRLIDG
Sbjct: 402 PVLCFVGPPGVGKTSLASSIAAALGRKFVRLSLGGVKDEADIRGHRRTYIGSMPGRLIDG 461
Query: 301 LKRVGVCNPVMLLDEIDKTGSDVRGDPASALLEVLDPEQNKTFNDHYLNVPFDLSKVIFV 360
LKRVGVCNPVMLLDEIDKTGSDVRGDPASALLEVLDPEQNK+FNDHYLNVP+DLSKV+FV
Sbjct: 462 LKRVGVCNPVMLLDEIDKTGSDVRGDPASALLEVLDPEQNKSFNDHYLNVPYDLSKVVFV 521
Query: 361 ATANRAQPIPPPLLDRMEVIELPGYTPEEKLRIAMRHLIPRVLDQHGLGSEFLQIPEAMV 420
ATANR QPIPPPLLDRME+IELPGYT EEKL+IAMRHLIPRVLDQHGL SEFL+IPEAMV
Sbjct: 522 ATANRVQPIPPPLLDRMELIELPGYTQEEKLKIAMRHLIPRVLDQHGLSSEFLKIPEAMV 581
Query: 421 KLVIQRYTREAGVRNLERNLAALARAAAVKVAEQEQEQALPSSKDVHRLGSPLLDNRLAD 480
K +IQRYTREAGVR+LERN A A A V E EQ+LP SKDV +L SPLL+ R+A+
Sbjct: 582 KNIIQRYTREAGVRSLERN--LAALARAAAVMVAEHEQSLPLSKDVQKLTSPLLNGRMAE 639
Query: 481 GAEVEMEVIPMGESTHEVSNTFRITSPLVVDEAMLEKVLGPPRFDDREAAERVAAPGISV 540
G EVEMEVIPMG + HE+ TF+ S LVVDE MLEK+LGPPRFDD EAA+RVA+ G+SV
Sbjct: 640 GGEVEMEVIPMGVNDHEIGGTFQSPSALVVDETMLEKILGPPRFDDSEAADRVASAGVSV 699
Query: 541 GLVWTNFGGEVQFVEATAMRGKGELHLTGQLGDVIKESAQIALTWVRARATDLQLVAEDG 600
GLVWT FGGEVQFVEAT+M GKGE+HLTGQLGDVIKESAQ+ALTWVRARA+D +L
Sbjct: 700 GLVWTTFGGEVQFVEATSMVGKGEMHLTGQLGDVIKESAQLALTWVRARASDFKLALAGD 759
Query: 601 MNLLQGRDIHIHFPAGAVPKDGPSAGVTLVTALVSLFSRKRVRADTAMTGEMTLRGLVLP 660
MN+L GRDIHIHFPAGAVPKDGPSAGVTLVTALVSLFS+KRVRADTAMTGEMTLRGLVLP
Sbjct: 760 MNVLDGRDIHIHFPAGAVPKDGPSAGVTLVTALVSLFSQKRVRADTAMTGEMTLRGLVLP 819
Query: 661 VGGVKDKILAAHRYGIKRVILPERNLKDLVEVPAAVLASLEIILAKRMEDVLEQAFEGGC 720
VGG+KDKILAAHRYGIKRVILP+RN KDLVEVPAAVL+SLE+ILAKRMEDVLE AFEGGC
Sbjct: 820 VGGIKDKILAAHRYGIKRVILPQRNSKDLVEVPAAVLSSLEVILAKRMEDVLENAFEGGC 879
Query: 721 PWR-QHSKL 728
PWR +SKL
Sbjct: 880 PWRNNYSKL 888
|
ATP-dependent serine protease that mediates the selective degradation of misfolded and unassembled polypeptides in the peroxisomal matrix (By similarity). Necessary for type 2 peroxisome targeting signal (PTS2)-containing protein processing and facilitates peroxisome matrix protein import. Arabidopsis thaliana (taxid: 3702) EC: 3EC: .EC: 4EC: .EC: 2EC: 1EC: .EC: - |
| >sp|O04979|LONP2_SPIOL Lon protease homolog 2, peroxisomal OS=Spinacia oleracea PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|B8BDV1|LONP2_ORYSI Lon protease homolog 2, peroxisomal OS=Oryza sativa subsp. indica GN=LON1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q0J032|LONP2_ORYSJ Lon protease homolog 2, peroxisomal OS=Oryza sativa subsp. japonica GN=Os09g0533400 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P93647|LONP2_MAIZE Lon protease homolog 2, peroxisomal OS=Zea mays GN=LON1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q5PQY6|LONP2_DANRE Lon protease homolog 2, peroxisomal OS=Danio rerio GN=lonp2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q3SX23|LONP2_BOVIN Lon protease homolog 2, peroxisomal OS=Bos taurus GN=LONP2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9DBN5|LONP2_MOUSE Lon protease homolog 2, peroxisomal OS=Mus musculus GN=Lonp2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q3MIB4|LONP2_RAT Lon protease homolog 2, peroxisomal OS=Rattus norvegicus GN=Lonp2 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q86WA8|LONP2_HUMAN Lon protease homolog 2, peroxisomal OS=Homo sapiens GN=LONP2 PE=1 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 728 | ||||||
| 255575800 | 890 | ATP-dependent protease La, putative [Ric | 0.997 | 0.815 | 0.912 | 0.0 | |
| 224126585 | 893 | predicted protein [Populus trichocarpa] | 0.997 | 0.812 | 0.902 | 0.0 | |
| 224137996 | 893 | predicted protein [Populus trichocarpa] | 0.997 | 0.812 | 0.884 | 0.0 | |
| 147834823 | 904 | hypothetical protein VITISV_034238 [Viti | 0.997 | 0.803 | 0.890 | 0.0 | |
| 225427356 | 888 | PREDICTED: lon protease homolog 2, perox | 0.997 | 0.817 | 0.890 | 0.0 | |
| 357482271 | 883 | Lon protease-like protein [Medicago trun | 0.997 | 0.822 | 0.864 | 0.0 | |
| 297790979 | 888 | hypothetical protein ARALYDRAFT_494276 [ | 0.997 | 0.817 | 0.865 | 0.0 | |
| 449511525 | 816 | PREDICTED: lon protease homolog 2, perox | 0.994 | 0.887 | 0.888 | 0.0 | |
| 449464900 | 886 | PREDICTED: lon protease homolog 2, perox | 0.994 | 0.817 | 0.887 | 0.0 | |
| 18422747 | 888 | ATP-dependent Lon protease [Arabidopsis | 0.997 | 0.817 | 0.862 | 0.0 |
| >gi|255575800|ref|XP_002528799.1| ATP-dependent protease La, putative [Ricinus communis] gi|223531802|gb|EEF33621.1| ATP-dependent protease La, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 1322 bits (3422), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 664/728 (91%), Positives = 694/728 (95%), Gaps = 2/728 (0%)
Query: 1 MTKIEMEQVEQDPDFIALSRQFKATAMELISVLEQKQKTGGRTKVLLETVPIHKLADIFV 60
MTK EMEQVEQDPDF++LSRQFKATAMELISVLEQKQKT GRTKVLLETVPIHKLADIFV
Sbjct: 165 MTKAEMEQVEQDPDFVSLSRQFKATAMELISVLEQKQKTDGRTKVLLETVPIHKLADIFV 224
Query: 61 ASFEISFEEQLVMLDSVDLKVRLSKATELVDRHLQSIRVAEKITQKVEGQLSKSQKEFLL 120
ASFE+SFEEQL MLDS+DLK+RLSKATELVDRHLQSIRVAEKI+QKVEGQLSKSQKEFLL
Sbjct: 225 ASFEMSFEEQLSMLDSIDLKIRLSKATELVDRHLQSIRVAEKISQKVEGQLSKSQKEFLL 284
Query: 121 RQQMRAIKEELGDNDDDEDDLVALERKMQSAGMPSNIWKHVQKELRRLKKMQPQQPGYTS 180
RQQMRAIKEELGDNDDDEDD+ ALERKMQSAGMPSNIWKH Q+ELRRLKKMQPQQPGY S
Sbjct: 285 RQQMRAIKEELGDNDDDEDDVAALERKMQSAGMPSNIWKHAQRELRRLKKMQPQQPGYNS 344
Query: 181 SRVYLELIADLPWEKASEEIDLDLKAAKERLDSDHYGLVRVKQRIIEYLAVRKLKPDARG 240
SRVYLEL+ADLPW+K SEE DLDLKAAKERLDSDHYGLV+VKQRIIEYLAVRKLKPDARG
Sbjct: 345 SRVYLELLADLPWQKDSEEHDLDLKAAKERLDSDHYGLVKVKQRIIEYLAVRKLKPDARG 404
Query: 241 PVLCFVGPPGVGKTSLASSIASALGRKFIRISLGGVKDEADIRGHRRTYIGSMPGRLIDG 300
PVLCFVGPPGVGKTSLASSIA+ALGRKF+R+SLGGVKDEADIRGHRRTYIGSMPGRLIDG
Sbjct: 405 PVLCFVGPPGVGKTSLASSIATALGRKFVRLSLGGVKDEADIRGHRRTYIGSMPGRLIDG 464
Query: 301 LKRVGVCNPVMLLDEIDKTGSDVRGDPASALLEVLDPEQNKTFNDHYLNVPFDLSKVIFV 360
LKRVGVCNPVMLLDEIDKTGSDVRGDPASALLEVLDPEQNKTFNDHYLNVPFDLSKVIFV
Sbjct: 465 LKRVGVCNPVMLLDEIDKTGSDVRGDPASALLEVLDPEQNKTFNDHYLNVPFDLSKVIFV 524
Query: 361 ATANRAQPIPPPLLDRMEVIELPGYTPEEKLRIAMRHLIPRVLDQHGLGSEFLQIPEAMV 420
ATANRAQPIPPPLLDRMEVIELPGYTPEEKLRIAMRHLIPRVLDQHGLGSEFLQIPEAMV
Sbjct: 525 ATANRAQPIPPPLLDRMEVIELPGYTPEEKLRIAMRHLIPRVLDQHGLGSEFLQIPEAMV 584
Query: 421 KLVIQRYTREAGVRNLERNLAALARAAAVKVAEQEQEQALPSSKDVHRLGSPLLDNRLAD 480
KLVIQRYTREAGVRNLER + A A A V EQEQALP SK++HRL SPLL+NRLAD
Sbjct: 585 KLVIQRYTREAGVRNLER--SLAALARAAAVRLAEQEQALPLSKNMHRLASPLLENRLAD 642
Query: 481 GAEVEMEVIPMGESTHEVSNTFRITSPLVVDEAMLEKVLGPPRFDDREAAERVAAPGISV 540
GAEVEMEVIPM ++ HE+SN+FR+ S LVVDEAMLEKVLGPPRFDD+EAAERVA+PGISV
Sbjct: 643 GAEVEMEVIPMSDNNHELSNSFRVASALVVDEAMLEKVLGPPRFDDKEAAERVASPGISV 702
Query: 541 GLVWTNFGGEVQFVEATAMRGKGELHLTGQLGDVIKESAQIALTWVRARATDLQLVAEDG 600
GLVWT FGGEVQFVEATAM GKG+LHLTGQLGDVIKESAQIALTWVRARATDLQ A
Sbjct: 703 GLVWTAFGGEVQFVEATAMAGKGDLHLTGQLGDVIKESAQIALTWVRARATDLQFAAAHE 762
Query: 601 MNLLQGRDIHIHFPAGAVPKDGPSAGVTLVTALVSLFSRKRVRADTAMTGEMTLRGLVLP 660
+NLL+GRDIHIHFPAGAVPKDGPSAGVTLVTALVSLFSRKRVRADTAMTGEMTLRGLVLP
Sbjct: 763 INLLEGRDIHIHFPAGAVPKDGPSAGVTLVTALVSLFSRKRVRADTAMTGEMTLRGLVLP 822
Query: 661 VGGVKDKILAAHRYGIKRVILPERNLKDLVEVPAAVLASLEIILAKRMEDVLEQAFEGGC 720
VGG+KDKILAAHRYGIKRVILPERNLKDLVEVPAAVL SLEI+LAKRMEDVLEQAFEGGC
Sbjct: 823 VGGIKDKILAAHRYGIKRVILPERNLKDLVEVPAAVLGSLEILLAKRMEDVLEQAFEGGC 882
Query: 721 PWRQHSKL 728
PWR HSKL
Sbjct: 883 PWRIHSKL 890
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224126585|ref|XP_002329591.1| predicted protein [Populus trichocarpa] gi|222870300|gb|EEF07431.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224137996|ref|XP_002326492.1| predicted protein [Populus trichocarpa] gi|222833814|gb|EEE72291.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|147834823|emb|CAN75012.1| hypothetical protein VITISV_034238 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225427356|ref|XP_002282657.1| PREDICTED: lon protease homolog 2, peroxisomal [Vitis vinifera] gi|297742183|emb|CBI33970.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357482271|ref|XP_003611421.1| Lon protease-like protein [Medicago truncatula] gi|355512756|gb|AES94379.1| Lon protease-like protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|297790979|ref|XP_002863374.1| hypothetical protein ARALYDRAFT_494276 [Arabidopsis lyrata subsp. lyrata] gi|297309209|gb|EFH39633.1| hypothetical protein ARALYDRAFT_494276 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|449511525|ref|XP_004163979.1| PREDICTED: lon protease homolog 2, peroxisomal-like, partial [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449464900|ref|XP_004150167.1| PREDICTED: lon protease homolog 2, peroxisomal-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|18422747|ref|NP_568675.1| ATP-dependent Lon protease [Arabidopsis thaliana] gi|3914002|sp|O64948.1|LONP2_ARATH RecName: Full=Lon protease homolog 2, peroxisomal gi|2935279|gb|AAC05085.1| Lon protease [Arabidopsis thaliana] gi|9759446|dbj|BAB10243.1| mitochondrial Lon protease homolog 1 precursor [Arabidopsis thaliana] gi|332008077|gb|AED95460.1| ATP-dependent Lon protease [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 728 | ||||||
| TAIR|locus:2171037 | 888 | LON2 "lon protease 2" [Arabido | 0.997 | 0.817 | 0.823 | 2.60000020455e-317 | |
| ZFIN|ZDB-GENE-041212-1 | 840 | lonp2 "lon peptidase 2, peroxi | 0.586 | 0.508 | 0.485 | 1.2e-173 | |
| UNIPROTKB|E2RG41 | 852 | LONP2 "Lon protease homolog" [ | 0.563 | 0.481 | 0.483 | 2.1e-167 | |
| RGD|1305466 | 852 | Lonp2 "lon peptidase 2, peroxi | 0.563 | 0.481 | 0.478 | 1e-165 | |
| UNIPROTKB|Q3SX23 | 852 | LONP2 "Lon protease homolog 2, | 0.943 | 0.806 | 0.470 | 3.8e-165 | |
| UNIPROTKB|Q86WA8 | 852 | LONP2 "Lon protease homolog 2, | 0.563 | 0.481 | 0.478 | 5.7e-165 | |
| MGI|MGI:1914137 | 852 | Lonp2 "lon peptidase 2, peroxi | 0.940 | 0.803 | 0.462 | 1.5e-163 | |
| UNIPROTKB|F1NYI8 | 844 | LONP2 "Lon protease homolog" [ | 0.960 | 0.828 | 0.457 | 9.3e-162 | |
| UNIPROTKB|B7ZKL7 | 808 | LONP2 "Lon protease homolog" [ | 0.549 | 0.495 | 0.469 | 1.3e-158 | |
| TIGR_CMR|GSU_3193 | 819 | GSU_3193 "ATP-dependent protea | 0.581 | 0.516 | 0.454 | 1.5e-153 |
| TAIR|locus:2171037 LON2 "lon protease 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 3043 (1076.2 bits), Expect = 2.6e-317, P = 2.6e-317
Identities = 600/729 (82%), Positives = 645/729 (88%)
Query: 1 MTKIEMEQVEQDPDFIALSRQFKATAMELISVLEQKQKTGGRTKVLLETVPIHKLADIFV 60
MTK E+EQV+QDPDF+ALSRQFK TAMEL+SVLEQKQKTGGRTKVLLETVPIHKLADIFV
Sbjct: 162 MTKAELEQVKQDPDFVALSRQFKTTAMELVSVLEQKQKTGGRTKVLLETVPIHKLADIFV 221
Query: 61 ASFEISFEEQLVMLDSVDLKVRLSKATELVDRHLQSIRVAEKITQKVEGQLSKSQKEFLL 120
ASFE+SFEEQL MLDSVDLKVRLSKATELVDRHLQSIRVAEKITQKVEGQLSKSQKE+LL
Sbjct: 222 ASFEMSFEEQLSMLDSVDLKVRLSKATELVDRHLQSIRVAEKITQKVEGQLSKSQKEYLL 281
Query: 121 RQQMRAIKXXXXXXXXXXXXXXXXXRKMQSAGMPSNIWKHVQKELRRLKKMQPQQPGYTS 180
RQQMRAIK RKMQ+AGMPSNIWKH Q+ELRRLKKMQPQQPGY S
Sbjct: 282 RQQMRAIKEELGDNDDDEDDVAALERKMQAAGMPSNIWKHAQRELRRLKKMQPQQPGYNS 341
Query: 181 SRVYLELIADLPWEKASEEIDLDLKAAKERLDSDHYGLVRVKQRIIEYLAVRKLKPDARG 240
SRVYLEL+ADLPW+KASEE +LDLKAAKERLDSDHYGL +VKQRIIEYLAVRKLKPDARG
Sbjct: 342 SRVYLELLADLPWDKASEEHELDLKAAKERLDSDHYGLAKVKQRIIEYLAVRKLKPDARG 401
Query: 241 PVLCFVGPPGVGKTSLASSIASALGRKFIRISLGGVKDEADIRGHRRTYIGSMPGRLIDG 300
PVLCFVGPPGVGKTSLASSIA+ALGRKF+R+SLGGVKDEADIRGHRRTYIGSMPGRLIDG
Sbjct: 402 PVLCFVGPPGVGKTSLASSIAAALGRKFVRLSLGGVKDEADIRGHRRTYIGSMPGRLIDG 461
Query: 301 LKRVGVCNPVMLLDEIDKTGSDVRGDPASALLEVLDPEQNKTFNDHYLNVPFDLSKVIFV 360
LKRVGVCNPVMLLDEIDKTGSDVRGDPASALLEVLDPEQNK+FNDHYLNVP+DLSKV+FV
Sbjct: 462 LKRVGVCNPVMLLDEIDKTGSDVRGDPASALLEVLDPEQNKSFNDHYLNVPYDLSKVVFV 521
Query: 361 ATANRAQPIPPPLLDRMEVIELPGYTPEEKLRIAMRHLIPRVLDQHGLGSEFLQIPEAMV 420
ATANR QPIPPPLLDRME+IELPGYT EEKL+IAMRHLIPRVLDQHGL SEFL+IPEAMV
Sbjct: 522 ATANRVQPIPPPLLDRMELIELPGYTQEEKLKIAMRHLIPRVLDQHGLSSEFLKIPEAMV 581
Query: 421 KLVIQRYTREAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXPSSKDVHRLGSPLLDNRLAD 480
K +IQRYTREAG P SKDV +L SPLL+ R+A+
Sbjct: 582 KNIIQRYTREAGVRSLERNLAALARAAAVMVAEHEQSL--PLSKDVQKLTSPLLNGRMAE 639
Query: 481 GAEVEMEVIPMGESTHEVSNTFRITSPLVVDEAMLEKVLGPPRFDDREAAERVAAPGISV 540
G EVEMEVIPMG + HE+ TF+ S LVVDE MLEK+LGPPRFDD EAA+RVA+ G+SV
Sbjct: 640 GGEVEMEVIPMGVNDHEIGGTFQSPSALVVDETMLEKILGPPRFDDSEAADRVASAGVSV 699
Query: 541 GLVWTNFGGEVQFVEATAMRGKGELHLTGQLGDVIKESAQIALTWVRARATDLQLVAEDG 600
GLVWT FGGEVQFVEAT+M GKGE+HLTGQLGDVIKESAQ+ALTWVRARA+D +L
Sbjct: 700 GLVWTTFGGEVQFVEATSMVGKGEMHLTGQLGDVIKESAQLALTWVRARASDFKLALAGD 759
Query: 601 MNLLQGRDIHIHFPAGAVPKDGPSAGVTLVTALVSLFSRKRVRADTAMTGEMTLRGLVLP 660
MN+L GRDIHIHFPAGAVPKDGPSAGVTLVTALVSLFS+KRVRADTAMTGEMTLRGLVLP
Sbjct: 760 MNVLDGRDIHIHFPAGAVPKDGPSAGVTLVTALVSLFSQKRVRADTAMTGEMTLRGLVLP 819
Query: 661 VGGVKDKILAAHRYGIKRVILPERNLKDLVEVPAAVLASLEIILAKRMEDVLEQAFEGGC 720
VGG+KDKILAAHRYGIKRVILP+RN KDLVEVPAAVL+SLE+ILAKRMEDVLE AFEGGC
Sbjct: 820 VGGIKDKILAAHRYGIKRVILPQRNSKDLVEVPAAVLSSLEVILAKRMEDVLENAFEGGC 879
Query: 721 PWRQ-HSKL 728
PWR +SKL
Sbjct: 880 PWRNNYSKL 888
|
|
| ZFIN|ZDB-GENE-041212-1 lonp2 "lon peptidase 2, peroxisomal" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RG41 LONP2 "Lon protease homolog" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| RGD|1305466 Lonp2 "lon peptidase 2, peroxisomal" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3SX23 LONP2 "Lon protease homolog 2, peroxisomal" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q86WA8 LONP2 "Lon protease homolog 2, peroxisomal" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1914137 Lonp2 "lon peptidase 2, peroxisomal" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NYI8 LONP2 "Lon protease homolog" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B7ZKL7 LONP2 "Lon protease homolog" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_3193 GSU_3193 "ATP-dependent protease La" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| B8BDV1 | LONP2_ORYSI | 3, ., 4, ., 2, 1, ., - | 0.8337 | 0.9931 | 0.8178 | N/A | no |
| Q3SX23 | LONP2_BOVIN | 3, ., 4, ., 2, 1, ., - | 0.5028 | 0.9381 | 0.8016 | yes | no |
| Q86WA8 | LONP2_HUMAN | 3, ., 4, ., 2, 1, ., - | 0.4964 | 0.9368 | 0.8004 | yes | no |
| Q5PQY6 | LONP2_DANRE | 3, ., 4, ., 2, 1, ., - | 0.4993 | 0.9368 | 0.8119 | yes | no |
| Q3MIB4 | LONP2_RAT | 3, ., 4, ., 2, 1, ., - | 0.4908 | 0.9395 | 0.8028 | yes | no |
| P93647 | LONP2_MAIZE | 3, ., 4, ., 2, 1, ., - | 0.8392 | 0.9931 | 0.8169 | N/A | no |
| B8EMF2 | LON_METSB | 3, ., 4, ., 2, 1, ., 5, 3 | 0.4323 | 0.8942 | 0.8037 | yes | no |
| A4XJL4 | LON_CALS8 | 3, ., 4, ., 2, 1, ., 5, 3 | 0.4600 | 0.8818 | 0.8294 | yes | no |
| P36774 | LON2_MYXXA | 3, ., 4, ., 2, 1, ., 5, 3 | 0.5216 | 0.8420 | 0.7412 | yes | no |
| Q9DBN5 | LONP2_MOUSE | 3, ., 4, ., 2, 1, ., - | 0.4777 | 0.9684 | 0.8274 | yes | no |
| O64948 | LONP2_ARATH | 3, ., 4, ., 2, 1, ., - | 0.8628 | 0.9972 | 0.8175 | yes | no |
| B2TFQ5 | LON_BURPP | 3, ., 4, ., 2, 1, ., 5, 3 | 0.4311 | 0.8969 | 0.8121 | yes | no |
| O04979 | LONP2_SPIOL | 3, ., 4, ., 2, 1, ., - | 0.8530 | 0.9958 | 0.8173 | N/A | no |
| Q0J032 | LONP2_ORYSJ | 3, ., 4, ., 2, 1, ., - | 0.8337 | 0.9931 | 0.8178 | yes | no |
| Q5R6M5 | LONP2_PONAB | 3, ., 4, ., 2, 1, ., - | 0.4922 | 0.9368 | 0.8004 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 3.4.21 | 0.921 |
| 3rd Layer | 3.4.21.53 | 0.914 |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 728 | |||
| TIGR00763 | 775 | TIGR00763, lon, ATP-dependent protease La | 0.0 | |
| COG0466 | 782 | COG0466, Lon, ATP-dependent Lon protease, bacteria | 0.0 | |
| PRK10787 | 784 | PRK10787, PRK10787, DNA-binding ATP-dependent prot | 0.0 | |
| pfam05362 | 205 | pfam05362, Lon_C, Lon protease (S16) C-terminal pr | 2e-91 | |
| pfam00004 | 131 | pfam00004, AAA, ATPase family associated with vari | 7e-28 | |
| TIGR00764 | 608 | TIGR00764, lon_rel, lon-related putative ATP-depen | 5e-23 | |
| TIGR02902 | 531 | TIGR02902, spore_lonB, ATP-dependent protease LonB | 2e-22 | |
| COG1067 | 647 | COG1067, LonB, Predicted ATP-dependent protease [P | 1e-21 | |
| PRK13765 | 637 | PRK13765, PRK13765, ATP-dependent protease Lon; Pr | 3e-21 | |
| TIGR02903 | 615 | TIGR02903, spore_lon_C, ATP-dependent protease, Lo | 5e-20 | |
| COG0714 | 329 | COG0714, COG0714, MoxR-like ATPases [General funct | 1e-15 | |
| cd00009 | 151 | cd00009, AAA, The AAA+ (ATPases Associated with a | 1e-12 | |
| pfam07728 | 135 | pfam07728, AAA_5, AAA domain (dynein-related subfa | 2e-09 | |
| COG0464 | 494 | COG0464, SpoVK, ATPases of the AAA+ class [Posttra | 2e-08 | |
| COG2256 | 436 | COG2256, MGS1, ATPase related to the helicase subu | 1e-07 | |
| PRK13342 | 413 | PRK13342, PRK13342, recombination factor protein R | 1e-07 | |
| PRK11823 | 446 | PRK11823, PRK11823, DNA repair protein RadA; Provi | 2e-07 | |
| COG1750 | 579 | COG1750, COG1750, Archaeal serine proteases [Gener | 4e-07 | |
| smart00382 | 148 | smart00382, AAA, ATPases associated with a variety | 1e-06 | |
| TIGR00416 | 454 | TIGR00416, sms, DNA repair protein RadA | 2e-06 | |
| PHA02544 | 316 | PHA02544, 44, clamp loader, small subunit; Provisi | 2e-06 | |
| pfam07724 | 168 | pfam07724, AAA_2, AAA domain (Cdc48 subfamily) | 4e-06 | |
| COG2255 | 332 | COG2255, RuvB, Holliday junction resolvasome, heli | 5e-06 | |
| TIGR02653 | 675 | TIGR02653, Lon_rel_chp, conserved hypothetical pro | 6e-06 | |
| TIGR02639 | 730 | TIGR02639, ClpA, ATP-dependent Clp protease ATP-bi | 6e-06 | |
| TIGR03345 | 852 | TIGR03345, VI_ClpV1, type VI secretion ATPase, Clp | 8e-06 | |
| COG1066 | 456 | COG1066, Sms, Predicted ATP-dependent serine prote | 3e-05 | |
| TIGR00635 | 305 | TIGR00635, ruvB, Holliday junction DNA helicase, R | 3e-05 | |
| pfam07726 | 131 | pfam07726, AAA_3, ATPase family associated with va | 3e-05 | |
| pfam13541 | 121 | pfam13541, ChlI, Subunit ChlI of Mg-chelatase | 4e-05 | |
| COG4930 | 683 | COG4930, COG4930, Predicted ATP-dependent Lon-type | 4e-05 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 7e-05 | |
| COG0542 | 786 | COG0542, clpA, ATP-binding subunits of Clp proteas | 6e-04 | |
| PRK11034 | 758 | PRK11034, clpA, ATP-dependent Clp protease ATP-bin | 9e-04 | |
| pfam02190 | 191 | pfam02190, LON, ATP-dependent protease La (LON) do | 0.001 | |
| pfam00910 | 105 | pfam00910, RNA_helicase, RNA helicase | 0.002 | |
| COG1484 | 254 | COG1484, DnaC, DNA replication protein [DNA replic | 0.002 | |
| PRK10733 | 644 | PRK10733, hflB, ATP-dependent metalloprotease; Rev | 0.002 | |
| TIGR03922 | 557 | TIGR03922, T7SS_EccA, type VII secretion AAA-ATPas | 0.002 | |
| PRK00080 | 328 | PRK00080, ruvB, Holliday junction DNA helicase Ruv | 0.002 | |
| cd00267 | 157 | cd00267, ABC_ATPase, ATP-binding cassette transpor | 0.002 | |
| COG4088 | 261 | COG4088, COG4088, Predicted nucleotide kinase [Nuc | 0.003 |
| >gnl|CDD|233119 TIGR00763, lon, ATP-dependent protease La | Back alignment and domain information |
|---|
Score = 954 bits (2469), Expect = 0.0
Identities = 356/717 (49%), Positives = 474/717 (66%), Gaps = 51/717 (7%)
Query: 2 TKIEMEQVE-QDPDFIALSRQFKATAMELISVLEQKQKTGGRTKVLLETVPIHKLADIFV 60
++ E + D + AL+R+ K T ELIS+ + ++ L + +LAD
Sbjct: 108 DNLKEEPFDKDDEEIKALTREIKETFRELISLSKLFREQPALLSALEDIDEPGRLADFVA 167
Query: 61 ASFEIS-FEEQLVMLDSVDLKVRLSKATELVDRHLQSIRVAEKITQKVEGQLSKSQKEFL 119
AS ++ +E +L++V+++ RL KA EL+ + L+ +++ KIT+KVE ++ K+Q+E+
Sbjct: 168 ASLQLKEKDELQEVLETVNIEKRLKKALELLKKELELLKLQNKITKKVEEKMEKTQREYY 227
Query: 120 LRQQMRAIKEELGDNDDDEDDLVALERKMQSAGMPSNIWKHVQKELRRLKKMQPQQPGYT 179
LR+Q++AIK+ELG DD+D+L L+ K++ +P + K ++KEL +L ++P +T
Sbjct: 228 LREQLKAIKKELGIEKDDKDELEKLKEKLEELKLPEEVKKVIEKELTKLSLLEPSSSEFT 287
Query: 180 SSRVYLELIADLPWEKASEEIDLDLKAAKERLDSDHYGLVRVKQRIIEYLAVRKLKPDAR 239
+R YL+ + DLPW K S+E +LDLK AKE LD DHYGL +VK+RI+EYLAV+KL+ +
Sbjct: 288 VTRNYLDWLTDLPWGKYSKE-NLDLKRAKEILDEDHYGLKKVKERILEYLAVQKLRGKMK 346
Query: 240 GPVLCFVGPPGVGKTSLASSIASALGRKFIRISLGGVKDEADIRGHRRTYIGSMPGRLID 299
GP+LC VGPPGVGKTSL SIA AL RKF+R SLGGV+DEA+IRGHRRTY+G+MPGR+I
Sbjct: 347 GPILCLVGPPGVGKTSLGKSIAKALNRKFVRFSLGGVRDEAEIRGHRRTYVGAMPGRIIQ 406
Query: 300 GLKRVGVCNPVMLLDEIDKTGSDVRGDPASALLEVLDPEQNKTFNDHYLNVPFDLSKVIF 359
GLK+ NP+ LLDEIDK GS RGDPASALLEVLDPEQN F+DHYL+VPFDLSKVIF
Sbjct: 407 GLKKAKTKNPLFLLDEIDKIGSSFRGDPASALLEVLDPEQNNAFSDHYLDVPFDLSKVIF 466
Query: 360 VATANRAQPIPPPLLDRMEVIELPGYTPEEKLRIAMRHLIPRVLDQHGLGSEFLQIPEAM 419
+ATAN IP PLLDRMEVIEL GYT EEKL IA ++LIP+ L+ HGL + L+I +
Sbjct: 467 IATANSIDTIPRPLLDRMEVIELSGYTEEEKLEIAKKYLIPKALEDHGLKPDELKITDEA 526
Query: 420 VKLVIQRYTREAGVRNLERNLAALARAAAVKVAEQEQEQALPSSKDVHRLGSPLLDNRLA 479
+ L+I+ YTREAGVRNLER + + R AAVK+ EQ
Sbjct: 527 LLLLIKYYTREAGVRNLERQIEKICRKAAVKLVEQG------------------------ 562
Query: 480 DGAEVEMEVIPMGESTHEVSNTFRITSPLVVDEAMLEKVLGPPRFDDREAAERVAAPGIS 539
E + +V+ L+K LG P F E A V PG+
Sbjct: 563 ---EKKKSEA----------------ESVVITPDNLKKYLGKPVFTY-ERAYEVTPPGVV 602
Query: 540 VGLVWTNFGGEVQFVEATAMRGKGELHLTGQLGDVIKESAQIALTWVRARATDLQLVAED 599
+GL WT GG+ F+E T + GKG L LTGQLGDV+KESAQIALT+VR+ A DL +
Sbjct: 603 MGLAWTPMGGDTLFIETTKVAGKGSLELTGQLGDVMKESAQIALTYVRSIAADLGI---- 658
Query: 600 GMNLLQGRDIHIHFPAGAVPKDGPSAGVTLVTALVSLFSRKRVRADTAMTGEMTLRGLVL 659
N + DIH+H P GA PKDGPSAG+T+ TAL+SL + K VR D AMTGE+TLRG VL
Sbjct: 659 SPNFFEKADIHLHVPEGATPKDGPSAGITMATALLSLATGKPVRPDVAMTGEITLRGKVL 718
Query: 660 PVGGVKDKILAAHRYGIKRVILPERNLKDLVEVPAAVLASLEIILAKRMEDVLEQAF 716
P+GG+K+K +AA R GIK +ILPE+N +DL E+P V LEI K ++VL++AF
Sbjct: 719 PIGGLKEKTIAAKRAGIKTIILPEKNRRDLEELPENVKEGLEIHFVKHYDEVLKKAF 775
|
This protein is induced by heat shock and other stresses in E. coli, B. subtilis, and other species. The yeast member, designated PIM1, is located in the mitochondrial matrix, required for mitochondrial function, and also induced by heat shock [Protein fate, Degradation of proteins, peptides, and glycopeptides]. Length = 775 |
| >gnl|CDD|223542 COG0466, Lon, ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|182730 PRK10787, PRK10787, DNA-binding ATP-dependent protease La; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|191262 pfam05362, Lon_C, Lon protease (S16) C-terminal proteolytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) | Back alignment and domain information |
|---|
| >gnl|CDD|233120 TIGR00764, lon_rel, lon-related putative ATP-dependent protease | Back alignment and domain information |
|---|
| >gnl|CDD|131948 TIGR02902, spore_lonB, ATP-dependent protease LonB | Back alignment and domain information |
|---|
| >gnl|CDD|223994 COG1067, LonB, Predicted ATP-dependent protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|237495 PRK13765, PRK13765, ATP-dependent protease Lon; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234053 TIGR02903, spore_lon_C, ATP-dependent protease, Lon family | Back alignment and domain information |
|---|
| >gnl|CDD|223786 COG0714, COG0714, MoxR-like ATPases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >gnl|CDD|219538 pfam07728, AAA_5, AAA domain (dynein-related subfamily) | Back alignment and domain information |
|---|
| >gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|225165 COG2256, MGS1, ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|237355 PRK13342, PRK13342, recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236994 PRK11823, PRK11823, DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224664 COG1750, COG1750, Archaeal serine proteases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >gnl|CDD|232966 TIGR00416, sms, DNA repair protein RadA | Back alignment and domain information |
|---|
| >gnl|CDD|222866 PHA02544, 44, clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219536 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) | Back alignment and domain information |
|---|
| >gnl|CDD|225164 COG2255, RuvB, Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|131701 TIGR02653, Lon_rel_chp, conserved hypothetical protein | Back alignment and domain information |
|---|
| >gnl|CDD|233959 TIGR02639, ClpA, ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >gnl|CDD|234172 TIGR03345, VI_ClpV1, type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >gnl|CDD|223993 COG1066, Sms, Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|129721 TIGR00635, ruvB, Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >gnl|CDD|116340 pfam07726, AAA_3, ATPase family associated with various cellular activities (AAA) | Back alignment and domain information |
|---|
| >gnl|CDD|205719 pfam13541, ChlI, Subunit ChlI of Mg-chelatase | Back alignment and domain information |
|---|
| >gnl|CDD|227267 COG4930, COG4930, Predicted ATP-dependent Lon-type protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|223616 COG0542, clpA, ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|236828 PRK11034, clpA, ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216923 pfam02190, LON, ATP-dependent protease La (LON) domain | Back alignment and domain information |
|---|
| >gnl|CDD|216186 pfam00910, RNA_helicase, RNA helicase | Back alignment and domain information |
|---|
| >gnl|CDD|224401 COG1484, DnaC, DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|188437 TIGR03922, T7SS_EccA, type VII secretion AAA-ATPase EccA | Back alignment and domain information |
|---|
| >gnl|CDD|234619 PRK00080, ruvB, Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|226573 COG4088, COG4088, Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 728 | |||
| COG0466 | 782 | Lon ATP-dependent Lon protease, bacterial type [Po | 100.0 | |
| KOG2004 | 906 | consensus Mitochondrial ATP-dependent protease PIM | 100.0 | |
| PRK10787 | 784 | DNA-binding ATP-dependent protease La; Provisional | 100.0 | |
| TIGR00763 | 775 | lon ATP-dependent protease La. This protein is ind | 100.0 | |
| TIGR02902 | 531 | spore_lonB ATP-dependent protease LonB. Members of | 100.0 | |
| TIGR02903 | 615 | spore_lon_C ATP-dependent protease, Lon family. Me | 100.0 | |
| PRK13765 | 637 | ATP-dependent protease Lon; Provisional | 100.0 | |
| TIGR00764 | 608 | lon_rel lon-related putative ATP-dependent proteas | 100.0 | |
| TIGR02653 | 675 | Lon_rel_chp conserved hypothetical protein. This m | 100.0 | |
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 100.0 | |
| PF05362 | 204 | Lon_C: Lon protease (S16) C-terminal proteolytic d | 100.0 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 100.0 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 100.0 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 100.0 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 100.0 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 100.0 | |
| COG1066 | 456 | Sms Predicted ATP-dependent serine protease [Postt | 100.0 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 100.0 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 100.0 | |
| TIGR00416 | 454 | sms DNA repair protein RadA. The gene protuct code | 99.98 | |
| COG1067 | 647 | LonB Predicted ATP-dependent protease [Posttransla | 99.96 | |
| TIGR00368 | 499 | Mg chelatase-related protein. The N-terminal end m | 99.95 | |
| COG1222 | 406 | RPT1 ATP-dependent 26S proteasome regulatory subun | 99.95 | |
| KOG1051 | 898 | consensus Chaperone HSP104 and related ATP-depende | 99.95 | |
| KOG0730 | 693 | consensus AAA+-type ATPase [Posttranslational modi | 99.94 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 99.93 | |
| PF13541 | 121 | ChlI: Subunit ChlI of Mg-chelatase | 99.92 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 99.92 | |
| PRK05342 | 412 | clpX ATP-dependent protease ATP-binding subunit Cl | 99.92 | |
| KOG0738 | 491 | consensus AAA+-type ATPase [Posttranslational modi | 99.91 | |
| KOG0727 | 408 | consensus 26S proteasome regulatory complex, ATPas | 99.91 | |
| TIGR00382 | 413 | clpX endopeptidase Clp ATP-binding regulatory subu | 99.91 | |
| PRK09862 | 506 | putative ATP-dependent protease; Provisional | 99.91 | |
| COG1223 | 368 | Predicted ATPase (AAA+ superfamily) [General funct | 99.89 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 99.89 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 99.89 | |
| KOG0736 | 953 | consensus Peroxisome assembly factor 2 containing | 99.89 | |
| KOG0734 | 752 | consensus AAA+-type ATPase containing the peptidas | 99.88 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 99.88 | |
| KOG0728 | 404 | consensus 26S proteasome regulatory complex, ATPas | 99.86 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 99.86 | |
| KOG0731 | 774 | consensus AAA+-type ATPase containing the peptidas | 99.85 | |
| KOG0739 | 439 | consensus AAA+-type ATPase [Posttranslational modi | 99.85 | |
| COG0464 | 494 | SpoVK ATPases of the AAA+ class [Posttranslational | 99.85 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 99.84 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 99.84 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 99.84 | |
| PRK05201 | 443 | hslU ATP-dependent protease ATP-binding subunit Hs | 99.84 | |
| KOG0726 | 440 | consensus 26S proteasome regulatory complex, ATPas | 99.83 | |
| KOG0737 | 386 | consensus AAA+-type ATPase [Posttranslational modi | 99.83 | |
| KOG0735 | 952 | consensus AAA+-type ATPase [Posttranslational modi | 99.83 | |
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 99.83 | |
| TIGR00390 | 441 | hslU ATP-dependent protease HslVU, ATPase subunit. | 99.82 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 99.82 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 99.81 | |
| COG1219 | 408 | ClpX ATP-dependent protease Clp, ATPase subunit [P | 99.81 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 99.81 | |
| KOG0652 | 424 | consensus 26S proteasome regulatory complex, ATPas | 99.8 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 99.8 | |
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 99.79 | |
| KOG0729 | 435 | consensus 26S proteasome regulatory complex, ATPas | 99.79 | |
| CHL00176 | 638 | ftsH cell division protein; Validated | 99.79 | |
| COG0465 | 596 | HflB ATP-dependent Zn proteases [Posttranslational | 99.76 | |
| KOG0651 | 388 | consensus 26S proteasome regulatory complex, ATPas | 99.75 | |
| COG0606 | 490 | Predicted ATPase with chaperone activity [Posttran | 99.75 | |
| COG2255 | 332 | RuvB Holliday junction resolvasome, helicase subun | 99.75 | |
| COG4930 | 683 | Predicted ATP-dependent Lon-type protease [Posttra | 99.74 | |
| CHL00206 | 2281 | ycf2 Ycf2; Provisional | 99.74 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 99.74 | |
| KOG0740 | 428 | consensus AAA+-type ATPase [Posttranslational modi | 99.74 | |
| KOG0741 | 744 | consensus AAA+-type ATPase [Posttranslational modi | 99.73 | |
| PRK10733 | 644 | hflB ATP-dependent metalloprotease; Reviewed | 99.72 | |
| PF07724 | 171 | AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR | 99.72 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 99.71 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 99.71 | |
| KOG0745 | 564 | consensus Putative ATP-dependent Clp-type protease | 99.71 | |
| KOG0732 | 1080 | consensus AAA+-type ATPase containing the bromodom | 99.71 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 99.7 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 99.7 | |
| KOG0730 | 693 | consensus AAA+-type ATPase [Posttranslational modi | 99.69 | |
| KOG0989 | 346 | consensus Replication factor C, subunit RFC4 [Repl | 99.69 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 99.69 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 99.68 | |
| COG1220 | 444 | HslU ATP-dependent protease HslVU (ClpYQ), ATPase | 99.67 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 99.66 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 99.66 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 99.65 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 99.64 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 99.63 | |
| COG1750 | 579 | Archaeal serine proteases [General function predic | 99.62 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 99.62 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 99.61 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 99.61 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 99.61 | |
| TIGR01650 | 327 | PD_CobS cobaltochelatase, CobS subunit. This model | 99.61 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 99.6 | |
| KOG0742 | 630 | consensus AAA+-type ATPase [Posttranslational modi | 99.6 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 99.6 | |
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 99.6 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 99.59 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 99.59 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 99.59 | |
| KOG2028 | 554 | consensus ATPase related to the helicase subunit o | 99.59 | |
| PRK07764 | 824 | DNA polymerase III subunits gamma and tau; Validat | 99.58 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 99.58 | |
| PRK14952 | 584 | DNA polymerase III subunits gamma and tau; Provisi | 99.58 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 99.58 | |
| COG0714 | 329 | MoxR-like ATPases [General function prediction onl | 99.58 | |
| PF07726 | 131 | AAA_3: ATPase family associated with various cellu | 99.58 | |
| PRK14959 | 624 | DNA polymerase III subunits gamma and tau; Provisi | 99.58 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 99.57 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 99.57 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 99.57 | |
| PRK05563 | 559 | DNA polymerase III subunits gamma and tau; Validat | 99.56 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 99.56 | |
| PRK05896 | 605 | DNA polymerase III subunits gamma and tau; Validat | 99.56 | |
| PRK07133 | 725 | DNA polymerase III subunits gamma and tau; Validat | 99.55 | |
| PHA02244 | 383 | ATPase-like protein | 99.55 | |
| PRK14965 | 576 | DNA polymerase III subunits gamma and tau; Provisi | 99.55 | |
| PRK13531 | 498 | regulatory ATPase RavA; Provisional | 99.55 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 99.55 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 99.55 | |
| PRK14953 | 486 | DNA polymerase III subunits gamma and tau; Provisi | 99.54 | |
| COG2204 | 464 | AtoC Response regulator containing CheY-like recei | 99.54 | |
| TIGR02397 | 355 | dnaX_nterm DNA polymerase III, subunit gamma and t | 99.53 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 99.53 | |
| PRK13407 | 334 | bchI magnesium chelatase subunit I; Provisional | 99.53 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 99.53 | |
| PRK07940 | 394 | DNA polymerase III subunit delta'; Validated | 99.52 | |
| PRK08451 | 535 | DNA polymerase III subunits gamma and tau; Validat | 99.52 | |
| PRK06647 | 563 | DNA polymerase III subunits gamma and tau; Validat | 99.51 | |
| COG2812 | 515 | DnaX DNA polymerase III, gamma/tau subunits [DNA r | 99.51 | |
| PRK06305 | 451 | DNA polymerase III subunits gamma and tau; Validat | 99.51 | |
| PRK14948 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 99.51 | |
| COG3604 | 550 | FhlA Transcriptional regulator containing GAF, AAA | 99.51 | |
| KOG0743 | 457 | consensus AAA+-type ATPase [Posttranslational modi | 99.5 | |
| PRK14954 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 99.5 | |
| KOG0991 | 333 | consensus Replication factor C, subunit RFC2 [Repl | 99.5 | |
| PRK14970 | 367 | DNA polymerase III subunits gamma and tau; Provisi | 99.5 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 99.5 | |
| COG3829 | 560 | RocR Transcriptional regulator containing PAS, AAA | 99.5 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 99.49 | |
| PRK09111 | 598 | DNA polymerase III subunits gamma and tau; Validat | 99.49 | |
| KOG0744 | 423 | consensus AAA+-type ATPase [Posttranslational modi | 99.47 | |
| PRK14950 | 585 | DNA polymerase III subunits gamma and tau; Provisi | 99.46 | |
| PRK14971 | 614 | DNA polymerase III subunits gamma and tau; Provisi | 99.46 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 99.45 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 99.45 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 99.43 | |
| TIGR02974 | 329 | phageshock_pspF psp operon transcriptional activat | 99.43 | |
| CHL00081 | 350 | chlI Mg-protoporyphyrin IX chelatase | 99.42 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 99.42 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 99.42 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 99.41 | |
| TIGR01817 | 534 | nifA Nif-specific regulatory protein. This model r | 99.41 | |
| TIGR02030 | 337 | BchI-ChlI magnesium chelatase ATPase subunit I. Th | 99.41 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 99.41 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 99.41 | |
| PRK05022 | 509 | anaerobic nitric oxide reductase transcription reg | 99.41 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 99.41 | |
| PRK11331 | 459 | 5-methylcytosine-specific restriction enzyme subun | 99.4 | |
| PRK15424 | 538 | propionate catabolism operon regulatory protein Pr | 99.38 | |
| PRK11608 | 326 | pspF phage shock protein operon transcriptional ac | 99.37 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 99.36 | |
| smart00350 | 509 | MCM minichromosome maintenance proteins. | 99.36 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 99.35 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 99.35 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 99.34 | |
| TIGR02329 | 526 | propionate_PrpR propionate catabolism operon regul | 99.34 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 99.33 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 99.33 | |
| COG1224 | 450 | TIP49 DNA helicase TIP49, TBP-interacting protein | 99.32 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 99.32 | |
| PF06068 | 398 | TIP49: TIP49 C-terminus; InterPro: IPR010339 This | 99.32 | |
| COG1221 | 403 | PspF Transcriptional regulators containing an AAA- | 99.32 | |
| PRK10820 | 520 | DNA-binding transcriptional regulator TyrR; Provis | 99.32 | |
| TIGR00678 | 188 | holB DNA polymerase III, delta' subunit. At positi | 99.32 | |
| PF01078 | 206 | Mg_chelatase: Magnesium chelatase, subunit ChlI; I | 99.31 | |
| TIGR02442 | 633 | Cob-chelat-sub cobaltochelatase subunit. A number | 99.3 | |
| PRK15429 | 686 | formate hydrogenlyase transcriptional activator Fh | 99.29 | |
| PRK07399 | 314 | DNA polymerase III subunit delta'; Validated | 99.29 | |
| PRK05564 | 313 | DNA polymerase III subunit delta'; Validated | 99.29 | |
| PRK11388 | 638 | DNA-binding transcriptional regulator DhaR; Provis | 99.28 | |
| PRK09112 | 351 | DNA polymerase III subunit delta'; Validated | 99.28 | |
| PRK08727 | 233 | hypothetical protein; Validated | 99.28 | |
| COG3480 | 342 | SdrC Predicted secreted protein containing a PDZ d | 99.26 | |
| COG0470 | 325 | HolB ATPase involved in DNA replication [DNA repli | 99.25 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 99.24 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 99.24 | |
| PRK07471 | 365 | DNA polymerase III subunit delta'; Validated | 99.23 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 99.23 | |
| PTZ00111 | 915 | DNA replication licensing factor MCM4; Provisional | 99.22 | |
| PF13177 | 162 | DNA_pol3_delta2: DNA polymerase III, delta subunit | 99.22 | |
| TIGR02031 | 589 | BchD-ChlD magnesium chelatase ATPase subunit D. Th | 99.22 | |
| PF00158 | 168 | Sigma54_activat: Sigma-54 interaction domain; Inte | 99.21 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 99.2 | |
| PRK06620 | 214 | hypothetical protein; Validated | 99.2 | |
| PRK08058 | 329 | DNA polymerase III subunit delta'; Validated | 99.2 | |
| KOG0736 | 953 | consensus Peroxisome assembly factor 2 containing | 99.2 | |
| PRK09087 | 226 | hypothetical protein; Validated | 99.19 | |
| TIGR02915 | 445 | PEP_resp_reg putative PEP-CTERM system response re | 99.19 | |
| PRK04132 | 846 | replication factor C small subunit; Provisional | 99.18 | |
| PRK10923 | 469 | glnG nitrogen regulation protein NR(I); Provisiona | 99.18 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 99.15 | |
| PRK05707 | 328 | DNA polymerase III subunit delta'; Validated | 99.15 | |
| TIGR00368 | 499 | Mg chelatase-related protein. The N-terminal end m | 99.14 | |
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 99.12 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 99.11 | |
| PRK15115 | 444 | response regulator GlrR; Provisional | 99.11 | |
| COG1241 | 682 | MCM2 Predicted ATPase involved in replication cont | 99.1 | |
| KOG2035 | 351 | consensus Replication factor C, subunit RFC3 [Cell | 99.1 | |
| COG1239 | 423 | ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis | 99.1 | |
| PRK11361 | 457 | acetoacetate metabolism regulatory protein AtoC; P | 99.09 | |
| KOG0990 | 360 | consensus Replication factor C, subunit RFC5 [Repl | 99.08 | |
| COG0606 | 490 | Predicted ATPase with chaperone activity [Posttran | 99.07 | |
| PRK06871 | 325 | DNA polymerase III subunit delta'; Validated | 99.07 | |
| KOG2170 | 344 | consensus ATPase of the AAA+ superfamily [General | 99.06 | |
| TIGR01818 | 463 | ntrC nitrogen regulation protein NR(I). This model | 99.06 | |
| PF05673 | 249 | DUF815: Protein of unknown function (DUF815); Inte | 99.04 | |
| PRK08769 | 319 | DNA polymerase III subunit delta'; Validated | 99.03 | |
| PRK07993 | 334 | DNA polymerase III subunit delta'; Validated | 99.03 | |
| KOG0478 | 804 | consensus DNA replication licensing factor, MCM4 c | 99.02 | |
| PRK06964 | 342 | DNA polymerase III subunit delta'; Validated | 99.01 | |
| COG0593 | 408 | DnaA ATPase involved in DNA replication initiation | 99.0 | |
| KOG1942 | 456 | consensus DNA helicase, TBP-interacting protein [R | 98.99 | |
| PRK09862 | 506 | putative ATP-dependent protease; Provisional | 98.99 | |
| COG5271 | 4600 | MDN1 AAA ATPase containing von Willebrand factor t | 98.99 | |
| PRK06090 | 319 | DNA polymerase III subunit delta'; Validated | 98.99 | |
| KOG0735 | 952 | consensus AAA+-type ATPase [Posttranslational modi | 98.97 | |
| KOG1969 | 877 | consensus DNA replication checkpoint protein CHL12 | 98.97 | |
| TIGR00602 | 637 | rad24 checkpoint protein rad24. This family is bas | 98.95 | |
| PRK08181 | 269 | transposase; Validated | 98.94 | |
| KOG0480 | 764 | consensus DNA replication licensing factor, MCM6 c | 98.94 | |
| PF12775 | 272 | AAA_7: P-loop containing dynein motor region D3; P | 98.93 | |
| COG3283 | 511 | TyrR Transcriptional regulator of aromatic amino a | 98.92 | |
| PRK06526 | 254 | transposase; Provisional | 98.92 | |
| COG5271 | 4600 | MDN1 AAA ATPase containing von Willebrand factor t | 98.88 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 98.87 | |
| PRK10365 | 441 | transcriptional regulatory protein ZraR; Provision | 98.85 | |
| PRK05917 | 290 | DNA polymerase III subunit delta'; Validated | 98.83 | |
| PRK08699 | 325 | DNA polymerase III subunit delta'; Validated | 98.82 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 98.79 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 98.79 | |
| PRK15455 | 644 | PrkA family serine protein kinase; Provisional | 98.75 | |
| KOG2680 | 454 | consensus DNA helicase TIP49, TBP-interacting prot | 98.72 | |
| PRK13406 | 584 | bchD magnesium chelatase subunit D; Provisional | 98.72 | |
| PRK07276 | 290 | DNA polymerase III subunit delta'; Validated | 98.7 | |
| PRK08116 | 268 | hypothetical protein; Validated | 98.69 | |
| PF00493 | 331 | MCM: MCM2/3/5 family This family extends the MCM d | 98.68 | |
| PF05621 | 302 | TniB: Bacterial TniB protein; InterPro: IPR008868 | 98.67 | |
| COG3284 | 606 | AcoR Transcriptional activator of acetoin/glycerol | 98.65 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 98.65 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 98.64 | |
| PRK12377 | 248 | putative replication protein; Provisional | 98.63 | |
| KOG0482 | 721 | consensus DNA replication licensing factor, MCM7 c | 98.61 | |
| PF03215 | 519 | Rad17: Rad17 cell cycle checkpoint protein | 98.57 | |
| PRK05818 | 261 | DNA polymerase III subunit delta'; Validated | 98.54 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 98.53 | |
| COG2607 | 287 | Predicted ATPase (AAA+ superfamily) [General funct | 98.51 | |
| PRK07132 | 299 | DNA polymerase III subunit delta'; Validated | 98.51 | |
| ) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309 | 127 | Torsin: Torsin; InterPro: IPR010448 This family co | 98.5 | |
| KOG2227 | 529 | consensus Pre-initiation complex, subunit CDC6, AA | 98.5 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 98.49 | |
| PF13173 | 128 | AAA_14: AAA domain | 98.44 | |
| KOG1514 | 767 | consensus Origin recognition complex, subunit 1, a | 98.41 | |
| PF14532 | 138 | Sigma54_activ_2: Sigma-54 interaction domain; PDB: | 98.41 | |
| KOG0477 | 854 | consensus DNA replication licensing factor, MCM2 c | 98.35 | |
| PF12774 | 231 | AAA_6: Hydrolytic ATP binding site of dynein motor | 98.34 | |
| KOG0741 | 744 | consensus AAA+-type ATPase [Posttranslational modi | 98.33 | |
| PF08298 | 358 | AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi | 98.3 | |
| COG4650 | 531 | RtcR Sigma54-dependent transcription regulator con | 98.26 | |
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 98.25 | |
| KOG0479 | 818 | consensus DNA replication licensing factor, MCM3 c | 98.22 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 98.22 | |
| PF01637 | 234 | Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 | 98.13 | |
| KOG0481 | 729 | consensus DNA replication licensing factor, MCM5 c | 98.13 | |
| TIGR02688 | 449 | conserved hypothetical protein TIGR02688. Members | 98.12 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 98.09 | |
| COG1116 | 248 | TauB ABC-type nitrate/sulfonate/bicarbonate transp | 98.07 | |
| COG0464 | 494 | SpoVK ATPases of the AAA+ class [Posttranslational | 98.06 | |
| KOG1051 | 898 | consensus Chaperone HSP104 and related ATP-depende | 98.05 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 98.04 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 98.02 | |
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 97.99 | |
| KOG1970 | 634 | consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 | 97.98 | |
| KOG1808 | 1856 | consensus AAA ATPase containing von Willebrand fac | 97.96 | |
| PF05729 | 166 | NACHT: NACHT domain | 97.9 | |
| PRK06581 | 263 | DNA polymerase III subunit delta'; Validated | 97.84 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 97.76 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 97.75 | |
| PHA02774 | 613 | E1; Provisional | 97.71 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 97.7 | |
| PF03969 | 362 | AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 | 97.67 | |
| COG4619 | 223 | ABC-type uncharacterized transport system, ATPase | 97.6 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 97.6 | |
| PF00931 | 287 | NB-ARC: NB-ARC domain; InterPro: IPR002182 This is | 97.56 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 97.54 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 97.53 | |
| PF10431 | 81 | ClpB_D2-small: C-terminal, D2-small domain, of Clp | 97.53 | |
| COG3842 | 352 | PotA ABC-type spermidine/putrescine transport syst | 97.52 | |
| KOG2228 | 408 | consensus Origin recognition complex, subunit 4 [R | 97.51 | |
| PF03266 | 168 | NTPase_1: NTPase; InterPro: IPR004948 This entry r | 97.5 | |
| KOG1968 | 871 | consensus Replication factor C, subunit RFC1 (larg | 97.48 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 97.46 | |
| COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 97.45 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 97.45 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 97.42 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 97.41 | |
| PF05272 | 198 | VirE: Virulence-associated protein E; InterPro: IP | 97.39 | |
| PHA02624 | 647 | large T antigen; Provisional | 97.37 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 97.37 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 97.36 | |
| COG3854 | 308 | SpoIIIAA ncharacterized protein conserved in bacte | 97.31 | |
| KOG3347 | 176 | consensus Predicted nucleotide kinase/nuclear prot | 97.3 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 97.28 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 97.28 | |
| TIGR01613 | 304 | primase_Cterm phage/plasmid primase, P4 family, C- | 97.27 | |
| COG5245 | 3164 | DYN1 Dynein, heavy chain [Cytoskeleton] | 97.26 | |
| cd00267 | 157 | ABC_ATPase ABC (ATP-binding cassette) transporter | 97.23 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 97.23 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 97.23 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 97.22 | |
| PRK06995 | 484 | flhF flagellar biosynthesis regulator FlhF; Valida | 97.2 | |
| COG3267 | 269 | ExeA Type II secretory pathway, component ExeA (pr | 97.2 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 97.2 | |
| PF07693 | 325 | KAP_NTPase: KAP family P-loop domain; InterPro: IP | 97.17 | |
| PRK13947 | 171 | shikimate kinase; Provisional | 97.13 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 97.13 | |
| COG0703 | 172 | AroK Shikimate kinase [Amino acid transport and me | 97.13 | |
| cd03246 | 173 | ABCC_Protease_Secretion This family represents the | 97.13 | |
| cd01128 | 249 | rho_factor Transcription termination factor rho is | 97.12 | |
| COG3839 | 338 | MalK ABC-type sugar transport systems, ATPase comp | 97.12 | |
| PRK00625 | 173 | shikimate kinase; Provisional | 97.12 | |
| PRK03839 | 180 | putative kinase; Provisional | 97.11 | |
| cd00227 | 175 | CPT Chloramphenicol (Cm) phosphotransferase (CPT). | 97.1 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 97.09 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 97.09 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 97.09 | |
| cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 97.08 | |
| cd00464 | 154 | SK Shikimate kinase (SK) is the fifth enzyme in th | 97.04 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 97.0 | |
| PRK14530 | 215 | adenylate kinase; Provisional | 96.99 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 96.99 | |
| PRK13695 | 174 | putative NTPase; Provisional | 96.97 | |
| TIGR01618 | 220 | phage_P_loop phage nucleotide-binding protein. Thi | 96.96 | |
| PHA01747 | 425 | putative ATP-dependent protease | 96.96 | |
| PRK06696 | 223 | uridine kinase; Validated | 96.95 | |
| COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 96.94 | |
| PRK13949 | 169 | shikimate kinase; Provisional | 96.94 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 96.93 | |
| cd03214 | 180 | ABC_Iron-Siderophores_B12_Hemin ABC transporters, | 96.93 | |
| PRK14723 | 767 | flhF flagellar biosynthesis regulator FlhF; Provis | 96.9 | |
| cd03223 | 166 | ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass | 96.9 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 96.88 | |
| PRK13948 | 182 | shikimate kinase; Provisional | 96.87 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 96.87 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 96.86 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 96.86 | |
| TIGR02788 | 308 | VirB11 P-type DNA transfer ATPase VirB11. The VirB | 96.85 | |
| TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 96.84 | |
| PF14516 | 331 | AAA_35: AAA-like domain | 96.84 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 96.83 | |
| TIGR02858 | 270 | spore_III_AA stage III sporulation protein AA. Mem | 96.83 | |
| PRK14532 | 188 | adenylate kinase; Provisional | 96.83 | |
| PRK06217 | 183 | hypothetical protein; Validated | 96.8 | |
| TIGR01359 | 183 | UMP_CMP_kin_fam UMP-CMP kinase family. This subfam | 96.79 | |
| cd02020 | 147 | CMPK Cytidine monophosphate kinase (CMPK) catalyze | 96.79 | |
| TIGR00767 | 415 | rho transcription termination factor Rho. Members | 96.79 | |
| COG1102 | 179 | Cmk Cytidylate kinase [Nucleotide transport and me | 96.78 | |
| cd02021 | 150 | GntK Gluconate kinase (GntK) catalyzes the phospho | 96.78 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 96.74 | |
| PRK14531 | 183 | adenylate kinase; Provisional | 96.73 | |
| PF12780 | 268 | AAA_8: P-loop containing dynein motor region D4; I | 96.73 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 96.73 | |
| COG1124 | 252 | DppF ABC-type dipeptide/oligopeptide/nickel transp | 96.73 | |
| PRK05057 | 172 | aroK shikimate kinase I; Reviewed | 96.72 | |
| COG1373 | 398 | Predicted ATPase (AAA+ superfamily) [General funct | 96.72 | |
| COG1118 | 345 | CysA ABC-type sulfate/molybdate transport systems, | 96.71 | |
| PRK14737 | 186 | gmk guanylate kinase; Provisional | 96.71 | |
| TIGR01313 | 163 | therm_gnt_kin carbohydrate kinase, thermoresistant | 96.71 | |
| COG4133 | 209 | CcmA ABC-type transport system involved in cytochr | 96.7 | |
| PF05707 | 193 | Zot: Zonular occludens toxin (Zot); InterPro: IPR0 | 96.69 | |
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 96.68 | |
| PRK03731 | 171 | aroL shikimate kinase II; Reviewed | 96.64 | |
| PRK14527 | 191 | adenylate kinase; Provisional | 96.63 | |
| COG1134 | 249 | TagH ABC-type polysaccharide/polyol phosphate tran | 96.62 | |
| PRK14721 | 420 | flhF flagellar biosynthesis regulator FlhF; Provis | 96.62 | |
| PRK09376 | 416 | rho transcription termination factor Rho; Provisio | 96.61 | |
| COG0563 | 178 | Adk Adenylate kinase and related kinases [Nucleoti | 96.6 | |
| PRK13946 | 184 | shikimate kinase; Provisional | 96.59 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 96.59 | |
| PF00519 | 432 | PPV_E1_C: Papillomavirus helicase; InterPro: IPR00 | 96.59 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 96.57 | |
| COG4586 | 325 | ABC-type uncharacterized transport system, ATPase | 96.57 | |
| PTZ00202 | 550 | tuzin; Provisional | 96.57 | |
| PRK06547 | 172 | hypothetical protein; Provisional | 96.56 | |
| PRK10078 | 186 | ribose 1,5-bisphosphokinase; Provisional | 96.56 | |
| cd01428 | 194 | ADK Adenylate kinase (ADK) catalyzes the reversibl | 96.54 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 96.52 | |
| KOG0058 | 716 | consensus Peptide exporter, ABC superfamily [Intra | 96.51 | |
| PRK14700 | 300 | recombination factor protein RarA; Provisional | 96.51 | |
| PF10923 | 416 | DUF2791: P-loop Domain of unknown function (DUF279 | 96.51 | |
| TIGR02525 | 372 | plasmid_TraJ plasmid transfer ATPase TraJ. Members | 96.5 | |
| COG1936 | 180 | Predicted nucleotide kinase (related to CMP and AM | 96.5 | |
| PRK08154 | 309 | anaerobic benzoate catabolism transcriptional regu | 96.49 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 96.49 | |
| cd03255 | 218 | ABC_MJ0796_Lo1CDE_FtsE This family is comprised of | 96.48 | |
| PTZ00088 | 229 | adenylate kinase 1; Provisional | 96.46 | |
| PLN02200 | 234 | adenylate kinase family protein | 96.45 | |
| PRK02496 | 184 | adk adenylate kinase; Provisional | 96.45 | |
| PRK13900 | 332 | type IV secretion system ATPase VirB11; Provisiona | 96.43 | |
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 96.42 | |
| PF04665 | 241 | Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 | 96.42 | |
| PRK14528 | 186 | adenylate kinase; Provisional | 96.42 | |
| PRK04040 | 188 | adenylate kinase; Provisional | 96.42 | |
| PF01745 | 233 | IPT: Isopentenyl transferase; InterPro: IPR002648 | 96.41 | |
| KOG2543 | 438 | consensus Origin recognition complex, subunit 5 [R | 96.4 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 96.39 | |
| PRK12608 | 380 | transcription termination factor Rho; Provisional | 96.37 | |
| COG3840 | 231 | ThiQ ABC-type thiamine transport system, ATPase co | 96.37 | |
| TIGR02782 | 299 | TrbB_P P-type conjugative transfer ATPase TrbB. Th | 96.37 | |
| PRK05541 | 176 | adenylylsulfate kinase; Provisional | 96.36 | |
| TIGR00960 | 216 | 3a0501s02 Type II (General) Secretory Pathway (IIS | 96.36 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 96.35 | |
| PRK09825 | 176 | idnK D-gluconate kinase; Provisional | 96.34 | |
| PRK04182 | 180 | cytidylate kinase; Provisional | 96.31 | |
| TIGR01448 | 720 | recD_rel helicase, putative, RecD/TraA family. Thi | 96.3 | |
| cd03261 | 235 | ABC_Org_Solvent_Resistant ABC (ATP-binding cassett | 96.29 | |
| COG1485 | 367 | Predicted ATPase [General function prediction only | 96.27 | |
| TIGR03574 | 249 | selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem | 96.27 | |
| TIGR01166 | 190 | cbiO cobalt transport protein ATP-binding subunit. | 96.26 | |
| cd03258 | 233 | ABC_MetN_methionine_transporter MetN (also known a | 96.26 | |
| cd03283 | 199 | ABC_MutS-like MutS-like homolog in eukaryotes. The | 96.26 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 96.25 | |
| cd03292 | 214 | ABC_FtsE_transporter FtsE is a hydrophilic nucleot | 96.25 | |
| cd03269 | 210 | ABC_putative_ATPase This subfamily is involved in | 96.25 | |
| COG4525 | 259 | TauB ABC-type taurine transport system, ATPase com | 96.24 | |
| TIGR01351 | 210 | adk adenylate kinases. Adenylate kinase (EC 2.7.4. | 96.24 | |
| cd03225 | 211 | ABC_cobalt_CbiO_domain1 Domain I of the ABC compon | 96.24 | |
| PRK00300 | 205 | gmk guanylate kinase; Provisional | 96.23 | |
| PF00005 | 137 | ABC_tran: ABC transporter This structure is on hol | 96.23 | |
| COG2274 | 709 | SunT ABC-type bacteriocin/lantibiotic exporters, c | 96.23 | |
| cd03262 | 213 | ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- | 96.23 | |
| TIGR02315 | 243 | ABC_phnC phosphonate ABC transporter, ATP-binding | 96.23 | |
| cd03260 | 227 | ABC_PstB_phosphate_transporter Phosphate uptake is | 96.22 | |
| TIGR03608 | 206 | L_ocin_972_ABC putative bacteriocin export ABC tra | 96.22 | |
| PLN02165 | 334 | adenylate isopentenyltransferase | 96.22 | |
| PRK13541 | 195 | cytochrome c biogenesis protein CcmA; Provisional | 96.22 | |
| PF13479 | 213 | AAA_24: AAA domain | 96.22 | |
| COG2884 | 223 | FtsE Predicted ATPase involved in cell division [C | 96.21 | |
| cd03229 | 178 | ABC_Class3 This class is comprised of all BPD (Bin | 96.2 | |
| PRK13851 | 344 | type IV secretion system protein VirB11; Provision | 96.2 | |
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 96.19 | |
| PRK11629 | 233 | lolD lipoprotein transporter ATP-binding subunit; | 96.19 | |
| TIGR02673 | 214 | FtsE cell division ATP-binding protein FtsE. This | 96.19 | |
| cd03226 | 205 | ABC_cobalt_CbiO_domain2 Domain II of the ABC compo | 96.19 | |
| PRK08485 | 206 | DNA polymerase III subunit delta'; Validated | 96.18 | |
| cd03256 | 241 | ABC_PhnC_transporter ABC-type phosphate/phosphonat | 96.18 | |
| TIGR03263 | 180 | guanyl_kin guanylate kinase. Members of this famil | 96.17 | |
| cd03224 | 222 | ABC_TM1139_LivF_branched LivF (TM1139) is part of | 96.17 | |
| PLN02674 | 244 | adenylate kinase | 96.17 | |
| PRK13833 | 323 | conjugal transfer protein TrbB; Provisional | 96.17 | |
| cd03301 | 213 | ABC_MalK_N The N-terminal ATPase domain of the mal | 96.16 | |
| TIGR02211 | 221 | LolD_lipo_ex lipoprotein releasing system, ATP-bin | 96.15 | |
| PRK13540 | 200 | cytochrome c biogenesis protein CcmA; Provisional | 96.15 | |
| cd03263 | 220 | ABC_subfamily_A The ABCA subfamily mediates the tr | 96.15 | |
| cd03247 | 178 | ABCC_cytochrome_bd The CYD subfamily implicated in | 96.14 | |
| PRK00279 | 215 | adk adenylate kinase; Reviewed | 96.14 | |
| COG1419 | 407 | FlhF Flagellar GTP-binding protein [Cell motility | 96.14 | |
| PRK00889 | 175 | adenylylsulfate kinase; Provisional | 96.14 | |
| COG0410 | 237 | LivF ABC-type branched-chain amino acid transport | 96.13 | |
| cd03296 | 239 | ABC_CysA_sulfate_importer Part of the ABC transpor | 96.13 | |
| cd03293 | 220 | ABC_NrtD_SsuB_transporters NrtD and SsuB are the A | 96.13 | |
| PRK11432 | 351 | fbpC ferric transporter ATP-binding subunit; Provi | 96.13 | |
| TIGR02533 | 486 | type_II_gspE general secretory pathway protein E. | 96.12 | |
| TIGR03410 | 230 | urea_trans_UrtE urea ABC transporter, ATP-binding | 96.12 | |
| cd02027 | 149 | APSK Adenosine 5'-phosphosulfate kinase (APSK) cat | 96.12 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 96.12 | |
| PRK05800 | 170 | cobU adenosylcobinamide kinase/adenosylcobinamide- | 96.12 | |
| PF02562 | 205 | PhoH: PhoH-like protein; InterPro: IPR003714 PhoH | 96.11 | |
| cd03219 | 236 | ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans | 96.11 | |
| PRK13538 | 204 | cytochrome c biogenesis protein CcmA; Provisional | 96.1 | |
| PRK13764 | 602 | ATPase; Provisional | 96.1 | |
| cd03235 | 213 | ABC_Metallic_Cations ABC component of the metal-ty | 96.09 | |
| cd03257 | 228 | ABC_NikE_OppD_transporters The ABC transporter sub | 96.08 | |
| PRK10584 | 228 | putative ABC transporter ATP-binding protein YbbA; | 96.08 | |
| PRK11124 | 242 | artP arginine transporter ATP-binding subunit; Pro | 96.07 | |
| PF02190 | 205 | LON: ATP-dependent protease La (LON) domain; Inter | 96.07 | |
| PRK13894 | 319 | conjugal transfer ATPase TrbB; Provisional | 96.07 | |
| cd03265 | 220 | ABC_DrrA DrrA is the ATP-binding protein component | 96.07 | |
| PRK10247 | 225 | putative ABC transporter ATP-binding protein YbbL; | 96.06 | |
| PRK11248 | 255 | tauB taurine transporter ATP-binding subunit; Prov | 96.05 | |
| PRK05439 | 311 | pantothenate kinase; Provisional | 96.05 | |
| COG4175 | 386 | ProV ABC-type proline/glycine betaine transport sy | 96.05 | |
| TIGR03864 | 236 | PQQ_ABC_ATP ABC transporter, ATP-binding subunit, | 96.05 | |
| PF01443 | 234 | Viral_helicase1: Viral (Superfamily 1) RNA helicas | 96.04 | |
| cd03259 | 213 | ABC_Carb_Solutes_like ABC Carbohydrate and Solute | 96.04 | |
| PRK14526 | 211 | adenylate kinase; Provisional | 96.04 | |
| TIGR02173 | 171 | cyt_kin_arch cytidylate kinase, putative. Proteins | 96.03 | |
| PLN02199 | 303 | shikimate kinase | 96.03 |
| >COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.8e-148 Score=1225.71 Aligned_cols=652 Identities=53% Similarity=0.852 Sum_probs=632.1
Q ss_pred CHHHHHHHHHHHHHHHHHHHHhhccCCchHHHHHHHccCChhHHHHHHHhcCCCCHHHHHHhhhccCHHHHHHHHHHHHH
Q 004834 12 DPDFIALSRQFKATAMELISVLEQKQKTGGRTKVLLETVPIHKLADIFVASFEISFEEQLVMLDSVDLKVRLSKATELVD 91 (728)
Q Consensus 12 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~d~~~~~~~~~~~~~~~lLd~~~~~~r~~~~~~~l~ 91 (728)
+.+.+|+.+.+...|++|++.++. .+.+.+..+.++++|++|||++|++++++.+++|++|++.+...||+..+..+.
T Consensus 125 ~~~~~al~~~i~~~~~~~~~l~~~--~~~e~l~~~~~i~~~~klad~iaa~l~~~~~~kQ~iLe~~~v~~Rlek~l~~l~ 202 (782)
T COG0466 125 EREIEALVRSILSEFEEYAKLNKK--IPPEELQSLNSIDDPGKLADTIAAHLPLKLEEKQEILETLDVKERLEKLLDLLE 202 (782)
T ss_pred hhHHHHHHHHHHHHHHHHHHhccC--CCHHHHHHHhcccchHHHHHHHHHhCCCCHHHHHHHHHhCCHHHHHHHHHHHHH
Confidence 567899999999999999998753 677888888899999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHhhhchHHHHHHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHhc
Q 004834 92 RHLQSIRVAEKITQKVEGQLSKSQKEFLLRQQMRAIKEELGDNDDDEDDLVALERKMQSAGMPSNIWKHVQKELRRLKKM 171 (728)
Q Consensus 92 ~~~~~~~~e~~~~~~~~~~~~~~~r~~~l~eql~~i~~el~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~el~~l~~~ 171 (728)
.++..+++|++|.++++.+++++||+|||+||+++||+|||..++..+++.+++++++...||+++++.+++|+++|+.+
T Consensus 203 ~ei~~~~~ek~I~~kVk~~meK~QREyyL~EQlKaIqkELG~~~d~~~e~~~~~~kie~~~~p~evk~k~~~El~kL~~m 282 (782)
T COG0466 203 KEIDLLQLEKRIRKKVKEQMEKSQREYYLREQLKAIQKELGEDDDDKDEVEELREKIEKLKLPKEAKEKAEKELKKLETM 282 (782)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCccchhHHHHHHHHHhhcCCCHHHHHHHHHHHHHHhcC
Confidence 99999999999999999999999999999999999999999887666899999999999999999999999999999999
Q ss_pred CCCCCCCchhHHHHHHHHcCCCCccchhHHhcHHHHHHhhhccccchHHHHHHHHHHHHhhccCCCCCCCEEEEEcCCCC
Q 004834 172 QPQQPGYTSSRVYLELIADLPWEKASEEIDLDLKAAKERLDSDHYGLVRVKQRIIEYLAVRKLKPDARGPVLCFVGPPGV 251 (728)
Q Consensus 172 ~~~~~~~~~~~~~~~~~~~iP~~~~~~~~~~~l~~~~~~L~~~i~G~~~vk~~i~~~l~~~~~~~~~~~~~lLL~GPpGt 251 (728)
+|++++++++|+|++|++.+||...+.+ ..|+.+++++|+++|||++++|+||++|+++..+.+..+||++||+|||||
T Consensus 283 ~~~SaE~~ViRnYlDwll~lPW~~~sk~-~~Dl~~a~~iLd~dHYGLekVKeRIlEyLAV~~l~~~~kGpILcLVGPPGV 361 (782)
T COG0466 283 SPMSAEATVIRNYLDWLLDLPWGKRSKD-KLDLKKAEKILDKDHYGLEKVKERILEYLAVQKLTKKLKGPILCLVGPPGV 361 (782)
T ss_pred CCCCchHHHHHHHHHHHHhCCCccccch-hhhHHHHHHHhcccccCchhHHHHHHHHHHHHHHhccCCCcEEEEECCCCC
Confidence 9999999999999999999999999998 999999999999999999999999999999999988899999999999999
Q ss_pred ChhHHHHHHHHHhCCCeEEEecCCccchhhhccCccccccCCcchHHHHHhhcCCCCcEEEEecccccCCCCCCCHHHHH
Q 004834 252 GKTSLASSIASALGRKFIRISLGGVKDEADIRGHRRTYIGSMPGRLIDGLKRVGVCNPVMLLDEIDKTGSDVRGDPASAL 331 (728)
Q Consensus 252 GKT~LakalA~~l~~~~~~i~~~~~~~~s~l~g~~~~yvG~~~g~l~~~~~~a~~~~~VlllDEidkl~~~~~~~~~~~L 331 (728)
|||+|+++||++++++|+|++++|.+|+++++|||++|+|++||++.+.+++++..|||++||||||++.+.+|||.++|
T Consensus 362 GKTSLgkSIA~al~RkfvR~sLGGvrDEAEIRGHRRTYIGamPGrIiQ~mkka~~~NPv~LLDEIDKm~ss~rGDPaSAL 441 (782)
T COG0466 362 GKTSLGKSIAKALGRKFVRISLGGVRDEAEIRGHRRTYIGAMPGKIIQGMKKAGVKNPVFLLDEIDKMGSSFRGDPASAL 441 (782)
T ss_pred CchhHHHHHHHHhCCCEEEEecCccccHHHhccccccccccCChHHHHHHHHhCCcCCeEEeechhhccCCCCCChHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHhcCcccccccccCCCCeeecCCCcEEEEecCCCCCCChhhhCCeeEEEcCCCCHHHHHHHHHHhhchHHHhhcCCCcc
Q 004834 332 LEVLDPEQNKTFNDHYLNVPFDLSKVIFVATANRAQPIPPPLLDRMEVIELPGYTPEEKLRIAMRHLIPRVLDQHGLGSE 411 (728)
Q Consensus 332 l~~Ld~~~~~~~~d~~~~~~~d~~~vi~I~TtN~~~~l~~~Ll~R~~vI~~~~~t~ee~~~Il~~~l~~~~~~~~~~~~~ 411 (728)
|++||++||..|.|||++.++|+|+|+||||+|..+++|.||+|||++|.+++|+++|+.+|+++||.|++++++|+...
T Consensus 442 LEVLDPEQN~~F~DhYLev~yDLS~VmFiaTANsl~tIP~PLlDRMEiI~lsgYt~~EKl~IAk~~LiPk~~~~~gL~~~ 521 (782)
T COG0466 442 LEVLDPEQNNTFSDHYLEVPYDLSKVMFIATANSLDTIPAPLLDRMEVIRLSGYTEDEKLEIAKRHLIPKQLKEHGLKKG 521 (782)
T ss_pred HhhcCHhhcCchhhccccCccchhheEEEeecCccccCChHHhcceeeeeecCCChHHHHHHHHHhcchHHHHHcCCCcc
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ccccCHHHHHHHHHHcccccchHHHHHHHHHHHHHHHHHHHHHhhhhcCCCCccccccCCccccccccCCCceeEeeccC
Q 004834 412 FLQIPEAMVKLVIQRYTREAGVRNLERNLAALARAAAVKVAEQEQEQALPSSKDVHRLGSPLLDNRLADGAEVEMEVIPM 491 (728)
Q Consensus 412 ~~~i~d~~l~~l~~~~~~~~G~R~L~~~I~~l~r~a~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~v~~~~~~~ 491 (728)
.+.++|+++..+++.|++|+|||+|+|.|.++||+++.+++.+. .
T Consensus 522 el~i~d~ai~~iI~~YTREAGVR~LeR~i~ki~RK~~~~i~~~~--~--------------------------------- 566 (782)
T COG0466 522 ELTITDEAIKDIIRYYTREAGVRNLEREIAKICRKAAKKILLKK--E--------------------------------- 566 (782)
T ss_pred ceeecHHHHHHHHHHHhHhhhhhHHHHHHHHHHHHHHHHHHhcC--c---------------------------------
Confidence 99999999999999999999999999999999999999998751 1
Q ss_pred CCcccccccccccCCceeechhhhhhhcCCCccCchHHHhhhcCCceeEeeEEeecCceeEEEEEEEecCCceEEEeecc
Q 004834 492 GESTHEVSNTFRITSPLVVDEAMLEKVLGPPRFDDREAAERVAAPGISVGLVWTNFGGEVQFVEATAMRGKGELHLTGQL 571 (728)
Q Consensus 492 ~~~~~~~~~~~~~~~~~~It~~~L~~~Lg~~~~~~~~~~~~~~~~G~~~gl~~~~~gg~~~~iE~~~~~G~~~~~~tG~~ 571 (728)
...+.|+.++|++|||++.|.. +...+++++|+|+|||||++||.+++||+..+||+|++++||++
T Consensus 567 -------------k~~~~i~~~~l~~yLG~~~f~~-~~~~~~~~vGvVtGLAWT~vGGd~L~IE~~~~~Gkg~l~lTG~L 632 (782)
T COG0466 567 -------------KSIVKIDEKNLKKYLGVPVFRY-GKAEEEDQVGVVTGLAWTEVGGDLLTIEAVKMPGKGKLTLTGSL 632 (782)
T ss_pred -------------ccceeeCHHHHHHHhCCcccCc-cccccCCCCeeEeeeeeecCCceEEEEEEEEecCCccEEEeccH
Confidence 1125899999999999999999 78888999999999999999999999999999999999999999
Q ss_pred chHHHHHHHHHHHHHHHHhhhccchhcccCCCCCcccEEEEccCCCCCCCCchhHHHHHHHHHHhccCCCCCCCeEEEee
Q 004834 572 GDVIKESAQIALTWVRARATDLQLVAEDGMNLLQGRDIHIHFPAGAVPKDGPSAGVTLVTALVSLFSRKRVRADTAMTGE 651 (728)
Q Consensus 572 ~~~~kES~~~a~~~~~~~~~~l~~~~~~~~~~~~~~di~i~~~~g~~~kdGpsaglaia~allSa~~~~~v~~~~a~tGE 651 (728)
|+|||||+++|+||+|+++..+++ +..||.+.|||||+|.|++||||||||+|||+||+|+++++||++++|||||
T Consensus 633 GdVMKESa~~A~s~vrs~a~~~~i----~~~~fek~dIHiHVPeGAtPKDGPSAGitm~TAlvS~lt~~~V~~~vAMTGE 708 (782)
T COG0466 633 GDVMKESAQAALSYVRSRAEKLGI----DPDFFEKRDIHIHVPEGATPKDGPSAGITMATALVSLLTGKPVRADVAMTGE 708 (782)
T ss_pred HHHHHHHHHHHHHHHHHHHHHcCC----CcccccccceEEECCCCCCCCCCcchHHHHHHHHHHHHhCCCCCCCccceee
Confidence 999999999999999999999997 5678999999999999999999999999999999999999999999999999
Q ss_pred eCCCceeeecCCHHHHHHHHHHcCCCeeeccccCccccccchHhhhCCcEEEEeCCHHHHHHHHHcCC
Q 004834 652 MTLRGLVLPVGGVKDKILAAHRYGIKRVILPERNLKDLVEVPAAVLASLEIILAKRMEDVLEQAFEGG 719 (728)
Q Consensus 652 i~L~G~V~~Vggi~~ki~~A~~~G~~~viiP~~n~~d~~~ip~~~~~~i~i~~v~~~~e~~~~~~~~~ 719 (728)
|||+|+|+||||++||++||+|+|+++||+|++|.+|+.++|++++++++|++|++++||++++|...
T Consensus 709 ITLrG~VLpIGGLKEKllAA~R~GIk~viiP~~N~~DleeiP~~vk~~l~i~~V~~~~eVl~~al~~~ 776 (782)
T COG0466 709 ITLRGRVLPIGGLKEKLLAAHRGGIKTVIIPKDNERDLEEIPDNVKEGLEIHPVKTIDEVLKLALVGN 776 (782)
T ss_pred EEeeeceeecccHHHHHHHHHhcCCcEEeccccccccHHhCCHHHHcCCeEEEeccHHHHHHHHhcCC
Confidence 99999999999999999999999999999999999999999999999999999999999999999864
|
|
| >KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10787 DNA-binding ATP-dependent protease La; Provisional | Back alignment and domain information |
|---|
| >TIGR00763 lon ATP-dependent protease La | Back alignment and domain information |
|---|
| >TIGR02902 spore_lonB ATP-dependent protease LonB | Back alignment and domain information |
|---|
| >TIGR02903 spore_lon_C ATP-dependent protease, Lon family | Back alignment and domain information |
|---|
| >PRK13765 ATP-dependent protease Lon; Provisional | Back alignment and domain information |
|---|
| >TIGR00764 lon_rel lon-related putative ATP-dependent protease | Back alignment and domain information |
|---|
| >TIGR02653 Lon_rel_chp conserved hypothetical protein | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF05362 Lon_C: Lon protease (S16) C-terminal proteolytic domain; InterPro: IPR008269 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00416 sms DNA repair protein RadA | Back alignment and domain information |
|---|
| >COG1067 LonB Predicted ATP-dependent protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00368 Mg chelatase-related protein | Back alignment and domain information |
|---|
| >COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13541 ChlI: Subunit ChlI of Mg-chelatase | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional | Back alignment and domain information |
|---|
| >KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) | Back alignment and domain information |
|---|
| >PRK09862 putative ATP-dependent protease; Provisional | Back alignment and domain information |
|---|
| >COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional | Back alignment and domain information |
|---|
| >KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >CHL00176 ftsH cell division protein; Validated | Back alignment and domain information |
|---|
| >COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG4930 Predicted ATP-dependent Lon-type protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >CHL00206 ycf2 Ycf2; Provisional | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10733 hflB ATP-dependent metalloprotease; Reviewed | Back alignment and domain information |
|---|
| >PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG1750 Archaeal serine proteases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR01650 PD_CobS cobaltochelatase, CobS subunit | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK07764 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14952 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >COG0714 MoxR-like ATPases [General function prediction only] | Back alignment and domain information |
|---|
| >PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model | Back alignment and domain information |
|---|
| >PRK14959 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK05563 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >PRK05896 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK07133 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PHA02244 ATPase-like protein | Back alignment and domain information |
|---|
| >PRK14965 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK13531 regulatory ATPase RavA; Provisional | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >PRK14953 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK13407 bchI magnesium chelatase subunit I; Provisional | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >PRK07940 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK08451 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK06647 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK06305 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14948 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14954 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK14970 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK09111 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14950 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14971 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02974 phageshock_pspF psp operon transcriptional activator PspF | Back alignment and domain information |
|---|
| >CHL00081 chlI Mg-protoporyphyrin IX chelatase | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01817 nifA Nif-specific regulatory protein | Back alignment and domain information |
|---|
| >TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional | Back alignment and domain information |
|---|
| >PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional | Back alignment and domain information |
|---|
| >PRK11608 pspF phage shock protein operon transcriptional activator; Provisional | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >smart00350 MCM minichromosome maintenance proteins | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins | Back alignment and domain information |
|---|
| >COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10820 DNA-binding transcriptional regulator TyrR; Provisional | Back alignment and domain information |
|---|
| >TIGR00678 holB DNA polymerase III, delta' subunit | Back alignment and domain information |
|---|
| >PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX | Back alignment and domain information |
|---|
| >TIGR02442 Cob-chelat-sub cobaltochelatase subunit | Back alignment and domain information |
|---|
| >PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional | Back alignment and domain information |
|---|
| >PRK07399 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK05564 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK11388 DNA-binding transcriptional regulator DhaR; Provisional | Back alignment and domain information |
|---|
| >PRK09112 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK07471 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >PTZ00111 DNA replication licensing factor MCM4; Provisional | Back alignment and domain information |
|---|
| >PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A | Back alignment and domain information |
|---|
| >TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D | Back alignment and domain information |
|---|
| >PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK08058 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator | Back alignment and domain information |
|---|
| >PRK04132 replication factor C small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK10923 glnG nitrogen regulation protein NR(I); Provisional | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK05707 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR00368 Mg chelatase-related protein | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK15115 response regulator GlrR; Provisional | Back alignment and domain information |
|---|
| >COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional | Back alignment and domain information |
|---|
| >KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK06871 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG2170 consensus ATPase of the AAA+ superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01818 ntrC nitrogen regulation protein NR(I) | Back alignment and domain information |
|---|
| >PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >PRK08769 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK07993 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG0478 consensus DNA replication licensing factor, MCM4 component [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK06964 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK09862 putative ATP-dependent protease; Provisional | Back alignment and domain information |
|---|
| >COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06090 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR00602 rad24 checkpoint protein rad24 | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >KOG0480 consensus DNA replication licensing factor, MCM6 component [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A | Back alignment and domain information |
|---|
| >COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PRK10365 transcriptional regulatory protein ZraR; Provisional | Back alignment and domain information |
|---|
| >PRK05917 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK08699 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PRK15455 PrkA family serine protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription] | Back alignment and domain information |
|---|
| >PRK13406 bchD magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >PRK07276 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite | Back alignment and domain information |
|---|
| >PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins | Back alignment and domain information |
|---|
| >COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >KOG0482 consensus DNA replication licensing factor, MCM7 component [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF03215 Rad17: Rad17 cell cycle checkpoint protein | Back alignment and domain information |
|---|
| >PRK05818 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07132 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins | Back alignment and domain information |
|---|
| >KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H | Back alignment and domain information |
|---|
| >KOG0477 consensus DNA replication licensing factor, MCM2 component [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A | Back alignment and domain information |
|---|
| >KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length | Back alignment and domain information |
|---|
| >COG4650 RtcR Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >KOG0479 consensus DNA replication licensing factor, MCM3 component [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP | Back alignment and domain information |
|---|
| >KOG0481 consensus DNA replication licensing factor, MCM5 component [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR02688 conserved hypothetical protein TIGR02688 | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1808 consensus AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >PRK06581 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >PHA02774 E1; Provisional | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP | Back alignment and domain information |
|---|
| >COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >PF10431 ClpB_D2-small: C-terminal, D2-small domain, of ClpB protein ; InterPro: IPR019489 Most Clp ATPases form complexes with peptidase subunits and are involved in protein degradation, though some, such as ClpB, do not associate with peptidases and are involved in protein disaggregation [] | Back alignment and domain information |
|---|
| >COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] | Back alignment and domain information |
|---|
| >KOG1968 consensus Replication factor C, subunit RFC1 (large subunit) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PF05272 VirE: Virulence-associated protein E; InterPro: IPR007936 This family contains several bacterial virulence-associated protein E like proteins | Back alignment and domain information |
|---|
| >PHA02624 large T antigen; Provisional | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >TIGR01613 primase_Cterm phage/plasmid primase, P4 family, C-terminal domain | Back alignment and domain information |
|---|
| >COG5245 DYN1 Dynein, heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals | Back alignment and domain information |
|---|
| >PRK13947 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain | Back alignment and domain information |
|---|
| >cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase | Back alignment and domain information |
|---|
| >COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00625 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK03839 putative kinase; Provisional | Back alignment and domain information |
|---|
| >cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
|---|
| >cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >PRK14530 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PRK13695 putative NTPase; Provisional | Back alignment and domain information |
|---|
| >TIGR01618 phage_P_loop phage nucleotide-binding protein | Back alignment and domain information |
|---|
| >PHA01747 putative ATP-dependent protease | Back alignment and domain information |
|---|
| >PRK06696 uridine kinase; Validated | Back alignment and domain information |
|---|
| >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK13949 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea | Back alignment and domain information |
|---|
| >PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >PRK13948 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 | Back alignment and domain information |
|---|
| >TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
|---|
| >PF14516 AAA_35: AAA-like domain | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02858 spore_III_AA stage III sporulation protein AA | Back alignment and domain information |
|---|
| >PRK14532 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK06217 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family | Back alignment and domain information |
|---|
| >cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor | Back alignment and domain information |
|---|
| >TIGR00767 rho transcription termination factor Rho | Back alignment and domain information |
|---|
| >COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >PRK14531 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF12780 AAA_8: P-loop containing dynein motor region D4; InterPro: IPR024317 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05057 aroK shikimate kinase I; Reviewed | Back alignment and domain information |
|---|
| >COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14737 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family | Back alignment and domain information |
|---|
| >COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot) | Back alignment and domain information |
|---|
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK03731 aroL shikimate kinase II; Reviewed | Back alignment and domain information |
|---|
| >PRK14527 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK09376 rho transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13946 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >PF00519 PPV_E1_C: Papillomavirus helicase; InterPro: IPR001177 Papillomaviruses are a large family of DNA tumour viruses which give rise to warts in their host species | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00202 tuzin; Provisional | Back alignment and domain information |
|---|
| >PRK06547 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK10078 ribose 1,5-bisphosphokinase; Provisional | Back alignment and domain information |
|---|
| >cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK14700 recombination factor protein RarA; Provisional | Back alignment and domain information |
|---|
| >PF10923 DUF2791: P-loop Domain of unknown function (DUF2791); InterPro: IPR021228 This is a family of proteins found in archaea and bacteria | Back alignment and domain information |
|---|
| >TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ | Back alignment and domain information |
|---|
| >COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) | Back alignment and domain information |
|---|
| >PTZ00088 adenylate kinase 1; Provisional | Back alignment and domain information |
|---|
| >PLN02200 adenylate kinase family protein | Back alignment and domain information |
|---|
| >PRK02496 adk adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13900 type IV secretion system ATPase VirB11; Provisional | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein | Back alignment and domain information |
|---|
| >PRK14528 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK04040 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] | Back alignment and domain information |
|---|
| >KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >PRK12608 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB | Back alignment and domain information |
|---|
| >PRK05541 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >PRK09825 idnK D-gluconate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK04182 cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01448 recD_rel helicase, putative, RecD/TraA family | Back alignment and domain information |
|---|
| >cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >COG1485 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal | Back alignment and domain information |
|---|
| >TIGR01166 cbiO cobalt transport protein ATP-binding subunit | Back alignment and domain information |
|---|
| >cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport | Back alignment and domain information |
|---|
| >cd03283 ABC_MutS-like MutS-like homolog in eukaryotes | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane | Back alignment and domain information |
|---|
| >cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity | Back alignment and domain information |
|---|
| >COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01351 adk adenylate kinases | Back alignment and domain information |
|---|
| >cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >PRK00300 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively | Back alignment and domain information |
|---|
| >TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient | Back alignment and domain information |
|---|
| >TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group | Back alignment and domain information |
|---|
| >PLN02165 adenylate isopentenyltransferase | Back alignment and domain information |
|---|
| >PRK13541 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PF13479 AAA_24: AAA domain | Back alignment and domain information |
|---|
| >COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment | Back alignment and domain information |
|---|
| >PRK13851 type IV secretion system protein VirB11; Provisional | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02673 FtsE cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >PRK08485 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system | Back alignment and domain information |
|---|
| >TIGR03263 guanyl_kin guanylate kinase | Back alignment and domain information |
|---|
| >cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids | Back alignment and domain information |
|---|
| >PLN02674 adenylate kinase | Back alignment and domain information |
|---|
| >PRK13833 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK | Back alignment and domain information |
|---|
| >TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK13540 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds | Back alignment and domain information |
|---|
| >cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis | Back alignment and domain information |
|---|
| >PRK00279 adk adenylate kinase; Reviewed | Back alignment and domain information |
|---|
| >COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] | Back alignment and domain information |
|---|
| >PRK00889 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import | Back alignment and domain information |
|---|
| >cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively | Back alignment and domain information |
|---|
| >PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02533 type_II_gspE general secretory pathway protein E | Back alignment and domain information |
|---|
| >TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE | Back alignment and domain information |
|---|
| >cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated | Back alignment and domain information |
|---|
| >PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] | Back alignment and domain information |
|---|
| >cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine | Back alignment and domain information |
|---|
| >PRK13538 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters | Back alignment and domain information |
|---|
| >cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) | Back alignment and domain information |
|---|
| >PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional | Back alignment and domain information |
|---|
| >PRK11124 artP arginine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PF02190 LON: ATP-dependent protease La (LON) domain; InterPro: IPR003111 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PRK13894 conjugal transfer ATPase TrbB; Provisional | Back alignment and domain information |
|---|
| >cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin | Back alignment and domain information |
|---|
| >PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional | Back alignment and domain information |
|---|
| >PRK11248 tauB taurine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK05439 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system | Back alignment and domain information |
|---|
| >PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases | Back alignment and domain information |
|---|
| >cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup | Back alignment and domain information |
|---|
| >PRK14526 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02173 cyt_kin_arch cytidylate kinase, putative | Back alignment and domain information |
|---|
| >PLN02199 shikimate kinase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 728 | ||||
| 3m6a_A | 543 | Crystal Structure Of Bacillus Subtilis Lon C-Termin | 2e-91 | ||
| 3m6a_A | 543 | Crystal Structure Of Bacillus Subtilis Lon C-Termin | 7e-43 | ||
| 1rr9_A | 200 | Catalytic Domain Of E.Coli Lon Protease Length = 20 | 7e-46 | ||
| 1rre_A | 200 | Crystal Structure Of E.Coli Lon Proteolytic Domain | 2e-44 | ||
| 2x36_A | 207 | Structure Of The Proteolytic Domain Of The Human Mi | 8e-37 | ||
| 1xhk_A | 187 | Crystal Structure Of M. Jannaschii Lon Proteolytic | 6e-15 | ||
| 3k1j_A | 604 | Crystal Structure Of Lon Protease From Thermococcus | 3e-14 | ||
| 1z0c_A | 207 | Crystal Structure Of A. Fulgidus Lon Proteolytic Do | 4e-14 | ||
| 1z0w_A | 207 | Crystal Structure Of A. Fulgidus Lon Proteolytic Do | 4e-14 | ||
| 1z0e_A | 205 | Crystal Structure Of A. Fulgidus Lon Proteolytic Do | 5e-14 | ||
| 1z0b_A | 207 | Crystal Structure Of A. Fulgidus Lon Proteolytic Do | 1e-13 | ||
| 1x37_A | 124 | Structure Of Bacillus Subtilis Lon Protease Ssd Dom | 3e-05 | ||
| 1ixr_C | 312 | Ruva-Ruvb Complex Length = 312 | 4e-05 | ||
| 1ixs_B | 318 | Structure Of Ruvb Complexed With Ruva Domain Iii Le | 6e-05 | ||
| 1qzm_A | 94 | Alpha-Domain Of Atpase Length = 94 | 9e-05 | ||
| 1hqc_A | 324 | Structure Of Ruvb From Thermus Thermophilus Hb8 Len | 1e-04 | ||
| 1ksf_X | 758 | Crystal Structure Of Clpa, An Hsp100 Chaperone And | 2e-04 | ||
| 1qvr_A | 854 | Crystal Structure Analysis Of Clpb Length = 854 | 4e-04 |
| >pdb|3M6A|A Chain A, Crystal Structure Of Bacillus Subtilis Lon C-Terminal Domain Length = 543 | Back alignment and structure |
|
| >pdb|3M6A|A Chain A, Crystal Structure Of Bacillus Subtilis Lon C-Terminal Domain Length = 543 | Back alignment and structure |
| >pdb|1RR9|A Chain A, Catalytic Domain Of E.Coli Lon Protease Length = 200 | Back alignment and structure |
| >pdb|1RRE|A Chain A, Crystal Structure Of E.Coli Lon Proteolytic Domain Length = 200 | Back alignment and structure |
| >pdb|2X36|A Chain A, Structure Of The Proteolytic Domain Of The Human Mitochondrial Lon Protease Length = 207 | Back alignment and structure |
| >pdb|1XHK|A Chain A, Crystal Structure Of M. Jannaschii Lon Proteolytic Domain Length = 187 | Back alignment and structure |
| >pdb|3K1J|A Chain A, Crystal Structure Of Lon Protease From Thermococcus Onnurineus Na1 Length = 604 | Back alignment and structure |
| >pdb|1Z0C|A Chain A, Crystal Structure Of A. Fulgidus Lon Proteolytic Domain D508a Mutant Length = 207 | Back alignment and structure |
| >pdb|1Z0W|A Chain A, Crystal Structure Of A. Fulgidus Lon Proteolytic Domain At 1.2a Resolution Length = 207 | Back alignment and structure |
| >pdb|1Z0E|A Chain A, Crystal Structure Of A. Fulgidus Lon Proteolytic Domain Length = 205 | Back alignment and structure |
| >pdb|1Z0B|A Chain A, Crystal Structure Of A. Fulgidus Lon Proteolytic Domain E506a Mutant Length = 207 | Back alignment and structure |
| >pdb|1X37|A Chain A, Structure Of Bacillus Subtilis Lon Protease Ssd Domain Length = 124 | Back alignment and structure |
| >pdb|1IXR|C Chain C, Ruva-Ruvb Complex Length = 312 | Back alignment and structure |
| >pdb|1IXS|B Chain B, Structure Of Ruvb Complexed With Ruva Domain Iii Length = 318 | Back alignment and structure |
| >pdb|1QZM|A Chain A, Alpha-Domain Of Atpase Length = 94 | Back alignment and structure |
| >pdb|1HQC|A Chain A, Structure Of Ruvb From Thermus Thermophilus Hb8 Length = 324 | Back alignment and structure |
| >pdb|1KSF|X Chain X, Crystal Structure Of Clpa, An Hsp100 Chaperone And Regulator Of Clpap Protease: Structural Basis Of Differences In Function Of The Two Aaa+ Atpase Domains Length = 758 | Back alignment and structure |
| >pdb|1QVR|A Chain A, Crystal Structure Analysis Of Clpb Length = 854 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Length = 543 | Back alignment and structure |
|---|
Score = 844 bits (2182), Expect = 0.0
Identities = 265/587 (45%), Positives = 364/587 (62%), Gaps = 55/587 (9%)
Query: 132 GDNDDDEDDLVALERKMQSAGMPSNIWKHVQKELRRLKKMQPQQPGYTSSRVYLELIADL 191
GD + ++ L K++ AGMP ++ + KEL R +K+ + R Y++ + L
Sbjct: 1 GDKEGKTGEVQTLTEKIEEAGMPDHVKETALKELNRYEKIPSSSAESSVIRNYIDWLVAL 60
Query: 192 PWEKASEEIDLDLKAAKERLDSDHYGLVRVKQRIIEYLAVRKLKPDARGPVLCFVGPPGV 251
PW +++ LDLK A LD +H+GL +VK+RI+EYLAV+KL +GP+LC GPPGV
Sbjct: 61 PWTDETDD-KLDLKEAGRLLDEEHHGLEKVKERILEYLAVQKLTKSLKGPILCLAGPPGV 119
Query: 252 GKTSLASSIASALGRKFIRISLGGVKDEADIRGHRRTYIGSMPGRLIDGLKRVGVCNPVM 311
GKTSLA SIA +LGRKF+RISLGGV+DE++IRGHRRTY+G+MPGR+I G+K+ G NPV
Sbjct: 120 GKTSLAKSIAKSLGRKFVRISLGGVRDESEIRGHRRTYVGAMPGRIIQGMKKAGKLNPVF 179
Query: 312 LLDEIDKTGSDVRGDPASALLEVLDPEQNKTFNDHYLNVPFDLSKVIFVATANRAQPIPP 371
LLDEIDK SD RGDP+SA+LEVLDPEQN +F+DHY+ FDLSKV+F+ATAN IP
Sbjct: 180 LLDEIDKMSSDFRGDPSSAMLEVLDPEQNSSFSDHYIEETFDLSKVLFIATANNLATIPG 239
Query: 372 PLLDRMEVIELPGYTPEEKLRIAMRHLIPRVLDQHGLGSEFLQIPEAMVKLVIQRYTREA 431
PL DRME+I + GYT EKL I HL+P+ + +HGL LQ+ + + +I+ YTREA
Sbjct: 240 PLRDRMEIINIAGYTEIEKLEIVKDHLLPKQIKEHGLKKSNLQLRDQAILDIIRYYTREA 299
Query: 432 GVRNLERNLAALARAAAVKVAEQEQEQALPSSKDVHRLGSPLLDNRLADGAEVEMEVIPM 491
GVR+LER LAA+ R AA + +E++
Sbjct: 300 GVRSLERQLAAICRKAAKAIVAEERK---------------------------------- 325
Query: 492 GESTHEVSNTFRITSPLVVDEAMLEKVLGPPRFDDREAAERVAAPGISVGLVWTNFGGEV 551
+ V E L+ +G F AE G+ GL +T GG+
Sbjct: 326 ---------------RITVTEKNLQDFIGKRIF-RYGQAETEDQVGVVTGLAYTTVGGDT 369
Query: 552 QFVEATAMRGKGELHLTGQLGDVIKESAQIALTWVRARATDLQLVAEDGMNLLQGRDIHI 611
+E + GKG+L LTG+LGDV++ESAQ A ++VR++ +L + + + DIHI
Sbjct: 370 LSIEVSLSPGKGKLILTGKLGDVMRESAQAAFSYVRSKTEELGIEPD----FHEKYDIHI 425
Query: 612 HFPAGAVPKDGPSAGVTLVTALVSLFSRKRVRADTAMTGEMTLRGLVLPVGGVKDKILAA 671
H P GAVPKDGP+AG+T+ TALVS + + V + MTGE+TLRG VLP+GG+K+K L A
Sbjct: 426 HVPEGAVPKDGPAAGITMATALVSALTGRAVSREVGMTGEITLRGRVLPIGGLKEKALGA 485
Query: 672 HRYGIKRVILPERNLKDLVEVPAAVLASLEIILAKRMEDVLEQAFEG 718
HR G+ +I P+ N KD+ ++P +V L ILA +++VLE A G
Sbjct: 486 HRAGLTTIIAPKDNEKDIEDIPESVREGLTFILASHLDEVLEHALVG 532
|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Length = 604 | Back alignment and structure |
|---|
| >1rre_A ATP-dependent protease LA; catalytic Ser-Lys DYAD, hydrolase; HET: MSE; 1.75A {Escherichia coli} SCOP: d.14.1.10 PDB: 1rr9_A* Length = 200 | Back alignment and structure |
|---|
| >2x36_A LON protease homolog, mitochondrial; hydrolase, catalytic DYAD, transit peptide; 2.00A {Homo sapiens} Length = 207 | Back alignment and structure |
|---|
| >1xhk_A Putative protease LA homolog; LON protease, ATP dependent, catalytic DYAD, hydrolase; HET: MES; 1.90A {Methanocaldococcus jannaschii} SCOP: d.14.1.10 Length = 187 | Back alignment and structure |
|---|
| >1z0w_A Putative protease LA homolog type; ATP-dependent protease, catalytic Ser-Lys DYAD, B-type LON, hydrolase; 1.20A {Archaeoglobus fulgidus} PDB: 1z0b_A 1z0c_A 1z0e_A 1z0g_A 1z0t_A 1z0v_A Length = 207 | Back alignment and structure |
|---|
| >1qzm_A ATP-dependent protease LA; oligomerization domain, AAA+ protein, hydrolase; 1.90A {Escherichia coli} SCOP: c.37.1.20 Length = 94 | Back alignment and structure |
|---|
| >3ljc_A ATP-dependent protease LA; LON N-domain, allosteric enzyme, ATP-binding, DNA-binding, H nucleotide-binding, serine protease, stress respo; 2.60A {Escherichia coli} Length = 252 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Length = 293 | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Length = 447 | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 516 | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Length = 758 | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Length = 309 | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Length = 202 | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Length = 318 | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Length = 308 | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Length = 500 | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Length = 324 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 728 | |||
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 100.0 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 100.0 | |
| 1rre_A | 200 | ATP-dependent protease LA; catalytic Ser-Lys DYAD, | 100.0 | |
| 2x36_A | 207 | LON protease homolog, mitochondrial; hydrolase, ca | 100.0 | |
| 1xhk_A | 187 | Putative protease LA homolog; LON protease, ATP de | 100.0 | |
| 1z0w_A | 207 | Putative protease LA homolog type; ATP-dependent p | 100.0 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 99.96 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 99.96 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 99.96 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 99.95 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 99.95 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 99.94 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 99.94 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 99.93 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 99.93 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 99.93 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 99.92 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 99.91 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 99.89 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 99.89 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 99.88 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 99.87 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 99.87 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 99.86 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 99.86 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 99.85 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 99.84 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 99.83 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 99.83 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 99.82 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 99.82 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 99.82 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 99.81 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 99.8 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 99.8 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 99.8 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 99.8 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 99.78 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 99.76 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 99.76 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 99.75 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 99.72 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 99.72 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 99.71 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 99.7 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 99.7 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 99.69 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 99.68 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 99.67 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 99.66 | |
| 1qzm_A | 94 | ATP-dependent protease LA; oligomerization domain, | 99.66 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 99.66 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 99.66 | |
| 3ljc_A | 252 | ATP-dependent protease LA; LON N-domain, allosteri | 99.65 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 99.65 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 99.64 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 99.64 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 99.63 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 99.62 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 99.62 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 99.61 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 99.6 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 99.58 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 99.58 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 99.56 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 99.55 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 99.55 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 99.54 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 99.54 | |
| 3f9v_A | 595 | Minichromosome maintenance protein MCM; replicativ | 99.54 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 99.52 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 99.51 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 99.51 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 99.5 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 99.5 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 99.5 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 99.5 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 99.49 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 99.46 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 99.45 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 99.45 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 99.45 | |
| 3dzd_A | 368 | Transcriptional regulator (NTRC family); sigma43 a | 99.43 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 99.43 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 99.43 | |
| 1ny5_A | 387 | Transcriptional regulator (NTRC family); AAA+ ATPa | 99.41 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 99.4 | |
| 2gno_A | 305 | DNA polymerase III, gamma subunit-related protein; | 99.37 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 99.34 | |
| 3f8t_A | 506 | Predicted ATPase involved in replication control, | 99.33 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 99.31 | |
| 4akg_A | 2695 | Glutathione S-transferase class-MU 26 kDa isozyme | 99.22 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 99.0 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 98.94 | |
| 4akg_A | 2695 | Glutathione S-transferase class-MU 26 kDa isozyme | 98.74 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 98.71 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 98.69 | |
| 1jr3_D | 343 | DNA polymerase III, delta subunit; processivity, p | 98.6 | |
| 1u0j_A | 267 | DNA replication protein; AAA+ protein, P-loop atpa | 98.6 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 98.58 | |
| 3m65_A | 209 | ATP-dependent protease LA 1; coiled-coil, ATP-bind | 98.54 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 98.5 | |
| 2qen_A | 350 | Walker-type ATPase; unknown function; HET: ADP; 2. | 98.46 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 98.38 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 98.34 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 98.32 | |
| 2r2a_A | 199 | Uncharacterized protein; zonular occludens toxin, | 98.32 | |
| 1zbo_A | 210 | Hypothetical protein BPP1347; alpha-beta protein, | 98.04 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 98.01 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 97.96 | |
| 2r8r_A | 228 | Sensor protein; KDPD, PFAM02702, MCSG, structural | 97.79 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 97.75 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 97.66 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 97.65 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 97.49 | |
| 2pnl_A | 203 | Protease VP4; acyl-enzyme, Ser/Lys DYAD, viral pro | 97.42 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 97.35 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 97.31 | |
| 2gef_A | 217 | Protease VP4; birnavirus, serine/lysine DYAD mecha | 97.31 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 97.27 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 97.25 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 97.24 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 97.13 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 97.1 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 97.04 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 97.03 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 97.01 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 97.0 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 96.99 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 96.98 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 96.97 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 96.96 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 96.94 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 96.94 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 96.93 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 96.92 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 96.91 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 96.88 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 96.88 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 96.88 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 96.87 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 96.86 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 96.84 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 96.83 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 96.82 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 96.81 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 96.8 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 96.8 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 96.78 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 96.77 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 96.76 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 96.73 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 96.72 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 96.72 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 96.71 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 96.69 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 96.68 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 96.66 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 96.65 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 96.64 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 96.62 | |
| 2ga8_A | 359 | Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn | 96.61 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 96.6 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 96.6 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 96.58 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 96.57 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 96.56 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 96.54 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 96.54 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 96.53 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 96.53 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 96.53 | |
| 3sr0_A | 206 | Adenylate kinase; phosphoryl transfer analogue, AL | 96.52 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 96.52 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 96.52 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 96.51 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 96.5 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 96.5 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 96.5 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 96.5 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 96.49 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 96.49 | |
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 96.49 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 96.48 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 96.47 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 96.47 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 96.47 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 96.44 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 96.43 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 96.43 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 96.42 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 96.41 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 96.4 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 96.39 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 96.38 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 96.38 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 96.37 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 96.37 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 96.37 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 96.36 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 96.35 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 96.35 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 96.34 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 96.33 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 96.33 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 96.32 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 96.32 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 96.31 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 96.31 | |
| 3r20_A | 233 | Cytidylate kinase; structural genomics, seattle st | 96.31 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 96.3 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 96.3 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 96.3 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 96.3 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 96.29 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 96.29 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 96.29 | |
| 3ake_A | 208 | Cytidylate kinase; CMP kinase, CMP complex, open c | 96.28 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 96.27 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 96.27 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 96.26 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 96.25 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 96.24 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 96.23 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 96.23 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 96.22 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 96.22 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 96.22 | |
| 2fz4_A | 237 | DNA repair protein RAD25; RECA-like domain, DNA da | 96.22 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 96.21 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 96.2 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 96.19 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 96.18 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 96.18 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 96.16 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 96.16 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 96.15 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 96.15 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 96.14 | |
| 3crm_A | 323 | TRNA delta(2)-isopentenylpyrophosphate transferase | 96.14 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 96.14 | |
| 1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 96.11 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 96.11 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 96.1 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 96.1 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 96.1 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 96.09 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 96.08 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 96.06 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 96.06 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 96.05 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 96.02 | |
| 1q3t_A | 236 | Cytidylate kinase; nucleotide monophosphate kinase | 95.99 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 95.99 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 95.98 | |
| 1xx6_A | 191 | Thymidine kinase; NESG, northeast structural genom | 95.98 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 95.97 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 95.97 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 95.95 | |
| 1g5t_A | 196 | COB(I)alamin adenosyltransferase; P-loop protein, | 95.95 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 95.93 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 95.92 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 95.9 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 95.88 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 95.88 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 95.87 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 95.86 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 95.84 | |
| 1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 95.83 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 95.82 | |
| 2grj_A | 192 | Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp | 95.79 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 95.76 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 95.74 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 95.74 | |
| 1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 95.73 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 95.72 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 95.72 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 95.71 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 95.7 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 95.7 | |
| 2h92_A | 219 | Cytidylate kinase; rossmann fold, transferase; HET | 95.66 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 95.66 | |
| 2iut_A | 574 | DNA translocase FTSK; nucleotide-binding, chromoso | 95.65 | |
| 3fdi_A | 201 | Uncharacterized protein; cytidylate kinase like pr | 95.64 | |
| 1w36_D | 608 | RECD, exodeoxyribonuclease V alpha chain; recombin | 95.62 | |
| 3foz_A | 316 | TRNA delta(2)-isopentenylpyrophosphate transferas; | 95.61 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 95.6 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 95.6 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 95.53 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 95.5 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 95.49 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 95.47 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 95.46 | |
| 3exa_A | 322 | TRNA delta(2)-isopentenylpyrophosphate transferase | 95.45 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 95.45 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 95.44 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 95.38 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 95.31 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 95.29 | |
| 2j9r_A | 214 | Thymidine kinase; TK1, DNK, lasso, transferase, AT | 95.21 | |
| 2f1r_A | 171 | Molybdopterin-guanine dinucleotide biosynthesis pr | 95.19 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 95.18 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 95.18 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 95.18 | |
| 3sop_A | 270 | Neuronal-specific septin-3; hydrolase; HET: GDP; 2 | 95.17 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 95.16 | |
| 1a7j_A | 290 | Phosphoribulokinase; transferase, calvin cycle; 2. | 95.16 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 95.16 | |
| 3d3q_A | 340 | TRNA delta(2)-isopentenylpyrophosphate transferase | 95.1 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 95.08 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 95.07 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 95.02 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 95.02 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 95.01 | |
| 2obl_A | 347 | ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O | 95.0 | |
| 2qmh_A | 205 | HPR kinase/phosphorylase; V267F mutation, ATP-bind | 94.94 | |
| 1x6v_B | 630 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 94.86 | |
| 3eph_A | 409 | TRNA isopentenyltransferase; transferase, alternat | 94.84 | |
| 3vkw_A | 446 | Replicase large subunit; alpha/beta domain, helica | 94.78 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 94.74 | |
| 2ius_A | 512 | DNA translocase FTSK; nucleotide-binding, chromoso | 94.71 | |
| 3gmt_A | 230 | Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle | 94.7 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 94.67 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 94.66 | |
| 2krk_A | 86 | 26S protease regulatory subunit 8; structural geno | 94.64 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 94.64 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 94.57 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 94.56 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 94.55 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 94.52 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 94.48 | |
| 3hdt_A | 223 | Putative kinase; structura genomics, PSI-2, protei | 94.47 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 94.38 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 94.37 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 94.36 | |
| 3io5_A | 333 | Recombination and repair protein; storage dimer, i | 94.36 | |
| 3kw6_A | 78 | 26S protease regulatory subunit 8; structural geno | 94.35 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 94.27 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 94.27 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 94.26 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 94.15 | |
| 2npi_A | 460 | Protein CLP1; CLP1-PCF11 complex, ATP binding, ter | 94.09 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 94.07 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 94.01 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 93.97 | |
| 4b3f_X | 646 | DNA-binding protein smubp-2; hydrolase, helicase; | 93.95 | |
| 1m8p_A | 573 | Sulfate adenylyltransferase; rossmann fold, phosph | 93.92 | |
| 4edh_A | 213 | DTMP kinase, thymidylate kinase; structural genomi | 93.89 | |
| 3euj_A | 483 | Chromosome partition protein MUKB, linker; MUKB, M | 93.87 | |
| 1u0l_A | 301 | Probable GTPase ENGC; permutation, OB-fold, zinc-f | 93.83 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 93.77 | |
| 1w4r_A | 195 | Thymidine kinase; type II, human, cytosolic, phosp | 93.77 | |
| 2f9l_A | 199 | RAB11B, member RAS oncogene family; RAB11B GTPase, | 93.7 | |
| 1nrj_B | 218 | SR-beta, signal recognition particle receptor beta | 93.7 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 93.68 | |
| 2yv5_A | 302 | YJEQ protein; hydrolase, GTPase, permutation, stru | 93.67 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 93.67 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 93.63 | |
| 3v9p_A | 227 | DTMP kinase, thymidylate kinase; ssgcid, STRU geno | 93.62 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 93.6 | |
| 1g8f_A | 511 | Sulfate adenylyltransferase; alpha-beta protein, b | 93.57 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 93.55 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 93.53 | |
| 2axn_A | 520 | 6-phosphofructo-2-kinase/fructose-2,6- biphosphata | 93.48 | |
| 3tmk_A | 216 | Thymidylate kinase; phosphotransferase; HET: T5A; | 93.46 | |
| 3thx_A | 934 | DNA mismatch repair protein MSH2; ABC family ATPas | 93.45 | |
| 2ocp_A | 241 | DGK, deoxyguanosine kinase; protein-nucleotide com | 93.43 | |
| 2rcn_A | 358 | Probable GTPase ENGC; YJEQ, circularly permuted, G | 93.42 | |
| 3tqf_A | 181 | HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co | 93.35 | |
| 2dyk_A | 161 | GTP-binding protein; GTPase, ribosome-binding prot | 93.18 | |
| 2vp4_A | 230 | Deoxynucleoside kinase; ATP-binding, DNA synthesis | 93.18 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 93.16 | |
| 3lv8_A | 236 | DTMP kinase, thymidylate kinase; structural genomi | 93.13 | |
| 2lkc_A | 178 | Translation initiation factor IF-2; NMR {Geobacill | 93.09 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 93.09 | |
| 2wji_A | 165 | Ferrous iron transport protein B homolog; membrane | 93.02 | |
| 1bif_A | 469 | 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; | 92.96 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 92.95 | |
| 2zej_A | 184 | Dardarin, leucine-rich repeat kinase 2; parkinson' | 92.92 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 92.92 | |
| 1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 92.81 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 92.78 | |
| 1p5z_B | 263 | DCK, deoxycytidine kinase; nucleoside kinase, P-lo | 92.75 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 92.74 | |
| 4tmk_A | 213 | Protein (thymidylate kinase); ATP:DTMP phosphotran | 92.7 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 92.68 | |
| 3ld9_A | 223 | DTMP kinase, thymidylate kinase; ssgcid, NIH, niai | 92.67 | |
| 2gj8_A | 172 | MNME, tRNA modification GTPase TRME; G-domain dime | 92.64 | |
| 2wjg_A | 188 | FEOB, ferrous iron transport protein B homolog; me | 92.61 | |
| 1svi_A | 195 | GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro | 92.61 | |
| 1z2a_A | 168 | RAS-related protein RAB-23; RAB GTPase, vesicular | 92.6 | |
| 1t9h_A | 307 | YLOQ, probable GTPase ENGC; N-terminal beta-barrel | 92.6 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 92.59 | |
| 1kao_A | 167 | RAP2A; GTP-binding protein, small G protein, GDP, | 92.5 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 92.45 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 92.41 | |
| 2aka_B | 299 | Dynamin-1; fusion protein, GTPase domain, myosin, | 92.4 | |
| 2ce2_X | 166 | GTPase HRAS; signaling protein, guanine nucleotide | 92.39 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 92.37 | |
| 3ice_A | 422 | Transcription termination factor RHO; transcriptio | 92.36 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 92.31 | |
| 3pqc_A | 195 | Probable GTP-binding protein ENGB; rossmann fold, | 92.31 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 92.3 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 92.27 | |
| 1u8z_A | 168 | RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH | 92.23 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 92.22 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 92.22 | |
| 1ek0_A | 170 | Protein (GTP-binding protein YPT51); vesicular tra | 92.21 | |
| 2nzj_A | 175 | GTP-binding protein REM 1; GDP/GTP binding, GTP hy | 92.2 | |
| 1f2t_A | 149 | RAD50 ABC-ATPase; DNA double-strand break repair, | 92.17 | |
| 3thx_B | 918 | DNA mismatch repair protein MSH3; ABC family ATPas | 92.11 | |
| 1z0j_A | 170 | RAB-22, RAS-related protein RAB-22A; RAB GTPase, R | 92.11 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 92.08 | |
| 2fn4_A | 181 | P23, RAS-related protein R-RAS; GDP/GTP binding, G | 92.07 | |
| 1wms_A | 177 | RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p | 92.06 | |
| 1g16_A | 170 | RAS-related protein SEC4; G protein RAB, signaling | 91.98 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 91.98 | |
| 1z08_A | 170 | RAS-related protein RAB-21; RAB GTPase, vesicular | 91.97 | |
| 1qhl_A | 227 | Protein (cell division protein MUKB); SMC, chromos | 91.96 | |
| 3q85_A | 169 | GTP-binding protein REM 2; G-domain, CAV2 beta, si | 91.93 | |
| 1ky3_A | 182 | GTP-binding protein YPT7P; vesicular traffic, GTP | 91.91 | |
| 1upt_A | 171 | ARL1, ADP-ribosylation factor-like protein 1; hydr | 91.9 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 91.89 | |
| 1c1y_A | 167 | RAS-related protein RAP-1A; GTP-binding proteins, | 91.83 | |
| 1r8s_A | 164 | ADP-ribosylation factor 1; protein transport/excha | 91.82 | |
| 1r2q_A | 170 | RAS-related protein RAB-5A; GTPase, GNP, atomic re | 91.77 | |
| 2erx_A | 172 | GTP-binding protein DI-RAS2; GTP hydrolysis, trans | 91.7 | |
| 3q72_A | 166 | GTP-binding protein RAD; G-domain, CAV2 beta, sign | 91.69 | |
| 3bc1_A | 195 | RAS-related protein RAB-27A; RAB27, GTPase, RAB, s | 91.67 | |
| 2hf9_A | 226 | Probable hydrogenase nickel incorporation protein | 91.67 | |
| 2gk6_A | 624 | Regulator of nonsense transcripts 1; UPF1, helicas | 91.59 | |
| 1m2o_B | 190 | GTP-binding protein SAR1, GTP binding protein; zin | 91.53 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 91.46 | |
| 1c9k_A | 180 | COBU, adenosylcobinamide kinase; alpha/beta struct | 91.44 | |
| 2fwr_A | 472 | DNA repair protein RAD25; DNA unwinding, XPB, DNA | 91.41 | |
| 1yrb_A | 262 | ATP(GTP)binding protein; GTPase, P-loop, rossman f | 91.4 | |
| 2hxs_A | 178 | RAB-26, RAS-related protein RAB-28; GTPase, signal | 91.37 | |
| 3con_A | 190 | GTPase NRAS; structural genomics consortium, SGC, | 91.37 | |
| 2y8e_A | 179 | RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti | 91.33 | |
| 2oil_A | 193 | CATX-8, RAS-related protein RAB-25; G-protein, GDP | 91.31 | |
| 1m7b_A | 184 | RND3/RHOE small GTP-binding protein; small GTPase, | 91.3 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 91.28 | |
| 1mky_A | 439 | Probable GTP-binding protein ENGA; GTPase, DER, KH | 91.26 | |
| 1z0f_A | 179 | RAB14, member RAS oncogene family; RAB GTPase, ves | 91.26 | |
| 4dsu_A | 189 | GTPase KRAS, isoform 2B; small G-protein, signalin | 91.25 | |
| 3tw8_B | 181 | RAS-related protein RAB-35; longin domain, RAB GTP | 91.12 | |
| 4dzz_A | 206 | Plasmid partitioning protein PARF; deviant walker | 91.11 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 91.11 | |
| 2a9k_A | 187 | RAS-related protein RAL-A; bacterial ADP-ribosyltr | 91.1 | |
| 4ag6_A | 392 | VIRB4 ATPase, type IV secretory pathway VIRB4 comp | 91.1 | |
| 3e2i_A | 219 | Thymidine kinase; Zn-binding, ATP-binding, DNA syn | 91.09 | |
| 2bme_A | 186 | RAB4A, RAS-related protein RAB4A; GTP-binding prot | 91.08 | |
| 3clv_A | 208 | RAB5 protein, putative; malaria, GTPase, structura | 91.07 | |
| 2g6b_A | 180 | RAS-related protein RAB-26; G-protein, GTP analogu | 91.05 | |
| 2efe_B | 181 | Small GTP-binding protein-like; GEF, GTPase, VPS9, | 91.05 | |
| 3t1o_A | 198 | Gliding protein MGLA; G domain containing protein, | 91.03 | |
| 3bwd_D | 182 | RAC-like GTP-binding protein ARAC6; G domain, cyto | 91.0 | |
| 3kkq_A | 183 | RAS-related protein M-RAS; GTP-binding, GTPase, si | 90.95 | |
| 2fh5_B | 214 | SR-beta, signal recognition particle receptor beta | 90.95 | |
| 1mh1_A | 186 | RAC1; GTP-binding, GTPase, small G-protein, RHO fa | 90.89 | |
| 2cxx_A | 190 | Probable GTP-binding protein ENGB; structural geno | 90.88 | |
| 1fzq_A | 181 | ADP-ribosylation factor-like protein 3; protein-GD | 90.86 | |
| 2bov_A | 206 | RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, | 90.86 | |
| 3k53_A | 271 | Ferrous iron transport protein B; GTPase fold, hel | 90.81 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 90.81 | |
| 3ihw_A | 184 | Centg3; RAS, centaurin, GTPase, structural genomic | 90.81 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 90.77 | |
| 1nij_A | 318 | Hypothetical protein YJIA; structural genomics, P- | 90.75 | |
| 3t5g_A | 181 | GTP-binding protein RHEB; immunoglobulin-like beta | 90.74 | |
| 2gf9_A | 189 | RAS-related protein RAB-3D; G-protein, structural | 90.74 | |
| 3bgw_A | 444 | DNAB-like replicative helicase; ATPase, replicatio | 90.7 | |
| 2iwr_A | 178 | Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi | 90.68 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 90.68 | |
| 1w1w_A | 430 | Structural maintenance of chromosome 1; cohesin, c | 90.66 | |
| 4i1u_A | 210 | Dephospho-COA kinase; structural genomics, niaid, | 90.64 | |
| 3c5c_A | 187 | RAS-like protein 12; GDP, GTPase, structural genom | 90.64 | |
| 3lxx_A | 239 | GTPase IMAP family member 4; structural genomics c | 90.56 | |
| 3tkl_A | 196 | RAS-related protein RAB-1A; vesicle trafficking, p | 90.53 | |
| 3bor_A | 237 | Human initiation factor 4A-II; translation initiat | 90.47 | |
| 4bas_A | 199 | ADP-ribosylation factor, putative (small GTPase, p | 90.46 | |
| 1moz_A | 183 | ARL1, ADP-ribosylation factor-like protein 1; GTP- | 90.44 | |
| 2atv_A | 196 | RERG, RAS-like estrogen-regulated growth inhibitor | 90.42 | |
| 2gf0_A | 199 | GTP-binding protein DI-RAS1; GDP/GTP binding, GTP | 90.38 | |
| 1x3s_A | 195 | RAS-related protein RAB-18; GTPase, GNP, structura | 90.38 | |
| 2qnr_A | 301 | Septin-2, protein NEDD5; structural genomics conso | 90.34 | |
| 3qks_A | 203 | DNA double-strand break repair RAD50 ATPase; RECA- | 90.33 | |
| 2fg5_A | 192 | RAB-22B, RAS-related protein RAB-31; G-protein, GT | 90.33 | |
| 2cjw_A | 192 | GTP-binding protein GEM; nucleotide-binding, small | 90.32 | |
| 1zd9_A | 188 | ADP-ribosylation factor-like 10B; transport protei | 90.3 | |
| 3oes_A | 201 | GTPase rhebl1; small GTPase, structural genomics, | 90.3 | |
| 1f6b_A | 198 | SAR1; gtpases, N-terminal helix, Mg-containing com | 90.3 | |
| 3dz8_A | 191 | RAS-related protein RAB-3B; GDP, GTPase, structura | 90.28 | |
| 3reg_A | 194 | RHO-like small GTPase; cytoskeleton, nucleotide-bi | 90.27 | |
| 1ksh_A | 186 | ARF-like protein 2; small GTPase, small GTP-bindin | 90.27 | |
| 2a5j_A | 191 | RAS-related protein RAB-2B; GTPase, signal transdu | 90.24 | |
| 1vg8_A | 207 | RAS-related protein RAB-7; GTP-binding protein, pr | 90.23 | |
| 1z06_A | 189 | RAS-related protein RAB-33B; RAB GTPase, RAB33B GT | 90.21 | |
| 2p5s_A | 199 | RAS and EF-hand domain containing; G-protein, RAB, | 90.17 | |
| 2gks_A | 546 | Bifunctional SAT/APS kinase; transferase, sulfuryl | 90.14 | |
| 2wjy_A | 800 | Regulator of nonsense transcripts 1; nonsense medi | 90.13 |
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
Probab=100.00 E-value=2.5e-87 Score=769.06 Aligned_cols=531 Identities=49% Similarity=0.840 Sum_probs=469.0
Q ss_pred HHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHhcCCCCCCCchhHHHHHHHHcCCCCccchhHHhcHHHHHHhhhccccc
Q 004834 138 EDDLVALERKMQSAGMPSNIWKHVQKELRRLKKMQPQQPGYTSSRVYLELIADLPWEKASEEIDLDLKAAKERLDSDHYG 217 (728)
Q Consensus 138 ~~~~~~~~~~l~~~~~~~~~~~~~~~el~~l~~~~~~~~~~~~~~~~~~~~~~iP~~~~~~~~~~~l~~~~~~L~~~i~G 217 (728)
.+++++++++++++++|+++.+.+++++++++.+.+.++++.++++|++|++++||+..+.+ ..++..+++.|+++++|
T Consensus 7 ~~~~~~~~~~~~~~~~~~~~~~~~~~el~~l~~~~~~~~e~~~~~~~l~~~~~lp~~~~~~~-~~~~~~~~~~l~~di~G 85 (543)
T 3m6a_A 7 TGEVQTLTEKIEEAGMPDHVKETALKELNRYEKIPSSSAESSVIRNYIDWLVALPWTDETDD-KLDLKEAGRLLDEEHHG 85 (543)
T ss_dssp CCTTTHHHHHHHSSSCCCHHHHHHHHHHHSSCCCSSSCTTTTHHHHHHHHHHHSCSSCCCCC-CCCTTTGGGTHHHHCSS
T ss_pred HHHHHHHHHHHHhCCCCHHHHHHHHHHHHHHhcCCCCCchHhHHHHHHHHHhcCCCCccccc-cccHHHHHHHHHHHhcc
Confidence 45788999999999999999999999999999999999999999999999999999998887 78888899999999999
Q ss_pred hHHHHHHHHHHHHhhccCCCCCCCEEEEEcCCCCChhHHHHHHHHHhCCCeEEEecCCccchhhhccCccccccCCcchH
Q 004834 218 LVRVKQRIIEYLAVRKLKPDARGPVLCFVGPPGVGKTSLASSIASALGRKFIRISLGGVKDEADIRGHRRTYIGSMPGRL 297 (728)
Q Consensus 218 ~~~vk~~i~~~l~~~~~~~~~~~~~lLL~GPpGtGKT~LakalA~~l~~~~~~i~~~~~~~~s~l~g~~~~yvG~~~g~l 297 (728)
++++++++.+++....+....+++++||+||||||||++|+++|..++.+++.+++++..+.+++.|+.+.|+|+.++.+
T Consensus 86 ~~~vk~~i~~~~~l~~~~~~~~g~~vll~Gp~GtGKTtlar~ia~~l~~~~~~i~~~~~~~~~~~~g~~~~~ig~~~~~~ 165 (543)
T 3m6a_A 86 LEKVKERILEYLAVQKLTKSLKGPILCLAGPPGVGKTSLAKSIAKSLGRKFVRISLGGVRDESEIRGHRRTYVGAMPGRI 165 (543)
T ss_dssp CHHHHHHHHHHHHHHHHSSSCCSCEEEEESSSSSSHHHHHHHHHHHHTCEEEEECCCC--------------------CH
T ss_pred HHHHHHHHHHHHHHHHhcccCCCCEEEEECCCCCCHHHHHHHHHHhcCCCeEEEEecccchhhhhhhHHHHHhccCchHH
Confidence 99999999999888777666788899999999999999999999999999999999998889999999999999999999
Q ss_pred HHHHhhcCCCCcEEEEecccccCCCCCCCHHHHHHHhcCcccccccccCCCCeeecCCCcEEEEecCCCCCCChhhhCCe
Q 004834 298 IDGLKRVGVCNPVMLLDEIDKTGSDVRGDPASALLEVLDPEQNKTFNDHYLNVPFDLSKVIFVATANRAQPIPPPLLDRM 377 (728)
Q Consensus 298 ~~~~~~a~~~~~VlllDEidkl~~~~~~~~~~~Ll~~Ld~~~~~~~~d~~~~~~~d~~~vi~I~TtN~~~~l~~~Ll~R~ 377 (728)
.+.+..+...++|+||||||++.++.++++++.|+++||+.++..|.+++.+.++++++++||+|||.++.++|+|++||
T Consensus 166 ~~~~~~a~~~~~vl~lDEid~l~~~~~~~~~~~LL~~ld~~~~~~~~~~~~~~~~~~~~v~iI~ttN~~~~l~~aL~~R~ 245 (543)
T 3m6a_A 166 IQGMKKAGKLNPVFLLDEIDKMSSDFRGDPSSAMLEVLDPEQNSSFSDHYIEETFDLSKVLFIATANNLATIPGPLRDRM 245 (543)
T ss_dssp HHHHHTTCSSSEEEEEEESSSCC---------CCGGGTCTTTTTBCCCSSSCCCCBCSSCEEEEECSSTTTSCHHHHHHE
T ss_pred HHHHHHhhccCCEEEEhhhhhhhhhhccCHHHHHHHHHhhhhcceeecccCCeeecccceEEEeccCccccCCHHHHhhc
Confidence 99999888788899999999999988788899999999999999999999999999999999999999999999999999
Q ss_pred eEEEcCCCCHHHHHHHHHHhhchHHHhhcCCCccccccCHHHHHHHHHHcccccchHHHHHHHHHHHHHHHHHHHHHhhh
Q 004834 378 EVIELPGYTPEEKLRIAMRHLIPRVLDQHGLGSEFLQIPEAMVKLVIQRYTREAGVRNLERNLAALARAAAVKVAEQEQE 457 (728)
Q Consensus 378 ~vI~~~~~t~ee~~~Il~~~l~~~~~~~~~~~~~~~~i~d~~l~~l~~~~~~~~G~R~L~~~I~~l~r~a~~~~~~~~~~ 457 (728)
++|.|++|+.+++..|++.++.+++.+++++....+.++++++..+++.|+++.|+|+|++.|+++|+.++.++++.
T Consensus 246 ~vi~~~~~~~~e~~~Il~~~l~~~~~~~~~~~~~~i~i~~~~l~~l~~~~~~~~~vR~L~~~i~~~~~~aa~~~~~~--- 322 (543)
T 3m6a_A 246 EIINIAGYTEIEKLEIVKDHLLPKQIKEHGLKKSNLQLRDQAILDIIRYYTREAGVRSLERQLAAICRKAAKAIVAE--- 322 (543)
T ss_dssp EEEECCCCCHHHHHHHHHHTHHHHHHHHTTCCGGGCEECHHHHHHHHHHHCCCSSSHHHHHHHHHHHHHHHHHHHTT---
T ss_pred ceeeeCCCCHHHHHHHHHHHHHHHHHHHcCCCcccccCCHHHHHHHHHhCChhhchhHHHHHHHHHHHHHHHHHHhc---
Confidence 99999999999999999999999999999998888999999999999999999999999999999999988887754
Q ss_pred hcCCCCccccccCCccccccccCCCceeEeeccCCCcccccccccccCCceeechhhhhhhcCCCccCchHHHhhhcCCc
Q 004834 458 QALPSSKDVHRLGSPLLDNRLADGAEVEMEVIPMGESTHEVSNTFRITSPLVVDEAMLEKVLGPPRFDDREAAERVAAPG 537 (728)
Q Consensus 458 ~~~~~~~~~~~~~~~~l~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~It~~~L~~~Lg~~~~~~~~~~~~~~~~G 537 (728)
. ...+.||.+++++++|++.|.. +...+.+.+|
T Consensus 323 ~----------------------------------------------~~~~~It~~~l~~~Lg~~~~~~-e~~~~~~~~g 355 (543)
T 3m6a_A 323 E----------------------------------------------RKRITVTEKNLQDFIGKRIFRY-GQAETEDQVG 355 (543)
T ss_dssp C----------------------------------------------CSCCEECTTTTHHHHCSCCSCC-STTTCCCBSS
T ss_pred C----------------------------------------------CcceecCHHHHHHHhCCcccCc-hhhhcccccc
Confidence 1 1246799999999999999998 6655677899
Q ss_pred eeEeeEEeecCceeEEEEEEEecCCceEEEeeccchHHHHHHHHHHHHHHHHhhhccchhcccCCCCCcccEEEEccCCC
Q 004834 538 ISVGLVWTNFGGEVQFVEATAMRGKGELHLTGQLGDVIKESAQIALTWVRARATDLQLVAEDGMNLLQGRDIHIHFPAGA 617 (728)
Q Consensus 538 ~~~gl~~~~~gg~~~~iE~~~~~G~~~~~~tG~~~~~~kES~~~a~~~~~~~~~~l~~~~~~~~~~~~~~di~i~~~~g~ 617 (728)
+++|++|+++||.+++|||.+++|.|++++||++|++||||+++|++|+++++..+|+ ...+|+++|||||+++|+
T Consensus 356 ~v~g~a~~~~~g~~~~ve~~~~~g~~~~~~~G~~~~~~~es~~~a~~~v~~~~~~~g~----~~~~~~~~di~v~~~~g~ 431 (543)
T 3m6a_A 356 VVTGLAYTTVGGDTLSIEVSLSPGKGKLILTGKLGDVMRESAQAAFSYVRSKTEELGI----EPDFHEKYDIHIHVPEGA 431 (543)
T ss_dssp EEEEEEEETTEEEEEEEEEEEESSCSCEEEEESCCHHHHHHHHHHHHHHTSSCGGGSS----CSSCTTTCEEEEEECTTB
T ss_pred ccccccccCCCccceeeEEEeeCCCCceEEecCchHHHHHHHHHHHHHHHHHHHHcCC----CccccCCcceEEEeCCCC
Confidence 9999999999999999999999999999999999999999999999999999988887 345588999999999999
Q ss_pred CCCCCchhHHHHHHHHHHhccCCCCCCCeEEEeeeCCCceeeecCCHHHHHHHHHHcCCCeeeccccCccccccchHhhh
Q 004834 618 VPKDGPSAGVTLVTALVSLFSRKRVRADTAMTGEMTLRGLVLPVGGVKDKILAAHRYGIKRVILPERNLKDLVEVPAAVL 697 (728)
Q Consensus 618 ~~kdGpsaglaia~allSa~~~~~v~~~~a~tGEi~L~G~V~~Vggi~~ki~~A~~~G~~~viiP~~n~~d~~~ip~~~~ 697 (728)
+||+|||||||||+||+|+++++|++++++|||||+|+|+|+||||+++|+.+|+++|+++||+|.+|.+++.++|+.+.
T Consensus 432 ~~k~gpsa~l~ia~ai~s~~~~~~~~~~~~~~GEi~L~G~v~~v~g~~~~~~~a~~~g~~~~iiP~~n~~~~~~~~~~~~ 511 (543)
T 3m6a_A 432 VPKDGPAAGITMATALVSALTGRAVSREVGMTGEITLRGRVLPIGGLKEKALGAHRAGLTTIIAPKDNEKDIEDIPESVR 511 (543)
T ss_dssp CGGGGGGGHHHHHHHHHHHHTSCCBCTTCEECCEECTTCBEECCSCHHHHHHHHHHTTCSBEEEEGGGGGGGGGSCHHHH
T ss_pred CCCCCchhHHHHHHHHHHHccCCCCCCCEEEEEEEcCCceEEeeCCHHHHHHHHHHCCCCEEEECHHHHHHHHhhHHHHh
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCcEEEEeCCHHHHHHHHHcCCCCCC
Q 004834 698 ASLEIILAKRMEDVLEQAFEGGCPWR 723 (728)
Q Consensus 698 ~~i~i~~v~~~~e~~~~~~~~~~~~~ 723 (728)
.+++|++|+|+.||++++|...+...
T Consensus 512 ~~~~i~~v~~l~e~~~~~~~~~~~~~ 537 (543)
T 3m6a_A 512 EGLTFILASHLDEVLEHALVGEKKLE 537 (543)
T ss_dssp TSCBCCEESBHHHHHHHHBC------
T ss_pred CCCEEEEeCCHHHHHHHHHhccCccc
Confidence 99999999999999999987665443
|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >1rre_A ATP-dependent protease LA; catalytic Ser-Lys DYAD, hydrolase; HET: MSE; 1.75A {Escherichia coli} SCOP: d.14.1.10 PDB: 1rr9_A* | Back alignment and structure |
|---|
| >2x36_A LON protease homolog, mitochondrial; hydrolase, catalytic DYAD, transit peptide; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1xhk_A Putative protease LA homolog; LON protease, ATP dependent, catalytic DYAD, hydrolase; HET: MES; 1.90A {Methanocaldococcus jannaschii} SCOP: d.14.1.10 | Back alignment and structure |
|---|
| >1z0w_A Putative protease LA homolog type; ATP-dependent protease, catalytic Ser-Lys DYAD, B-type LON, hydrolase; 1.20A {Archaeoglobus fulgidus} PDB: 1z0b_A 1z0c_A 1z0e_A 1z0g_A 1z0t_A 1z0v_A | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >1qzm_A ATP-dependent protease LA; oligomerization domain, AAA+ protein, hydrolase; 1.90A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >3ljc_A ATP-dependent protease LA; LON N-domain, allosteric enzyme, ATP-binding, DNA-binding, H nucleotide-binding, serine protease, stress respo; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* | Back alignment and structure |
|---|
| >1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3m65_A ATP-dependent protease LA 1; coiled-coil, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; 2.60A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >1zbo_A Hypothetical protein BPP1347; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.60A {Bordetella parapertussis} SCOP: b.122.1.10 | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >2pnl_A Protease VP4; acyl-enzyme, Ser/Lys DYAD, viral protease, substrate complex, product complex, hydrolase; 2.21A {Infectious pancreatic necrosis virus} PDB: 2pnm_A 3rbp_A 3r0b_A | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2gef_A Protease VP4; birnavirus, serine/lysine DYAD mechamism, lysine general base, hydrolase; 2.20A {Blotched snakehead virus} | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
|---|
| >3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
|---|
| >2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* | Back alignment and structure |
|---|
| >3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* | Back alignment and structure |
|---|
| >3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* | Back alignment and structure |
|---|
| >2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* | Back alignment and structure |
|---|
| >2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* | Back alignment and structure |
|---|
| >1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* | Back alignment and structure |
|---|
| >3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* | Back alignment and structure |
|---|
| >3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A | Back alignment and structure |
|---|
| >2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* | Back alignment and structure |
|---|
| >3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} | Back alignment and structure |
|---|
| >2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* | Back alignment and structure |
|---|
| >3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >3kw6_A 26S protease regulatory subunit 8; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A | Back alignment and structure |
|---|
| >1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* | Back alignment and structure |
|---|
| >4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* | Back alignment and structure |
|---|
| >3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* | Back alignment and structure |
|---|
| >1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* | Back alignment and structure |
|---|
| >2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* | Back alignment and structure |
|---|
| >1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* | Back alignment and structure |
|---|
| >3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* | Back alignment and structure |
|---|
| >3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* | Back alignment and structure |
|---|
| >2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V | Back alignment and structure |
|---|
| >3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* | Back alignment and structure |
|---|
| >2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* | Back alignment and structure |
|---|
| >1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A | Back alignment and structure |
|---|
| >2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* | Back alignment and structure |
|---|
| >1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* | Back alignment and structure |
|---|
| >1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* | Back alignment and structure |
|---|
| >2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* | Back alignment and structure |
|---|
| >3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* | Back alignment and structure |
|---|
| >1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* | Back alignment and structure |
|---|
| >1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* | Back alignment and structure |
|---|
| >1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* | Back alignment and structure |
|---|
| >1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* | Back alignment and structure |
|---|
| >1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* | Back alignment and structure |
|---|
| >1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* | Back alignment and structure |
|---|
| >1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... | Back alignment and structure |
|---|
| >1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* | Back alignment and structure |
|---|
| >2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* | Back alignment and structure |
|---|
| >3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* | Back alignment and structure |
|---|
| >2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* | Back alignment and structure |
|---|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A | Back alignment and structure |
|---|
| >1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
|---|
| >1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A | Back alignment and structure |
|---|
| >2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* | Back alignment and structure |
|---|
| >1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* | Back alignment and structure |
|---|
| >2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* | Back alignment and structure |
|---|
| >3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* | Back alignment and structure |
|---|
| >2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* | Back alignment and structure |
|---|
| >2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 | Back alignment and structure |
|---|
| >1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* | Back alignment and structure |
|---|
| >4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* | Back alignment and structure |
|---|
| >3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* | Back alignment and structure |
|---|
| >4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A | Back alignment and structure |
|---|
| >3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* | Back alignment and structure |
|---|
| >3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* | Back alignment and structure |
|---|
| >3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* | Back alignment and structure |
|---|
| >3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C | Back alignment and structure |
|---|
| >3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* | Back alignment and structure |
|---|
| >2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 | Back alignment and structure |
|---|
| >1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... | Back alignment and structure |
|---|
| >2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* | Back alignment and structure |
|---|
| >2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} | Back alignment and structure |
|---|
| >3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 | Back alignment and structure |
|---|
| >3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* | Back alignment and structure |
|---|
| >2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* | Back alignment and structure |
|---|
| >3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* | Back alignment and structure |
|---|
| >3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} | Back alignment and structure |
|---|
| >3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* | Back alignment and structure |
|---|
| >4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} | Back alignment and structure |
|---|
| >1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* | Back alignment and structure |
|---|
| >3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* | Back alignment and structure |
|---|
| >2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* | Back alignment and structure |
|---|
| >1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* | Back alignment and structure |
|---|
| >3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* | Back alignment and structure |
|---|
| >3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* | Back alignment and structure |
|---|
| >1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* | Back alignment and structure |
|---|
| >2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* | Back alignment and structure |
|---|
| >1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* | Back alignment and structure |
|---|
| >1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* | Back alignment and structure |
|---|
| >2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 728 | ||||
| d1rrea_ | 182 | d.14.1.10 (A:) ATP-dependent protease Lon (La), ca | 7e-43 | |
| d1svma_ | 362 | c.37.1.20 (A:) Papillomavirus large T antigen heli | 2e-32 | |
| d1xhka_ | 185 | d.14.1.10 (A:) ATP-dependent protease Lon (La), ca | 4e-31 | |
| d1ofha_ | 309 | c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId | 7e-29 | |
| d1gvnb_ | 273 | c.37.1.21 (B:) Plasmid maintenance system epsilon/ | 1e-27 | |
| d1r6bx3 | 315 | c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, A | 3e-25 | |
| d1lv7a_ | 256 | c.37.1.20 (A:) AAA domain of cell division protein | 5e-22 | |
| d1ixza_ | 247 | c.37.1.20 (A:) AAA domain of cell division protein | 2e-18 | |
| d1np6a_ | 170 | c.37.1.10 (A:) Molybdopterin-guanine dinucleotide | 1e-17 | |
| d1qzma_ | 94 | c.37.1.20 (A:) ATPase domain of protease Lon (La) | 3e-16 | |
| d1w5sa2 | 287 | c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-t | 1e-15 | |
| d1r7ra3 | 265 | c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p | 2e-14 | |
| d1qvra3 | 315 | c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus | 1e-10 | |
| d1w44a_ | 321 | c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta | 6e-10 | |
| d1ixsb2 | 239 | c.37.1.20 (B:4-242) Holliday junction helicase Ruv | 7e-07 | |
| d1fnna2 | 276 | c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrob | 4e-05 | |
| d1e32a2 | 258 | c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p | 5e-05 | |
| d2iyva1 | 165 | c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycoba | 2e-04 | |
| d2gnoa2 | 198 | c.37.1.20 (A:11-208) gamma subunit of DNA polymera | 2e-04 | |
| d1d2na_ | 246 | c.37.1.20 (A:) Hexamerization domain of N-ethylmal | 2e-04 | |
| d1ak2a1 | 190 | c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Co | 5e-04 | |
| d1m8pa3 | 183 | c.37.1.15 (A:391-573) ATP sulfurylase C-terminal d | 5e-04 | |
| d1in4a2 | 238 | c.37.1.20 (A:17-254) Holliday junction helicase Ru | 6e-04 | |
| d1lw7a2 | 192 | c.37.1.1 (A:220-411) Transcriptional regulator Nad | 6e-04 | |
| d1kaga_ | 169 | c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia | 7e-04 | |
| d1rkba_ | 173 | c.37.1.1 (A:) Adenylate kinase {Human (Homo sapien | 7e-04 | |
| d1zp6a1 | 176 | c.37.1.25 (A:6-181) Hypothetical protein Atu3015 { | 7e-04 | |
| d2awna2 | 232 | c.37.1.12 (A:4-235) Maltose transport protein MalK | 0.002 | |
| d1e6ca_ | 170 | c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chr | 0.002 | |
| d1viaa_ | 161 | c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobact | 0.002 | |
| d2ak3a1 | 189 | c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow | 0.004 |
| >d1rrea_ d.14.1.10 (A:) ATP-dependent protease Lon (La), catalytic domain {Escherichia coli [TaxId: 562]} Length = 182 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ribosomal protein S5 domain 2-like superfamily: Ribosomal protein S5 domain 2-like family: ATP-dependent protease Lon (La), catalytic domain domain: ATP-dependent protease Lon (La), catalytic domain species: Escherichia coli [TaxId: 562]
Score = 151 bits (381), Expect = 7e-43
Identities = 94/182 (51%), Positives = 123/182 (67%), Gaps = 4/182 (2%)
Query: 537 GISVGLVWTNFGGEVQFVEATAMRGKGELHLTGQLGDVIKESAQIALTWVRARATDLQLV 596
G GL WT GG++ +E + GKG+L TG LG+V++ES Q ALT VRARA L +
Sbjct: 3 GQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVMQESIQAALTVVRARAEKLGIN 62
Query: 597 AEDGMNLLQGRDIHIHFPAGAVPKDGPSAGVTLVTALVSLFSRKRVRADTAMTGEMTLRG 656
+ RDIH+H P GA PKDGP+AG+ + TALVS + VRAD AMTGE+TLRG
Sbjct: 63 PDFYEK----RDIHVHVPEGATPKDGPAAGIAMCTALVSCLTGNPVRADVAMTGEITLRG 118
Query: 657 LVLPVGGVKDKILAAHRYGIKRVILPERNLKDLVEVPAAVLASLEIILAKRMEDVLEQAF 716
VLP+GG+K+K+LAAHR GIK V++P N +DL E+P V+A L+I KR+E+VL A
Sbjct: 119 QVLPIGGLKEKLLAAHRGGIKTVLIPFENKRDLEEIPDNVIADLDIHPVKRIEEVLTLAL 178
Query: 717 EG 718
+
Sbjct: 179 QN 180
|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 | Back information, alignment and structure |
|---|
| >d1xhka_ d.14.1.10 (A:) ATP-dependent protease Lon (La), catalytic domain {Methanococcus jannaschii [TaxId: 2190]} Length = 185 | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 309 | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Length = 315 | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Length = 170 | Back information, alignment and structure |
|---|
| >d1qzma_ c.37.1.20 (A:) ATPase domain of protease Lon (La) {Escherichia coli [TaxId: 562]} Length = 94 | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Length = 287 | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Length = 315 | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Length = 239 | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276 | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 165 | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Length = 198 | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 246 | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Length = 190 | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Length = 183 | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Length = 238 | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Length = 192 | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Length = 169 | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Length = 173 | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Length = 176 | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Length = 170 | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Length = 161 | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Length = 189 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 728 | |||
| d1rrea_ | 182 | ATP-dependent protease Lon (La), catalytic domain | 100.0 | |
| d1xhka_ | 185 | ATP-dependent protease Lon (La), catalytic domain | 100.0 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 100.0 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 99.97 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 99.94 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 99.93 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 99.92 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 99.92 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 99.89 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 99.87 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 99.79 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 99.79 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 99.75 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 99.75 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 99.74 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 99.74 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 99.74 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 99.72 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 99.72 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 99.7 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 99.65 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 99.62 | |
| d1qzma_ | 94 | ATPase domain of protease Lon (La) {Escherichia co | 99.59 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 99.58 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 99.55 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 99.51 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 99.5 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 99.49 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 99.47 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 99.42 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 99.38 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 99.33 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 99.31 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 99.23 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 98.52 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 98.34 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 98.09 | |
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 97.91 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 97.86 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 97.82 | |
| d1tuea_ | 205 | Replication protein E1 helicase domain {Human papi | 97.75 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 97.74 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 97.71 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 97.66 | |
| d1u0ja_ | 267 | Rep 40 protein helicase domain {Adeno-associated v | 97.65 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 97.64 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 97.58 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 97.57 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 97.53 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 97.5 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 97.47 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 97.47 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 97.4 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 97.39 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 97.38 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 97.38 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 97.29 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 97.28 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 97.28 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 97.23 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 97.21 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 97.19 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 97.16 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 97.15 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 97.13 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 97.12 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 97.11 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 97.07 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 97.07 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 97.05 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 97.03 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 97.01 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 96.94 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 96.92 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 96.91 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 96.91 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 96.9 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 96.87 | |
| d1zboa1 | 197 | Hypothetical protein BPP1347 {Bordetella parapertu | 96.86 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 96.82 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 96.75 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 96.75 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 96.75 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 96.73 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 96.63 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 96.63 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 96.59 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 96.54 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 96.48 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 96.47 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 96.43 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 96.35 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 96.33 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 96.28 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 96.28 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 96.26 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 96.25 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 96.25 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 96.24 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 96.21 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 96.14 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 96.13 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 96.04 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 96.0 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 95.92 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 95.92 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 95.84 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 95.78 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 95.77 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 95.77 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 95.76 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 95.68 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 95.61 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 95.58 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 95.46 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 95.45 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 95.4 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 95.33 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 95.17 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 95.11 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 95.07 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 94.96 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 94.94 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 94.84 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 94.83 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 94.67 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 94.66 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 94.49 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 94.33 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 94.31 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 94.28 | |
| d1wb9a2 | 234 | DNA repair protein MutS, the C-terminal domain {Es | 94.2 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 94.18 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 94.1 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 93.96 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 93.91 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 93.84 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 93.72 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 93.71 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 93.51 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 93.39 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 93.35 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 93.33 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 93.29 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 93.27 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 93.24 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 93.22 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 93.18 | |
| d1tmka_ | 214 | Thymidylate kinase {Baker's yeast (Saccharomyces c | 93.16 | |
| d1ihua1 | 296 | Arsenite-translocating ATPase ArsA {Escherichia co | 93.1 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 93.1 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 93.05 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 93.0 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 92.96 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 92.84 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 92.81 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 92.78 | |
| d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 92.74 | |
| d1knxa2 | 177 | HPr kinase HprK C-terminal domain {Mycoplasma pneu | 92.72 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 92.63 | |
| d1ewqa2 | 224 | DNA repair protein MutS, the C-terminal domain {Th | 92.62 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 92.58 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 92.56 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 92.54 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 92.5 | |
| d2atva1 | 168 | Ras-like estrogen-regulated growth inhibitor, RERG | 92.5 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 92.46 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 92.45 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 92.41 | |
| d1ko7a2 | 169 | HPr kinase HprK C-terminal domain {Staphylococcus | 92.38 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 92.32 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 92.11 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 92.1 | |
| d1veca_ | 206 | DEAD box RNA helicase rck/p54 {Human (Homo sapiens | 92.07 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 92.04 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 91.91 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 91.91 | |
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 91.87 | |
| d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 91.84 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 91.82 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 91.81 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 91.8 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 91.78 | |
| d2erxa1 | 171 | di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 91.76 | |
| d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 91.63 | |
| d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 91.6 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 91.5 | |
| d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 91.5 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 91.49 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 91.41 | |
| d1x3sa1 | 177 | Rab18 {Human (Homo sapiens) [TaxId: 9606]} | 91.37 | |
| d1kmqa_ | 177 | RhoA {Human (Homo sapiens) [TaxId: 9606]} | 91.37 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 91.32 | |
| d2gjsa1 | 168 | Rad {Human (Homo sapiens) [TaxId: 9606]} | 91.31 | |
| d1c1ya_ | 167 | Rap1A {Human (Homo sapiens) [TaxId: 9606]} | 91.31 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 91.3 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 91.16 | |
| d1ek0a_ | 170 | Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T | 91.09 | |
| d2ocpa1 | 241 | Deoxyguanosine kinase {Human (Homo sapiens) [TaxId | 91.05 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 90.94 | |
| d2g3ya1 | 172 | GTP-binding protein GEM {Human (Homo sapiens) [Tax | 90.93 | |
| d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 90.89 | |
| d1u8za_ | 168 | Ras-related protein RalA {Cotton-top tamarin (Sagu | 90.88 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 90.86 | |
| d1e0sa_ | 173 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 90.68 | |
| d1p5zb_ | 241 | Deoxycytidine kinase {Human (Homo sapiens) [TaxId: | 90.55 | |
| d1mh1a_ | 183 | Rac {Human (Homo sapiens) [TaxId: 9606]} | 90.55 | |
| d1m7ba_ | 179 | RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | 90.49 | |
| d1x1ra1 | 169 | Ras-related protein M-Ras (XRas) {Mouse (Mus muscu | 90.43 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 90.34 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 90.33 | |
| d1s2ma1 | 206 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 90.28 | |
| d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 90.18 | |
| d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 90.12 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 90.05 | |
| d2g9na1 | 218 | Initiation factor 4a {Human (Homo sapiens) [TaxId: | 90.03 | |
| d1xzpa2 | 160 | TrmE GTPase domain {Thermotoga maritima [TaxId: 23 | 90.02 | |
| d2fu5c1 | 173 | Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | 89.98 | |
| d1i2ma_ | 170 | Ran {Human (Homo sapiens) [TaxId: 9606]} | 89.86 | |
| d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 89.83 | |
| d1lnza2 | 185 | Obg GTP-binding protein middle domain {Bacillus su | 89.82 | |
| d2atxa1 | 185 | RhoQ {Human (Homo sapiens) [TaxId: 9606]} | 89.82 | |
| d2ngra_ | 191 | CDC42 {Human (Homo sapiens) [TaxId: 9606]} | 89.74 | |
| d1deka_ | 241 | Deoxynucleoside monophosphate kinase {Bacteriophag | 89.6 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 89.48 | |
| d2j0sa1 | 222 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 89.47 | |
| g1ii8.1 | 369 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 89.3 | |
| d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 88.56 | |
| d1qhla_ | 222 | Cell division protein MukB {Escherichia coli [TaxI | 88.55 | |
| d2bmfa2 | 305 | Dengue virus helicase {Dengue virus type 2 [TaxId: | 88.49 | |
| d1zcba2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 88.31 | |
| d1e69a_ | 308 | Smc head domain {Thermotoga maritima [TaxId: 2336] | 88.03 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 87.75 | |
| d1ihua2 | 279 | Arsenite-translocating ATPase ArsA {Escherichia co | 87.7 | |
| d2bmja1 | 175 | Centaurin gamma 1, G domain {Human (Homo sapiens) | 87.41 | |
| d1azta2 | 221 | Transducin (alpha subunit) {Cow (Bos taurus) [TaxI | 86.74 | |
| d1qdea_ | 212 | Initiation factor 4a {Baker's yeast (Saccharomyces | 86.45 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 86.11 | |
| d2bcjq2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 85.94 | |
| d1t6na_ | 207 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 85.88 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 85.57 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 83.71 | |
| d1w1wa_ | 427 | Smc head domain {Baker's yeast (Saccharomyces cere | 83.7 | |
| d1byia_ | 224 | Dethiobiotin synthetase {Escherichia coli [TaxId: | 82.38 | |
| d1svsa1 | 195 | Transducin (alpha subunit) {Rat (Rattus norvegicus | 82.19 | |
| d1wrba1 | 238 | putative ATP-dependent RNA helicase VlgB {Flatworm | 81.91 | |
| d1g7sa4 | 227 | Initiation factor IF2/eIF5b, N-terminal (G) domain | 81.76 | |
| d2jdid3 | 276 | Central domain of beta subunit of F1 ATP synthase | 81.35 | |
| d1hv8a1 | 208 | Putative DEAD box RNA helicase {Archaeon Methanoco | 80.99 | |
| d1p6xa_ | 333 | Thymidine kinase {Equine herpesvirus type 4 [TaxId | 80.37 | |
| d1tq4a_ | 400 | Interferon-inducible GTPase {Mouse (Mus musculus) | 80.36 |
| >d1rrea_ d.14.1.10 (A:) ATP-dependent protease Lon (La), catalytic domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ribosomal protein S5 domain 2-like superfamily: Ribosomal protein S5 domain 2-like family: ATP-dependent protease Lon (La), catalytic domain domain: ATP-dependent protease Lon (La), catalytic domain species: Escherichia coli [TaxId: 562]
Probab=100.00 E-value=8.3e-39 Score=312.03 Aligned_cols=181 Identities=52% Similarity=0.846 Sum_probs=170.6
Q ss_pred CCceeEeeEEeecCceeEEEEEEEecCCceEEEeeccchHHHHHHHHHHHHHHHHhhhccchhcccCCCCCcccEEEEcc
Q 004834 535 APGISVGLVWTNFGGEVQFVEATAMRGKGELHLTGQLGDVIKESAQIALTWVRARATDLQLVAEDGMNLLQGRDIHIHFP 614 (728)
Q Consensus 535 ~~G~~~gl~~~~~gg~~~~iE~~~~~G~~~~~~tG~~~~~~kES~~~a~~~~~~~~~~l~~~~~~~~~~~~~~di~i~~~ 614 (728)
++|+|+||+|++.||.++.||++..+|+|++++||.++..++||..++++++++....++. ...++.++|+|+|++
T Consensus 1 ~iG~v~GL~v~~~gG~ll~IEv~~~~G~g~~~~tG~~~~~~~es~~~a~~~~~~~~~~~~~----~~~~~~~~di~i~~~ 76 (182)
T d1rrea_ 1 RVGQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVMQESIQAALTVVRARAEKLGI----NPDFYEKRDIHVHVP 76 (182)
T ss_dssp CCEEEEEEEEETTEEEEEEEEEEEEECSSCEEEESSBCHHHHHHHHHHHHHHHHTHHHHTC----CTTTTTSEEEEEECS
T ss_pred CeEEEEEEEEECCCCEEEEEEEEEEcCCCcEEEecCcchhhhHHHHHHHHHHHHHHHHcCC----CcccccccceEEEee
Confidence 4799999999999999999999999999999999999999999999999999987766553 223367899999999
Q ss_pred CCCCCCCCchhHHHHHHHHHHhccCCCCCCCeEEEeeeCCCceeeecCCHHHHHHHHHHcCCCeeeccccCccccccchH
Q 004834 615 AGAVPKDGPSAGVTLVTALVSLFSRKRVRADTAMTGEMTLRGLVLPVGGVKDKILAAHRYGIKRVILPERNLKDLVEVPA 694 (728)
Q Consensus 615 ~g~~~kdGpsaglaia~allSa~~~~~v~~~~a~tGEi~L~G~V~~Vggi~~ki~~A~~~G~~~viiP~~n~~d~~~ip~ 694 (728)
+++.+++|||||+|+++|++|++.++|+++++||||||+|+|+|+||||+.+|+.+|++.|+|+||||++|.+|+.++|+
T Consensus 77 ~~~~~~~g~sa~la~~~a~~s~~~~~~i~~~~a~tGei~l~G~V~~Vggi~~ki~~A~~~G~k~viiP~~n~~~~~~~~~ 156 (182)
T d1rrea_ 77 EGATPKDGPAAGIAMCTALVSCLTGNPVRADVAMTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPFENKRDLEEIPD 156 (182)
T ss_dssp STTSCEESSTTHHHHHHHHHHHHHTCCBCTTEEECCEECTTCBEECCSCHHHHHHHHHHTTCCEEEEEGGGGGGGGGSCH
T ss_pred cccccccchhhHHHHHHHHHHHHhCccccccceeeeccccchhhccCCChHHHHHHHHHcCCcEEEecHHHHHHHHhhhH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hhhCCcEEEEeCCHHHHHHHHHcCC
Q 004834 695 AVLASLEIILAKRMEDVLEQAFEGG 719 (728)
Q Consensus 695 ~~~~~i~i~~v~~~~e~~~~~~~~~ 719 (728)
.+.++++|++|+|++||++++|.+.
T Consensus 157 ~~~~~i~i~~v~~i~e~~~~~l~~~ 181 (182)
T d1rrea_ 157 NVIADLDIHPVKRIEEVLTLALQNE 181 (182)
T ss_dssp HHHHHSEEEEESBHHHHHHHHBSSC
T ss_pred HHhCCcEEEEeCcHHHHHHHHhccC
Confidence 9999999999999999999998754
|
| >d1xhka_ d.14.1.10 (A:) ATP-dependent protease Lon (La), catalytic domain {Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qzma_ c.37.1.20 (A:) ATPase domain of protease Lon (La) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zboa1 b.122.1.10 (A:2-198) Hypothetical protein BPP1347 {Bordetella parapertussis [TaxId: 519]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} | Back information, alignment and structure |
|---|
| >d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} | Back information, alignment and structure |
|---|
| >d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|