Citrus Sinensis ID: 004888


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-----
MATSAACVRISSFHYNNNNFSKLCFFRTLDNSSSMLERLLCSSSLHHFLSHKTKLSSLPRNYLYPFRRPLAVISHRPIHPYKVVAMAERTPASTSHSRNKHTNRLAAEHSPYLLQHAHNPVDWFAWGEEAFAEARKRDVPIFLSIGYSTCHWCHVMEVESFEDEGVAKLLNDWFVSIKVDREERPDVDKVYMTYVQALYGGGGWPLSVFLSPDLKPLMGGTYFPPEDKYGRPGFKTILRKVKDAWDKKRDMLAQSGAFAIEQLSEALSASASSNKLPDELPQNALRLCAEQLSKSYDSRFGGFGSAPKFPRPVEIQMMLYHSKKLEDTGKSGEASEGQKMVLFTLQCMAKGGIHDHVGGGFHRYSVDERWHVPHFEKMLYDQGQLANVYLDAFSLTKDVFYSYICRDILDYLRRDMIGPGGEIFSAEDADSAETEGATRKKEGAFYVWTSKEVEDILGEHAILFKEHYYLKPTGNCDLSRMSDPHNEFKGKNVLIELNDSSASASKLGMPLEKYLNILGECRRKLFDVRSKRPRPHLDDKVIVSWNGLVISSFARASKILKSEAESAMFNFPVVGSDRKEYMEVAESAASFIRRHLYDEQTHRLQHSFRNGPSKAPGFLDDYAFLISGLLDLYEFGSGTKWLVWAIELQNTQDELFLDREGGGYFNTTGEDPSVLLRVKEDHDGAEPSGNSVSVINLVRLASIVAGSKSDYYRQNAEHSLYLRQD
cccccEEEEEEcccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccHHHHHccccccccccccHHHHHHHHHccccEEEEEccccccHHHHHHHHHcccHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHccccccccEEEEccccccEEEEcccccccccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHcccccccccccEEEcccccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHcccHHHHHHHcccccccccccccccccccccccccEEEcccccHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHcccccccEEEEEcccccccccccHHcHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccEEEEccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHc
ccccEEEEEEEEEEEccccccEEEEEEcccccHHHHHHHHHcHHHHccccccccccccccccccccccccEEcccccccccHEHEHcccccccccccccccccHHcccccHHHHHHcccccccccccHHHHHHHHHccccEEEEEccccccHHHHEcccccccHHHHHHHHHccEEEEEcccccccHHHHHHHHHHHHcccccccEEEEEccccccEEEEcccccccccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHccHHccccccccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHccccccccccccEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccEEEccccccccccccccccccEEEEEcHHHHHHHHccHHHHHHHHccccccccEccccccccccccccccEEEEcccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHccccccccccHHHHHHHHHHHHHHHHHHcccccccEEEEccccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccccEEEcccccccEEEEEcccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcc
MATSAACVRISsfhynnnnfskLCFFRTLDNSSSMLERLLCSSSlhhflshktklsslprnylypfrrplavishrpihpykvvamaertpastshsrnkhtnrlaaehspyllqhahnpvdwfawGEEAFAEArkrdvpiflsigystchwchvmevesfEDEGVAKLLNDWFVSIkvdreerpdvdkVYMTYVQALyggggwplsvflspdlkplmggtyfppedkygrpgfKTILRKVKDAWDKKRDMLAQSGAFAIEQLSEALSasassnklpdelpQNALRLCAEQLSKSydsrfggfgsapkfprpvEIQMMLYHSKkledtgksgeasegQKMVLFTLQCMakggihdhvgggfhrysvderwhvphfekmlYDQGQLANVYLDAFSLTKDVFYSYICRDILDYLRrdmigpggeifsaedadsaetegatrkkegaFYVWTSKEVEDILGEHAILFKEhyylkptgncdlsrmsdphnefkgknVLIELndssasasklgmPLEKYLNILGECRRKLfdvrskrprphlddkvivSWNGLVISSFARASKILKSEAesamfnfpvvgsdrkEYMEVAESAASFIRRHLYDEQTHRLqhsfrngpskapgfldDYAFLISGLLDLYEFGSGTKWLVWAIELQNTQDelfldregggyfnttgedpsvllrvkedhdgaepsgnsvSVINLVRLASIVagsksdyyrqnaEHSLYLRQD
MATSAACVRISSfhynnnnfsKLCFFRTLDNSSSMLERLLCSSSLHHFLSHKTKLSSLPRNYLYPFRRPLAVISHRPIHPYKVVAMAErtpastshsrnKHTNRLAAEHSPYLLQHAHNPVDWFAWGEEAFAEARKRDVPIFLSIGYSTCHWCHVMEVESFEDEGVAKLLNDWFVSikvdreerpdvdkVYMTYVQALYGGGGWPLSVFLSPDLKPLMGGtyfppedkygrpgFKTILRKVKDAWDKKRDMLAQSGAFAIEQLSEALSASASSNKLPDELPQNALRLCAEQLSKSYDSRFGGFGSAPKFPRPVEIQMMLYHSKKLEDTGKSGEASEGQKMVLFTLQCMAKGGIHDHVGGGFHRYSVDERWHVPHFEKMLYDQGQLANVYLDAFSLTKDVFYSYICRDILDYLRRDMIGPGGeifsaedadsaetegatrkkegafyvWTSKEVEDILGEHAILFKEHYYLKPTGNCDLSRMSDPHNEFKGKNVLIELNDSSASASKLGMPLEKYLNILGECRRKLfdvrskrprphlddkvivswNGLVISSFARASKILKSEAESAMFNFPVVGSDRKEYMEVAESAASFIRRHLYDEQTHRLQHSFRNGPSKAPGFLDDYAFLISGLLDLYEFGSGTKWLVWAIELQNTQDELFLDREGGGYFNTTGEDPSVLLRVKEDHDgaepsgnsvsvinLVRLASIvagsksdyyrqnaehslylrqd
MATSAACVRISSFHYNNNNFSKLCFFRTLDNSSSMLERllcssslhhflshktklsslPRNYLYPFRRPLAVISHRPIHPYKVVAMAERTPASTSHSRNKHTNRLAAEHSPYLLQHAHNPVDwfawgeeafaeaRKRDVPIFLSIGYSTCHWCHVMEVESFEDEGVAKLLNDWFVSIKVDREERPDVDKVYMTYVQALYGGGGWPLSVFLSPDLKPLMGGTYFPPEDKYGRPGFKTILRKVKDAWDKKRDMLAQSGAFAIEQlsealsasassNKLPDELPQNALRLCAEQLSKSYDSRFGGFGSAPKFPRPVEIQMMLYHSKKLEDTGKSGEASEGQKMVLFTLQCMAKGGIHDHVGGGFHRYSVDERWHVPHFEKMLYDQGQLANVYLDAFSLTKDVFYSYICRDILDYLRRDMIGPGGEIFSAEDADSAETEGATRKKEGAFYVWTSKEVEDILGEHAILFKEHYYLKPTGNCDLSRMSDPHNEFKGKNVLIELNDSSASASKLGMPLEKYLNILGECRRKLFDVRSKRPRPHLDDKVIVSWNGLVISSFARASKILKSEAESAMFNFPVVGSDRKEYMEVAESAASFIRRHLYDEQTHRLQHSFRNGPSKAPGFLDDYAFLISGLLDLYEFGSGTKWLVWAIELQNTQDELFLDREGGGYFNTTGEDPSVLLRVKEDHDGAEPSGNSVSVINLVRLASIVAGSKSDYYRQNAEHSLYLRQD
*****ACVRISSFHYNNNNFSKLCFFRTLDNSSSMLERLLCSSSLHHFLSHKTKLSSLPRNYLYPFRRPLAVISHRPIHPYKVVAM************************PYLLQHAHNPVDWFAWGEEAFAEARKRDVPIFLSIGYSTCHWCHVMEVESFEDEGVAKLLNDWFVSIKVDREERPDVDKVYMTYVQALYGGGGWPLSVFLSPDLKPLMGGTYFPPEDKYGRPGFKTILRKVKDAWDKKRDMLA***AF********************************************************IQMML********************MVLFTLQCMAKGGIHDHVGGGFHRYSVDERWHVPHFEKMLYDQGQLANVYLDAFSLTKDVFYSYICRDILDYLRRDMIGPGGEIF******************GAFYVWTSKEVEDILGEHAILFKEHYYLKPTGNCDL**************VLI************GMPLEKYLNILGECRRKLFDVRSKRPRPHLDDKVIVSWNGLVISSFARASKILKSEAESAMFNFPVVGSDRKEYMEVAESAASFIRRHLYDEQTHRL**********APGFLDDYAFLISGLLDLYEFGSGTKWLVWAIELQNTQDELFLDREGGGYFNTTG****VLL***************VSVINLVRLASIVAGSKSDYY*************
*****AC*RISSFHYNNNNFSKLCFFRTLDNSSSMLERLLCSSSLHHFLSHKTK*SS****************************************************SPYLLQHAHNPVDWFAWGEEAFAEARKRDVPIFLSIGYSTCHWCHVMEVESFEDEGVAKLLNDWFVSIKVDREERPDVDKVYMTYVQALYGGGGWPLSVFLSPDLKPLMGGTYFPPEDKYGRPGFKTILRKVKDAWDKKRDMLA***AF************************NALRLCAEQLSKSYDSRFGGFGSAPKFPRPVEIQMMLYHSKKLEDTGKSGEASEGQKMVLFTLQCMAKGGIHDHVGGGFHRYSVDERWHVPHFEKMLYDQGQLANVYLDAFSLTKDVFYSYICRDILDYLRRDMIGPGGEIFSAEDADSAETEGATRKKEGAFYVWTSKEVEDILGEHAILFKEHYYLKPTGNCDLSRMSDPHNEFKGKNVLIELNDSSASASKLGMPLEKYLNILGECRRKLFDVRSKRPRPHLDDKVIVSWNGLVISSFARASKILKSEAESAMFNFPVVGSDRKEYMEVAESAASFIRRHLYDEQTHRLQHSFRNGPSKAPGFLDDYAFLISGLLDLYEFGSGTKWLVWAIELQNTQDELFLDREGGGYFNTTGEDPSVLLRVKEDHDGAEPSGNSVSVINLVRLASIVAGSKSDYYRQNAEHSLYLRQ*
MATSAACVRISSFHYNNNNFSKLCFFRTLDNSSSMLERLLCSSSLHHFLSHKTKLSSLPRNYLYPFRRPLAVISHRPIHPYKVVAMA***************NRLAAEHSPYLLQHAHNPVDWFAWGEEAFAEARKRDVPIFLSIGYSTCHWCHVMEVESFEDEGVAKLLNDWFVSIKVDREERPDVDKVYMTYVQALYGGGGWPLSVFLSPDLKPLMGGTYFPPEDKYGRPGFKTILRKVKDAWDKKRDMLAQSGAFAIEQLSEA**********PDELPQNALRLCAEQLSKSYDSRFGGFGSAPKFPRPVEIQMMLYHSKKL**********EGQKMVLFTLQCMAKGGIHDHVGGGFHRYSVDERWHVPHFEKMLYDQGQLANVYLDAFSLTKDVFYSYICRDILDYLRRDMIGPGGEIFSA************RKKEGAFYVWTSKEVEDILGEHAILFKEHYYLKPTGNCDLSRMSDPHNEFKGKNVLIELNDSSASASKLGMPLEKYLNILGECRRKLFDVRSKRPRPHLDDKVIVSWNGLVISSFARASKILKSEAESAMFNFPVVGSDRKEYMEVAESAASFIRRHLYDEQTHRLQHSFRNGPSKAPGFLDDYAFLISGLLDLYEFGSGTKWLVWAIELQNTQDELFLDREGGGYFNTTGEDPSVLLRVKEDHDGAEPSGNSVSVINLVRLASIVAGSKSDYYRQNAEHSLYLRQD
***SAACVRISSFHYNNNNFSKLCFFRTLDNSSSMLERLLCSSSLHHFLSHKTKLSSLPRNYLYPFRRPLAVISHRPIHPYKVVAMAE*************TNRLAAEHSPYLLQHAHNPVDWFAWGEEAFAEARKRDVPIFLSIGYSTCHWCHVMEVESFEDEGVAKLLNDWFVSIKVDREERPDVDKVYMTYVQALYGGGGWPLSVFLSPDLKPLMGGTYFPPEDKYGRPGFKTILRKVKDAWDKKRDMLAQSGAFAIEQLSEALSASAS****PDELPQNALRLCAEQLSKSYDSRFGGFGSAPKFPRPVEIQMMLYHSKKLEDTGKSGEASEGQKMVLFTLQCMAKGGIHDHVGGGFHRYSVDERWHVPHFEKMLYDQGQLANVYLDAFSLTKDVFYSYICRDILDYLRRDMIGPGGEIFSAEDADSAETEGATRKKEGAFYVWTSKEVEDILGEHAILFKEHYYLKPTGNCDLSRMSDPHNEFKGKNVLIELNDSSASASKLGMPLEKYLNILGECRRKLFDVRSKRPRPHLDDKVIVSWNGLVISSFARASKILKSEAESAMFNFPVVGSDRKEYMEVAESAASFIRRHLYDEQTHRLQHSFRNGPSKAPGFLDDYAFLISGLLDLYEFGSGTKWLVWAIELQNTQDELFLDREGGGYFNTTGEDPSVLLRVKEDHDGAEPSGNSVSVINLVRLASIVAGSKSDYYRQNAEHSLYLRQD
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATSAACVRISSFHYNNNNFSKLCFFRTLDNSSSMLERLLCSSSLHHFLSHKTKLSSLPRNYLYPFRRPLAVISHRPIHPYKVVAMAERTPASTSHSRNKHTNRLAAEHSPYLLQHAHNPVDWFAWGEEAFAEARKRDVPIFLSIGYSTCHWCHVMEVESFEDEGVAKLLNDWFVSIKVDREERPDVDKVYMTYVQALYGGGGWPLSVFLSPDLKPLMGGTYFPPEDKYGRPGFKTILRKVKDAWDKKRDMLAQSGAFAIEQLSEALSASASSNKLPDELPQNALRLCAEQLSKSYDSRFGGFGSAPKFPRPVEIQMMLYHSKKLEDTGKSGEASEGQKMVLFTLQCMAKGGIHDHVGGGFHRYSVDERWHVPHFEKMLYDQGQLANVYLDAFSLTKDVFYSYICRDILDYLRRDMIGPGGEIFSAEDADSAETEGATRKKEGAFYVWTSKEVEDILGEHAILFKEHYYLKPTGNCDLSRMSDPHNEFKGKNVLIELNDSSASASKLGMPLEKYLNILGECRRKLFDVRSKRPRPHLDDKVIVSWNGLVISSFARASKILKSEAESAMFNFPVVGSDRKEYMEVAESAASFIRRHLYDEQTHRLQHSFRNGPSKAPGFLDDYAFLISGLLDLYEFGSGTKWLVWAIELQNTQDELFLDREGGGYFNTTGEDPSVLLRVKEDHDGAEPSGNSVSVINLVRLASIVAGSKSDYYRQNAEHSLYLRQD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query725 2.2.26 [Sep-21-2011]
Q8TB22 786 Spermatogenesis-associate yes no 0.798 0.736 0.468 1e-160
Q80YT5 790 Spermatogenesis-associate yes no 0.797 0.731 0.455 1e-156
Q6T393 789 Spermatogenesis-associate yes no 0.798 0.733 0.448 1e-154
Q09214 729 Uncharacterized protein B yes no 0.817 0.813 0.413 1e-136
P37512 689 Uncharacterized protein Y yes no 0.764 0.804 0.411 1e-129
P3750979 Uncharacterized protein Y no no 0.068 0.632 0.745 2e-16
>sp|Q8TB22|SPT20_HUMAN Spermatogenesis-associated protein 20 OS=Homo sapiens GN=SPATA20 PE=2 SV=3 Back     alignment and function desciption
 Score =  565 bits (1457), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 297/634 (46%), Positives = 400/634 (63%), Gaps = 55/634 (8%)

Query: 91  PASTSHSRNKHTNRLAAEHSPYLLQHAHNPVDWFAWGEEAFAEARKRDVPIFLSIGYSTC 150
           P+ST     +  NRL  E SPYLLQHA+NPVDW+ WG+EAF +ARK + PIFLS+GYSTC
Sbjct: 54  PSSTPQ---RVPNRLIHEKSPYLLQHAYNPVDWYPWGQEAFDKARKENKPIFLSVGYSTC 110

Query: 151 HWCHVMEVESFEDEGVAKLLNDWFVSIKVDREERPDVDKVYMTYVQALYGGGGWPLSVFL 210
           HWCH+ME ESF++E + +LL++ FVS+KVDREERPDVDKVYMT+VQA   GGGWP++V+L
Sbjct: 111 HWCHMMEEESFQNEEIGRLLSEDFVSVKVDREERPDVDKVYMTFVQATSSGGGWPMNVWL 170

Query: 211 SPDLKPLMGGTYFPPEDKYGRPGFKTILRKVKDAWDKKRDMLAQSGAFAIEQLSEALSAS 270
           +P+L+P +GGTYFPPED   R GF+T+L ++++ W + ++ L ++     ++++ AL A 
Sbjct: 171 TPNLQPFVGGTYFPPEDGLTRVGFRTVLLRIREQWKQNKNTLLENS----QRVTTALLAR 226

Query: 271 ASSNKLPDELPQNALRL---CAEQLSKSYDSRFGGFGSAPKFPRPVEIQMML--YHSKKL 325
           +  +    +LP +A  +   C +QL + YD  +GGF  APKFP PV +  +   + S +L
Sbjct: 227 SEISVGDRQLPPSAATVNNRCFQQLDEGYDEEYGGFAEAPKFPTPVILSFLFSYWLSHRL 286

Query: 326 EDTGKSGEASEGQKMVLFTLQCMAKGGIHDHVGGGFHRYSVDERWHVPHFEKMLYDQGQL 385
              G     S  Q+M L TL+ MA GGI DHVG GFHRYS D +WHVPHFEKMLYDQ QL
Sbjct: 287 TQDG-----SRAQQMALHTLKMMANGGIRDHVGQGFHRYSTDRQWHVPHFEKMLYDQAQL 341

Query: 386 ANVYLDAFSLTKDVFYSYICRDILDYLRRDMIGPGGEIFSAEDADSAETEGATRKKEGAF 445
           A  Y  AF L+ D FYS + + IL Y+ R +    G  +SAEDADS    G  R KEGA+
Sbjct: 342 AVAYSQAFQLSGDEFYSDVAKGILQYVARSLSHRSGGFYSAEDADSPPERG-QRPKEGAY 400

Query: 446 YVWTSKEVEDILGEHAI----------LFKEHYYLKPTGNCDLSRMSDPHNEFKGKNVLI 495
           YVWT KEV+ +L E  +          L  +HY L   GN  +S   DP  E +G+NVL 
Sbjct: 401 YVWTVKEVQQLLPEPVLGATEPLTSGQLLMKHYGLTEAGN--ISPSQDPKGELQGQNVLT 458

Query: 496 ELNDSSASASKLGMPLEKYLNILGECRRKLFDVRSKRPRPHLDDKVIVSWNGLVISSFAR 555
                  +A++ G+ +E    +L     KLF  R  RP+PHLD K++ +WNGL++S +A 
Sbjct: 459 VRYSLELTAARFGLDVEAVRTLLNSGLEKLFQARKHRPKPHLDSKMLAAWNGLMVSGYAV 518

Query: 556 ASKILKSEAESAMFNFPVVGSDRKEYMEVAESAASFIRRHLYDEQTHRLQHSFRNGP--- 612
              +L              G DR   +  A + A F++RH++D  + RL  +   GP   
Sbjct: 519 TGAVL--------------GQDR--LINYATNGAKFLKRHMFDVASGRLMRTCYTGPGGT 562

Query: 613 ---SKAP--GFLDDYAFLISGLLDLYEFGSGTKWLVWAIELQNTQDELFLDREGGGYFNT 667
              S  P  GFL+DYAF++ GLLDLYE    + WL WA+ LQ+TQD+LF D +GGGYF +
Sbjct: 563 VEHSNPPCWGFLEDYAFVVRGLLDLYEASQESAWLEWALRLQDTQDKLFWDSQGGGYFCS 622

Query: 668 TGEDPSVL-LRVKEDHDGAEPSGNSVSVINLVRL 700
             E  + L LR+K+D DGAEPS NSVS  NL+RL
Sbjct: 623 EAELGAGLPLRLKDDQDGAEPSANSVSAHNLLRL 656




May play a role in fertility regulation.
Homo sapiens (taxid: 9606)
>sp|Q80YT5|SPT20_MOUSE Spermatogenesis-associated protein 20 OS=Mus musculus GN=Spata20 PE=2 SV=1 Back     alignment and function description
>sp|Q6T393|SPT20_RAT Spermatogenesis-associated protein 20 OS=Rattus norvegicus GN=Spata20 PE=1 SV=1 Back     alignment and function description
>sp|Q09214|YP65_CAEEL Uncharacterized protein B0495.5 OS=Caenorhabditis elegans GN=B0495.5 PE=4 SV=2 Back     alignment and function description
>sp|P37512|YYAL_BACSU Uncharacterized protein YyaL OS=Bacillus subtilis (strain 168) GN=yyaL PE=4 SV=1 Back     alignment and function description
>sp|P37509|YYAO_BACSU Uncharacterized protein YyaO OS=Bacillus subtilis (strain 168) GN=yyaO PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query725
359479833819 PREDICTED: spermatogenesis-associated pr 0.899 0.796 0.831 0.0
296086616754 unnamed protein product [Vitis vinifera] 0.864 0.831 0.847 0.0
449436537 855 PREDICTED: spermatogenesis-associated pr 0.948 0.804 0.770 0.0
255559290 874 conserved hypothetical protein [Ricinus 0.874 0.725 0.845 0.0
449498445 855 PREDICTED: LOW QUALITY PROTEIN: spermato 0.948 0.804 0.764 0.0
115432144 839 cold-induced thioredoxin domain-containi 0.891 0.769 0.812 0.0
356570951755 PREDICTED: spermatogenesis-associated pr 0.864 0.830 0.804 0.0
356505532809 PREDICTED: spermatogenesis-associated pr 0.917 0.822 0.781 0.0
357511183809 Spermatogenesis-associated protein [Medi 0.918 0.823 0.760 0.0
224132400756 predicted protein [Populus trichocarpa] 0.852 0.817 0.838 0.0
>gi|359479833|ref|XP_002267103.2| PREDICTED: spermatogenesis-associated protein 20-like [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1143 bits (2957), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 543/653 (83%), Positives = 593/653 (90%), Gaps = 1/653 (0%)

Query: 68  RPLAVISHRPIHPYKVVAMAERTPASTSHSRNKHTNRLAAEHSPYLLQHAHNPVDWFAWG 127
           R L +   R +H  KV+AMAER+  + SHS +K+TNRLAAEHSPYLLQHAHNPVDW+ WG
Sbjct: 43  RTLPLFPRRHVHTLKVLAMAERSMKTASHS-HKYTNRLAAEHSPYLLQHAHNPVDWYPWG 101

Query: 128 EEAFAEARKRDVPIFLSIGYSTCHWCHVMEVESFEDEGVAKLLNDWFVSIKVDREERPDV 187
           EEAF+E+RKRDVPIFLSIGYSTCHWCHVMEVESFE+EGVAKLLNDWFVSIKVDREERPDV
Sbjct: 102 EEAFSESRKRDVPIFLSIGYSTCHWCHVMEVESFENEGVAKLLNDWFVSIKVDREERPDV 161

Query: 188 DKVYMTYVQALYGGGGWPLSVFLSPDLKPLMGGTYFPPEDKYGRPGFKTILRKVKDAWDK 247
           DKVYMTYVQALYGGGGWPLSVFLSPDLKPLMGGTYFPP+DKYGRPGFKT+LRKVKDAW+ 
Sbjct: 162 DKVYMTYVQALYGGGGWPLSVFLSPDLKPLMGGTYFPPDDKYGRPGFKTVLRKVKDAWEN 221

Query: 248 KRDMLAQSGAFAIEQLSEALSASASSNKLPDELPQNALRLCAEQLSKSYDSRFGGFGSAP 307
           KRD+L +SGAFAIEQLSEALSA+ASSNKL D +PQ AL LCAEQL+ +YD  +GGFGSAP
Sbjct: 222 KRDVLVKSGAFAIEQLSEALSATASSNKLADGIPQQALHLCAEQLAGNYDPEYGGFGSAP 281

Query: 308 KFPRPVEIQMMLYHSKKLEDTGKSGEASEGQKMVLFTLQCMAKGGIHDHVGGGFHRYSVD 367
           KFPRPVEIQ+MLYH KKLE++GKSGEA+E  KMV F+LQCMA+GG+HDH+GGGFHRYSVD
Sbjct: 282 KFPRPVEIQLMLYHYKKLEESGKSGEANEVLKMVAFSLQCMARGGVHDHIGGGFHRYSVD 341

Query: 368 ERWHVPHFEKMLYDQGQLANVYLDAFSLTKDVFYSYICRDILDYLRRDMIGPGGEIFSAE 427
           E WHVPHFEKMLYDQGQLAN YLD FS+TKDVFYS + RDILDYLRRDMIGP GEIFSAE
Sbjct: 342 ECWHVPHFEKMLYDQGQLANAYLDVFSITKDVFYSCVSRDILDYLRRDMIGPEGEIFSAE 401

Query: 428 DADSAETEGATRKKEGAFYVWTSKEVEDILGEHAILFKEHYYLKPTGNCDLSRMSDPHNE 487
           DADSAE+E A RKKEGAFY+WTSKEVED++GEHA LFK+HYY+KP+GNCDLSRMSDPHNE
Sbjct: 402 DADSAESEDAARKKEGAFYIWTSKEVEDVIGEHASLFKDHYYIKPSGNCDLSRMSDPHNE 461

Query: 488 FKGKNVLIELNDSSASASKLGMPLEKYLNILGECRRKLFDVRSKRPRPHLDDKVIVSWNG 547
           FKGKNVLIE N +SA ASKLGMP+EKYL+ILG CRRKLFDVR  RPRPHLDDKVIVSWNG
Sbjct: 462 FKGKNVLIERNCASAMASKLGMPVEKYLDILGTCRRKLFDVRLNRPRPHLDDKVIVSWNG 521

Query: 548 LVISSFARASKILKSEAESAMFNFPVVGSDRKEYMEVAESAASFIRRHLYDEQTHRLQHS 607
           L ISSFARASKILKSEAE   F FPVVG D KEYMEVAE AASFIR+ LYDEQT RL+HS
Sbjct: 522 LAISSFARASKILKSEAEGTKFRFPVVGCDPKEYMEVAEKAASFIRKWLYDEQTRRLRHS 581

Query: 608 FRNGPSKAPGFLDDYAFLISGLLDLYEFGSGTKWLVWAIELQNTQDELFLDREGGGYFNT 667
           FRNGPSKAPGFLDDYAFLISGLLD+YEFG  T WLVWAIELQ+TQDELFLD+EGGGYFNT
Sbjct: 582 FRNGPSKAPGFLDDYAFLISGLLDIYEFGGNTNWLVWAIELQDTQDELFLDKEGGGYFNT 641

Query: 668 TGEDPSVLLRVKEDHDGAEPSGNSVSVINLVRLASIVAGSKSDYYRQNAEHSL 720
            GEDPSVLLRVKEDHDGAEPSGNSVSVINLVRL S+VAGS  + +R+NAEH L
Sbjct: 642 PGEDPSVLLRVKEDHDGAEPSGNSVSVINLVRLTSMVAGSWFERHRRNAEHLL 694




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|296086616|emb|CBI32251.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449436537|ref|XP_004136049.1| PREDICTED: spermatogenesis-associated protein 20-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255559290|ref|XP_002520665.1| conserved hypothetical protein [Ricinus communis] gi|223540050|gb|EEF41627.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|449498445|ref|XP_004160539.1| PREDICTED: LOW QUALITY PROTEIN: spermatogenesis-associated protein 20-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|115432144|gb|ABI97349.1| cold-induced thioredoxin domain-containing protein [Ammopiptanthus mongolicus] Back     alignment and taxonomy information
>gi|356570951|ref|XP_003553646.1| PREDICTED: spermatogenesis-associated protein 20-like [Glycine max] Back     alignment and taxonomy information
>gi|356505532|ref|XP_003521544.1| PREDICTED: spermatogenesis-associated protein 20-like [Glycine max] Back     alignment and taxonomy information
>gi|357511183|ref|XP_003625880.1| Spermatogenesis-associated protein [Medicago truncatula] gi|355500895|gb|AES82098.1| Spermatogenesis-associated protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|224132400|ref|XP_002321330.1| predicted protein [Populus trichocarpa] gi|222862103|gb|EEE99645.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query725
TAIR|locus:2125541 818 AT4G03200 [Arabidopsis thalian 0.902 0.799 0.739 3e-266
ZFIN|ZDB-GENE-030131-7269 818 spata20 "spermatogenesis assoc 0.819 0.726 0.465 8.1e-147
UNIPROTKB|F1NIQ1685 SPATA20 "Uncharacterized prote 0.817 0.865 0.469 4.2e-143
UNIPROTKB|A4FV36 789 SPATA20 "Uncharacterized prote 0.830 0.762 0.455 5.6e-139
UNIPROTKB|Q8TB22 786 SPATA20 "Spermatogenesis-assoc 0.802 0.740 0.454 9.2e-139
UNIPROTKB|E2QU41 789 SPATA20 "Uncharacterized prote 0.820 0.754 0.443 1.9e-138
UNIPROTKB|F1PTK3 789 MYCBPAP "Uncharacterized prote 0.820 0.754 0.443 1.9e-138
UNIPROTKB|F6UYN9 821 MYCBPAP "Uncharacterized prote 0.820 0.724 0.443 1.9e-138
UNIPROTKB|F1RT97 789 LOC100738512 "Uncharacterized 0.830 0.762 0.451 4e-138
UNIPROTKB|I3LGI2 773 LOC100738512 "Uncharacterized 0.791 0.742 0.457 2.9e-135
TAIR|locus:2125541 AT4G03200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2561 (906.6 bits), Expect = 3.0e-266, P = 3.0e-266
 Identities = 485/656 (73%), Positives = 543/656 (82%)

Query:    66 FRRPLAVISHRPIHPYKVVAMAERTPAS-TSHSRNKHTNRLAAEHSPYLLQHAHNPVDXX 124
             F  P   I  RPI   KV+AMAE + +S TS +  KHTNRLAAEHSPYLLQHAHNPVD  
Sbjct:    43 FSSPFPPILSRPISSGKVLAMAEESSSSSTSSTSQKHTNRLAAEHSPYLLQHAHNPVDWY 102

Query:   125 XXXXXXXXXXRKRDVPIFLSIGYSTCHWCHVMEVESFEDEGVAKLLNDWFVSIKVDREER 184
                       RKRDVPIFLSIGYSTCHWCHVMEVESFEDE VAKLLN+ FVSIKVDREER
Sbjct:   103 PWGEEAFEEARKRDVPIFLSIGYSTCHWCHVMEVESFEDEEVAKLLNNSFVSIKVDREER 162

Query:   185 PDVDKVYMTYVQALYGGGGWPLSVFLSPDLKPLMGGTYFPPEDKYGRPGFKTILRKVKDA 244
             PDVDKVYM++VQALYGGGGWPLSVFLSPDLKPLMGGTYFPP D YGRPGFKT+L+KVKDA
Sbjct:   163 PDVDKVYMSFVQALYGGGGWPLSVFLSPDLKPLMGGTYFPPNDNYGRPGFKTLLKKVKDA 222

Query:   245 WDKKRDMLAQSGAFAIEQXXXXXXXXXXXNKLPDELPQNALRLCAEQLSKSYDSRFGGFG 304
             W+ KRD L +SG +AIE+           +KL D + + A+  CA+QLS+SYDS FGGFG
Sbjct:   223 WNSKRDTLVKSGTYAIEELSKALSASTGADKLSDGISREAVSTCAKQLSRSYDSEFGGFG 282

Query:   305 SAPKFPRPVEIQMMLYHSKKLEDTGKSGEASEGQKMVLFTLQCMAKGGIHDHVGGGFHRY 364
             SAPKFPRPVEIQ+MLYH KKL+++GK+ EA E + MVLF+LQ MA GG+HDH+GGGFHRY
Sbjct:   283 SAPKFPRPVEIQLMLYHYKKLKESGKTSEADEEKSMVLFSLQGMANGGMHDHIGGGFHRY 342

Query:   365 SVDERWHVPHFEKMLYDQGQLANVYLDAFSLTKDVFYSYICRDILDYLRRDMIGPGGEIF 424
             SVDE WHVPHFEKMLYDQGQLANVYLD FS+TKDV YSY+ RDILDYLRRDMI P G IF
Sbjct:   343 SVDECWHVPHFEKMLYDQGQLANVYLDGFSITKDVMYSYVARDILDYLRRDMIAPEGGIF 402

Query:   425 SAEDADSAETEGATRKKEGAFYVWTSKEVEDILGEHAILFKEHYYLKPTGNCDLSRMSDP 484
             SAEDADS E EGA RKKEGAFY+WTS E++++LGE+A LFKEHYY+K +GNCDLS  SDP
Sbjct:   403 SAEDADSFEFEGAKRKKEGAFYIWTSDEIDEVLGENADLFKEHYYVKKSGNCDLSSRSDP 462

Query:   485 HNEFKGKNVLIELNDSSASASKLGMPLEKYLNILGECRRKLFDVRSKRPRPHLDDKVIVS 544
             HNEF GKNVLIE N++SA ASK  + +EKY  ILGECRRKLFDVR KRP+PHLDDK+IVS
Sbjct:   463 HNEFAGKNVLIERNETSAMASKFSLSVEKYQEILGECRRKLFDVRLKRPKPHLDDKIIVS 522

Query:   545 WNGLVISSFARASKILKSEAESAMFNFPVVGSDRKEYMEVAESAASFIRRHLYDEQTHRL 604
             WNGLVISSFARASKILK+E ES  + FPVV S  ++Y+EVAE AA FIR +LYDEQ+ RL
Sbjct:   523 WNGLVISSFARASKILKAEPESTKYYFPVVNSQPEDYIEVAEKAALFIRGNLYDEQSRRL 582

Query:   605 QHSFRNGPSKAPGFLDDYAFLISGLLDLYEFGSGTKWLVWAIELQNTQDELFLDREGGGY 664
             QHS+R GPSKAP FLDDYAFLISGLLDLYE G G +WL WAI+LQ TQDEL+LDREGG Y
Sbjct:   583 QHSYRQGPSKAPAFLDDYAFLISGLLDLYENGGGIEWLKWAIKLQETQDELYLDREGGAY 642

Query:   665 FNTTGEDPSVLLRVKEDHDGAEPSGNSVSVINLVRLASIVAGSKSDYYRQNAEHSL 720
             FNT G+DPSVLLRVKEDHDGAEPSGNSVS INLVRLASIVAG K++ Y  N  H L
Sbjct:   643 FNTEGQDPSVLLRVKEDHDGAEPSGNSVSAINLVRLASIVAGEKAESYL-NTAHRL 697




GO:0003824 "catalytic activity" evidence=IEA
GO:0005576 "extracellular region" evidence=ISM
GO:0009507 "chloroplast" evidence=IDA
ZFIN|ZDB-GENE-030131-7269 spata20 "spermatogenesis associated 20" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NIQ1 SPATA20 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|A4FV36 SPATA20 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q8TB22 SPATA20 "Spermatogenesis-associated protein 20" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2QU41 SPATA20 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1PTK3 MYCBPAP "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F6UYN9 MYCBPAP "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RT97 LOC100738512 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|I3LGI2 LOC100738512 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q09214YP65_CAEELNo assigned EC number0.41340.81790.8134yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query725
COG1331667 COG1331, COG1331, Highly conserved protein contain 0.0
pfam03190163 pfam03190, DUF255, Protein of unknown function, DU 1e-108
cd02955124 cd02955, SSP411, TRX domain, SSP411 protein family 8e-83
pfam1389981 pfam13899, Thioredoxin_7, Thioredoxin-like 3e-09
cd02953104 cd02953, DsbDgamma, DsbD gamma family; DsbD gamma 7e-06
pfam13098105 pfam13098, Thioredoxin_2, Thioredoxin-like domain 2e-05
>gnl|CDD|224250 COG1331, COG1331, Highly conserved protein containing a thioredoxin domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
 Score =  659 bits (1701), Expect = 0.0
 Identities = 275/619 (44%), Positives = 361/619 (58%), Gaps = 61/619 (9%)

Query: 102 TNRLAAEHSPYLLQHAHNPVDWFAWGEEAFAEARKRDVPIFLSIGYSTCHWCHVMEVESF 161
            NRL  E SPYLLQHAHNPVDW+ WGEEAFA+A++ D PI LSIGYSTCHWCHVM  ESF
Sbjct: 7   PNRLINEKSPYLLQHAHNPVDWYPWGEEAFAKAKEEDKPILLSIGYSTCHWCHVMAHESF 66

Query: 162 EDEGVAKLLNDWFVSIKVDREERPDVDKVYMTYVQALYGGGGWPLSVFLSPDLKPLMGGT 221
           ED  +A +LN+ FV +KVDREERPDVD +YM   QA+ G GGWPL+VFL+PD KP   GT
Sbjct: 67  EDPEIAAILNENFVPVKVDREERPDVDSLYMNASQAITGQGGWPLTVFLTPDGKPFFAGT 126

Query: 222 YFPPEDKYGRPGFKTILRKVKDAWDKKRDMLAQSGAFAIEQLSEALSASASSNKLPDELP 281
           YFP ED+YGRPGFK +L  +++ W + R+ L QS     E++ EAL   A  +   +EL 
Sbjct: 127 YFPKEDRYGRPGFKQLLEAIRETWREDREELLQSA----ERVLEALEGLARPSA-GEELD 181

Query: 282 QNALRLCAEQLSKSYDSRFGGFGSAPKFPRPVEIQMMLYHSKKLEDTGKSGEASEGQKMV 341
           +  L   AE L++S+D  +GGFGSAPKFP P  +  +L +S +  D            MV
Sbjct: 182 EEVLDRAAEALARSFDREYGGFGSAPKFPPPHLLLFLLRYSLRTGD-------ERALDMV 234

Query: 342 LFTLQCMAKGGIHDHVGGGFHRYSVDERWHVPHFEKMLYDQGQLANVYLDAFSLTKDVFY 401
           L TL  MA+GGI+DH+GGGF RYS D  W VPHFEKMLYD   L   Y +A+  T D  Y
Sbjct: 235 LRTLDAMARGGIYDHLGGGFFRYSTDREWLVPHFEKMLYDNALLLRAYAEAYRATGDDLY 294

Query: 402 SYICRDILDYLRRDMIGPGGEIFSAEDADSAETEGATRKKEGAFYVWTSKEVEDILGEHA 461
                 ILDYL R++  P G  +S+ DADS + E      EG +Y W+ +E++++LGE A
Sbjct: 295 RRAAEGILDYLLRELYSPEGGFYSSLDADS-DGE------EGKYYTWSVEELKEVLGEDA 347

Query: 462 ILFKEHYYLKPTGNCDLSRMSDPHNEFKGKNVLIELNDSSASASKLGMPLEKYLNILGEC 521
            L  +++ +   GN            F+G+NVL        +  +    LE         
Sbjct: 348 ELACKYFDVSEEGN------------FEGRNVLHVPGPLEEAIEEAEEKLE-------RA 388

Query: 522 RRKLFDVRSKRPRPHLDDKVIVSWNGLVISSFARASKILKSEAESAMFNFPVVGSDRKEY 581
           R KL   R KR +P  DDKV+  WNGL+I++ A A ++L                   EY
Sbjct: 389 REKLLAAREKRKQPSRDDKVLTDWNGLMIAALAEAGRVL----------------GDPEY 432

Query: 582 MEVAESAASFIRRHLYDEQTHRLQHSFRNGPSKAPGFLDDYAFLISGLLDLYEFGSGTKW 641
           +E AE AA FI  +LY     RL   +R G +   G L+DYAFLI GLL LYE      +
Sbjct: 433 LEAAERAADFILDNLYV---DRLLRRYRGGEAAVAGLLEDYAFLILGLLALYEATGDLAY 489

Query: 642 LVWAIELQNTQDELFLDREGGGYFNTTGEDPSVLLRVKEDHDGAEPSGNSVSVINLVRLA 701
           L  AIEL +     F D + GG+++T  +   +L+R KE  DGA PSGN+V+   L+RL+
Sbjct: 490 LEKAIELADEAIADFWD-DEGGFYDTPSDSEDLLIRPKEPTDGATPSGNAVAAQALLRLS 548

Query: 702 SIVAGSKSDYYRQNAEHSL 720
            +   ++   Y + AE  L
Sbjct: 549 LLTGDAR---YLEAAEDIL 564


Length = 667

>gnl|CDD|202571 pfam03190, DUF255, Protein of unknown function, DUF255 Back     alignment and domain information
>gnl|CDD|239253 cd02955, SSP411, TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif Back     alignment and domain information
>gnl|CDD|222442 pfam13899, Thioredoxin_7, Thioredoxin-like Back     alignment and domain information
>gnl|CDD|239251 cd02953, DsbDgamma, DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD Back     alignment and domain information
>gnl|CDD|221921 pfam13098, Thioredoxin_2, Thioredoxin-like domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 725
KOG2244 786 consensus Highly conserved protein containing a th 100.0
COG1331667 Highly conserved protein containing a thioredoxin 100.0
PF03190163 Thioredox_DsbH: Protein of unknown function, DUF25 100.0
cd02955124 SSP411 TRX domain, SSP411 protein family; members 99.97
cd00249384 AGE AGE domain; N-acyl-D-glucosamine 2-epimerase d 99.93
cd00249384 AGE AGE domain; N-acyl-D-glucosamine 2-epimerase d 99.9
cd02960130 AGR Anterior Gradient (AGR) family; members of thi 99.83
PF07221346 GlcNAc_2-epim: N-acylglucosamine 2-epimerase (GlcN 99.81
PF1389982 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_ 99.79
cd02958114 UAS UAS family; UAS is a domain of unknown functio 99.74
COG2942388 N-acyl-D-glucosamine 2-epimerase [Carbohydrate tra 99.74
cd02959117 ERp19 Endoplasmic reticulum protein 19 (ERp19) fam 99.73
cd02951125 SoxW SoxW family; SoxW is a bacterial periplasmic 99.65
smart00594122 UAS UAS domain. 99.58
cd02953104 DsbDgamma DsbD gamma family; DsbD gamma is the C-t 99.57
PF03663370 Glyco_hydro_76: Glycosyl hydrolase family 76 ; Int 99.52
PRK00293571 dipZ thiol:disulfide interchange protein precursor 99.48
COG1331667 Highly conserved protein containing a thioredoxin 99.48
PF07221 346 GlcNAc_2-epim: N-acylglucosamine 2-epimerase (GlcN 99.42
COG4232569 Thiol:disulfide interchange protein [Posttranslati 99.4
PF13098112 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_ 99.37
cd02991116 UAS_ETEA UAS family, ETEA subfamily; composed of p 99.25
COG2143182 Thioredoxin-related protein [Posttranslational mod 99.24
PF03663 370 Glyco_hydro_76: Glycosyl hydrolase family 76 ; Int 99.15
cd02950142 TxlA TRX-like protein A (TxlA) family; TxlA was or 99.15
KOG2244786 consensus Highly conserved protein containing a th 99.08
cd02954114 DIM1 Dim1 family; Dim1 is also referred to as U5 s 99.03
KOG0910150 consensus Thioredoxin-like protein [Posttranslatio 98.98
cd0294997 TRX_NTR TRX domain, novel NADPH thioredoxin reduct 98.98
PRK10996139 thioredoxin 2; Provisional 98.97
cd0295696 ybbN ybbN protein family; ybbN is a hypothetical p 98.94
PLN00410142 U5 snRNP protein, DIM1 family; Provisional 98.93
cd02948102 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fus 98.88
cd04791321 LanC_SerThrkinase Lanthionine synthetase C-like do 98.87
cd0298497 TRX_PICOT TRX domain, PICOT (for PKC-interacting c 98.84
cd02986114 DLP Dim1 family, Dim1-like protein (DLP) subfamily 98.82
cd02985103 TRX_CDSP32 TRX family, chloroplastic drought-induc 98.81
cd03000104 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed o 98.81
TIGR01126102 pdi_dom protein disulfide-isomerase domain. This m 98.81
PF07470336 Glyco_hydro_88: Glycosyl Hydrolase Family 88; Inte 98.8
cd02993109 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfat 98.76
PHA02278103 thioredoxin-like protein 98.76
cd03003101 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam 98.76
cd02997104 PDI_a_PDIR PDIa family, PDIR subfamily; composed o 98.73
cd02963111 TRX_DnaJ TRX domain, DnaJ domain containing protei 98.72
KOG0907106 consensus Thioredoxin [Posttranslational modificat 98.7
cd02996108 PDI_a_ERp44 PDIa family, endoplasmic reticulum pro 98.7
TIGR01068101 thioredoxin thioredoxin. Several proteins, such as 98.69
cd02961101 PDI_a_family Protein Disulfide Isomerase (PDIa) fa 98.68
cd03004104 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam 98.67
cd02962152 TMX2 TMX2 family; composed of proteins similar to 98.65
PTZ0005198 thioredoxin; Provisional 98.64
cd03006113 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamil 98.61
cd02999100 PDI_a_ERp44_like PDIa family, endoplasmic reticulu 98.6
cd0294793 TRX_family TRX family; composed of two groups: Gro 98.58
PRK09381109 trxA thioredoxin; Provisional 98.56
TIGR00385173 dsbE periplasmic protein thiol:disulfide oxidoredu 98.55
cd03002109 PDI_a_MPD1_like PDI family, MPD1-like subfamily; c 98.55
COG2942 388 N-acyl-D-glucosamine 2-epimerase [Carbohydrate tra 98.54
PRK15412185 thiol:disulfide interchange protein DsbE; Provisio 98.53
cd02989113 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior 98.53
PF00085103 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio 98.53
cd02995104 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain 98.52
cd02975113 PfPDO_like_N Pyrococcus furiosus protein disulfide 98.5
cd03005102 PDI_a_ERp46 PDIa family, endoplasmic reticulum pro 98.5
cd02998105 PDI_a_ERp38 PDIa family, endoplasmic reticulum pro 98.47
cd03065120 PDI_b_Calsequestrin_N PDIb family, Calsequestrin s 98.47
cd02952119 TRP14_like Human TRX-related protein 14 (TRP14)-li 98.46
cd03008146 TryX_like_RdCVF Tryparedoxin (TryX)-like family, R 98.46
COG3118304 Thioredoxin domain-containing protein [Posttransla 98.45
cd03009131 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family 98.45
TIGR01295122 PedC_BrcD bacteriocin transport accessory protein, 98.45
PTZ00443224 Thioredoxin domain-containing protein; Provisional 98.43
cd03001103 PDI_a_P5 PDIa family, P5 subfamily; composed of eu 98.42
cd02994101 PDI_a_TMX PDIa family, TMX subfamily; composed of 98.42
cd04791321 LanC_SerThrkinase Lanthionine synthetase C-like do 98.37
cd02992114 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidas 98.31
cd03010127 TlpA_like_DsbE TlpA-like family, DsbE (also known 98.3
PRK14018521 trifunctional thioredoxin/methionine sulfoxide red 98.29
PF07944 520 DUF1680: Putative glycosyl hydrolase of unknown fu 98.28
cd02957113 Phd_like Phosducin (Phd)-like family; composed of 98.27
cd02964132 TryX_like_family Tryparedoxin (TryX)-like family; 98.27
PF1390595 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_ 98.25
cd02965111 HyaE HyaE family; HyaE is also called HupG and Hox 98.22
COG4225357 Predicted unsaturated glucuronyl hydrolase involve 98.21
cd02967114 mauD Methylamine utilization (mau) D family; mauD 98.2
cd02966116 TlpA_like_family TlpA-like family; composed of Tlp 98.19
PTZ00102477 disulphide isomerase; Provisional 98.17
PHA0212575 thioredoxin-like protein 98.15
cd03011123 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppresso 98.14
PTZ00102477 disulphide isomerase; Provisional 98.14
TIGR01130462 ER_PDI_fam protein disulfide isomerases, eukaryoti 98.13
TIGR02738153 TrbB type-F conjugative transfer system pilin asse 98.12
cd02987175 Phd_like_Phd Phosducin (Phd)-like family, Phd subf 98.1
TIGR0041182 redox_disulf_1 small redox-active disulfide protei 98.08
KOG0908288 consensus Thioredoxin-like protein [Posttranslatio 98.06
TIGR02740271 TraF-like TraF-like protein. This protein is relat 98.01
PRK03147173 thiol-disulfide oxidoreductase; Provisional 98.0
PF07470336 Glyco_hydro_88: Glycosyl Hydrolase Family 88; Inte 97.99
cd02982103 PDI_b'_family Protein Disulfide Isomerase (PDIb') 97.96
TIGR00424463 APS_reduc 5'-adenylylsulfate reductase, thioredoxi 97.96
PLN02309457 5'-adenylylsulfate reductase 97.95
TIGR01626184 ytfJ_HI0045 conserved hypothetical protein YtfJ-fa 97.87
TIGR0041276 redox_disulf_2 small redox-active disulfide protei 97.83
PLN029191057 haloacid dehalogenase-like hydrolase family protei 97.82
cd03012126 TlpA_like_DipZ_like TlpA-like family, DipZ-like su 97.8
TIGR02661189 MauD methylamine dehydrogenase accessory protein M 97.79
TIGR02187215 GlrX_arch Glutaredoxin-like domain protein. This f 97.78
cd0297367 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- 97.76
cd0302689 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid 97.68
TIGR02187215 GlrX_arch Glutaredoxin-like domain protein. This f 97.65
PF06662189 C5-epim_C: D-glucuronyl C5-epimerase C-terminus; I 97.62
TIGR01130462 ER_PDI_fam protein disulfide isomerases, eukaryoti 97.58
cd04434343 LanC_like LanC-like proteins. LanC is the cyclase 97.55
cd04792825 LanM-like LanM-like proteins. LanM is a bifunction 97.55
PF08534146 Redoxin: Redoxin; InterPro: IPR013740 This redoxin 97.48
PRK13728181 conjugal transfer protein TrbB; Provisional 97.46
KOG2501157 consensus Thioredoxin, nucleoredoxin and related p 97.45
PF07944 520 DUF1680: Putative glycosyl hydrolase of unknown fu 97.41
PTZ00062204 glutaredoxin; Provisional 97.41
cd03007116 PDI_a_ERp29_N PDIa family, endoplasmic reticulum p 97.38
PF06662189 C5-epim_C: D-glucuronyl C5-epimerase C-terminus; I 97.37
PF06917557 Pectate_lyase_2: Periplasmic pectate lyase; InterP 97.3
cd02969171 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypot 97.29
PLN02399236 phospholipid hydroperoxide glutathione peroxidase 97.26
cd02988192 Phd_like_VIAF Phosducin (Phd)-like family, Viral i 97.21
COG3533 589 Uncharacterized protein conserved in bacteria [Fun 97.18
cd04793382 LanC LanC is the cyclase enzyme of the lanthionine 97.14
cd0165969 TRX_superfamily Thioredoxin (TRX) superfamily; a l 97.14
cd02990136 UAS_FAF1 UAS family, FAS-associated factor 1 (FAF1 97.11
PTZ00056199 glutathione peroxidase; Provisional 97.11
COG4225 357 Predicted unsaturated glucuronyl hydrolase involve 96.99
cd03017140 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferrit 96.95
KOG0190493 consensus Protein disulfide isomerase (prolyl 4-hy 96.84
PRK09437154 bcp thioredoxin-dependent thiol peroxidase; Review 96.82
KOG0190493 consensus Protein disulfide isomerase (prolyl 4-hy 96.79
TIGR0218084 GRX_euk Glutaredoxin. This model represents eukary 96.78
PF14595129 Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A. 96.77
KOG0191383 consensus Thioredoxin/protein disulfide isomerase 96.74
PLN02412167 probable glutathione peroxidase 96.71
PF00759 444 Glyco_hydro_9: Glycosyl hydrolase family 9; InterP 96.66
COG3533 589 Uncharacterized protein conserved in bacteria [Fun 96.64
TIGR02540153 gpx7 putative glutathione peroxidase Gpx7. This mo 96.53
KOG4277468 consensus Uncharacterized conserved protein, conta 96.51
COG4403963 LcnDR2 Lantibiotic modifying enzyme [Defense mecha 96.49
cd00340152 GSH_Peroxidase Glutathione (GSH) peroxidase family 96.45
cd02889348 SQCY Squalene cyclase (SQCY) domain; found in clas 96.44
PF00578124 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Per 96.44
TIGR03137187 AhpC peroxiredoxin. This gene contains two invaria 96.39
PTZ00470522 glycoside hydrolase family 47 protein; Provisional 96.35
cd02968142 SCO SCO (an acronym for Synthesis of Cytochrome c 96.31
cd04434343 LanC_like LanC-like proteins. LanC is the cyclase 96.24
cd03014143 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 96.22
cd04792825 LanM-like LanM-like proteins. LanM is a bifunction 96.22
PRK00522167 tpx lipid hydroperoxide peroxidase; Provisional 96.2
TIGR0219674 GlrX_YruB Glutaredoxin-like protein, YruB-family. 96.18
KOG2787403 consensus Lanthionine synthetase C-like protein 1 96.17
PRK10382187 alkyl hydroperoxide reductase subunit C; Provision 96.14
cd03015173 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2- 96.12
PTZ00256183 glutathione peroxidase; Provisional 96.1
PF01532452 Glyco_hydro_47: Glycosyl hydrolase family 47; Inte 96.1
PLN03009495 cellulase 96.05
PLN02266 510 endoglucanase 95.99
COG0526127 TrxA Thiol-disulfide isomerase and thioredoxins [P 95.98
PLN02613 498 endoglucanase 95.89
PLN02171 629 endoglucanase 95.87
TIGR0220077 GlrX_actino Glutaredoxin-like protein. This family 95.86
cd0341982 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h 95.83
PLN00119 489 endoglucanase 95.81
PF05147355 LANC_like: Lanthionine synthetase C-like protein; 95.73
cd0297673 NrdH NrdH-redoxin (NrdH) family; NrdH is a small m 95.73
PLN02909 486 Endoglucanase 95.7
PTZ00470 522 glycoside hydrolase family 47 protein; Provisional 95.67
PLN02340 614 endoglucanase 95.65
KOG2507506 consensus Ubiquitin regulatory protein UBXD2, cont 95.63
PF06110119 DUF953: Eukaryotic protein of unknown function (DU 95.52
PF01532 452 Glyco_hydro_47: Glycosyl hydrolase family 47; Inte 95.46
TIGR01577616 oligosac_amyl oligosaccharide amylase. The name of 95.45
PRK11509132 hydrogenase-1 operon protein HyaE; Provisional 95.43
cd04794343 euk_LANCL eukaryotic Lanthionine synthetase C-like 95.42
PLN02420 525 endoglucanase 95.42
PLN02345 469 endoglucanase 95.42
PRK15000200 peroxidase; Provisional 95.33
PLN02308 492 endoglucanase 95.32
cd02971140 PRX_family Peroxiredoxin (PRX) family; composed of 95.27
KOG0191383 consensus Thioredoxin/protein disulfide isomerase 95.22
cd04794343 euk_LANCL eukaryotic Lanthionine synthetase C-like 95.16
cd03018149 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-lik 95.16
PRK11657251 dsbG disulfide isomerase/thiol-disulfide oxidase; 94.95
PRK13190202 putative peroxiredoxin; Provisional 94.94
cd02892634 SQCY_1 Squalene cyclase (SQCY) domain subgroup 1; 94.74
cd04793382 LanC LanC is the cyclase enzyme of the lanthionine 94.68
COG4833377 Predicted glycosyl hydrolase [Carbohydrate transpo 94.63
KOG1752104 consensus Glutaredoxin and related proteins [Postt 94.59
PF0046260 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl 94.21
cd0206672 GRX_family Glutaredoxin (GRX) family; composed of 94.17
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 94.08
PRK10877232 protein disulfide isomerase II DsbC; Provisional 94.0
TIGR0218999 GlrX-like_plant Glutaredoxin-like family. This fam 93.99
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 93.9
PRK1120085 grxA glutaredoxin 1; Provisional 93.87
cd02970149 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypot 93.8
PTZ00137261 2-Cys peroxiredoxin; Provisional 93.71
PF13728215 TraF: F plasmid transfer operon protein 93.68
PRK13599215 putative peroxiredoxin; Provisional 93.63
cd02892634 SQCY_1 Squalene cyclase (SQCY) domain subgroup 1; 93.45
TIGR0036597 monothiol glutaredoxin, Grx4 family. The gene for 93.35
TIGR0218386 GRXA Glutaredoxin, GrxA family. This model include 93.25
PHA03050108 glutaredoxin; Provisional 93.23
PTZ00253199 tryparedoxin peroxidase; Provisional 93.2
cd0302773 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg 93.19
PRK10606183 btuE putative glutathione peroxidase; Provisional 92.76
TIGR0219079 GlrX-dom Glutaredoxin-family domain. This C-termin 92.67
PF06917557 Pectate_lyase_2: Periplasmic pectate lyase; InterP 92.65
cd0302890 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte 92.53
PF06202370 GDE_C: Amylo-alpha-1,6-glucosidase ; InterPro: IPR 92.53
TIGR0219472 GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red 92.42
KOG3414142 consensus Component of the U4/U6.U5 snRNP/mitosis 92.23
PF02966133 DIM1: Mitosis protein DIM1; InterPro: IPR004123 Th 92.18
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 92.07
TIGR02739256 TraF type-F conjugative transfer system pilin asse 91.89
PRK1063883 glutaredoxin 3; Provisional 91.69
PRK13191215 putative peroxiredoxin; Provisional 91.53
PLN02175 484 endoglucanase 91.31
cd0341875 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b 91.24
cd03016203 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX sub 91.15
TIGR01577 616 oligosac_amyl oligosaccharide amylase. The name of 91.12
PF1319276 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZY 90.7
PRK13703248 conjugal pilus assembly protein TraF; Provisional 90.68
TIGR0218179 GRX_bact Glutaredoxin, GrxC family. This family of 90.66
PRK1032981 glutaredoxin-like protein; Provisional 90.53
PF00759444 Glyco_hydro_9: Glycosyl hydrolase family 9; InterP 90.34
KOG3425128 consensus Uncharacterized conserved protein [Funct 90.16
KOG0911227 consensus Glutaredoxin-related protein [Posttransl 89.6
KOG2431546 consensus 1, 2-alpha-mannosidase [Carbohydrate tra 89.45
TIGR03463634 osq_cycl 2,3-oxidosqualene cyclase. This model ide 88.95
KOG0912375 consensus Thiol-disulfide isomerase and thioredoxi 88.93
TIGR01507635 hopene_cyclase squalene-hopene cyclase. SHC is an 88.86
cd02896297 complement_C3_C4_C5 Proteins similar to C3, C4 and 88.49
COG069580 GrxC Glutaredoxin and related proteins [Posttransl 88.47
KOG2204 625 consensus Mannosyl-oligosaccharide alpha-1,2-manno 88.32
cd03020197 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamil 88.24
PRK13189222 peroxiredoxin; Provisional 87.79
KOG2204625 consensus Mannosyl-oligosaccharide alpha-1,2-manno 87.76
COG4403 963 LcnDR2 Lantibiotic modifying enzyme [Defense mecha 87.58
PF05592 509 Bac_rhamnosid: Bacterial alpha-L-rhamnosidase; Int 86.3
PRK12759410 bifunctional gluaredoxin/ribonucleoside-diphosphat 86.06
cd0302972 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb 85.98
TIGR02474290 pec_lyase pectate lyase, PelA/Pel-15E family. Memb 84.82
PRK11097 376 endo-1,4-D-glucanase; Provisional 84.81
TIGR01507635 hopene_cyclase squalene-hopene cyclase. SHC is an 84.75
cd02889 348 SQCY Squalene cyclase (SQCY) domain; found in clas 83.94
KOG2431 546 consensus 1, 2-alpha-mannosidase [Carbohydrate tra 83.66
TIGR01787621 squalene_cyclas squalene/oxidosqualene cyclases. T 83.65
TIGR02474290 pec_lyase pectate lyase, PelA/Pel-15E family. Memb 83.27
PLN02993763 lupeol synthase 82.55
PF05147355 LANC_like: Lanthionine synthetase C-like protein; 82.33
PTZ00062204 glutaredoxin; Provisional 82.21
TIGR01561575 gde_arch glycogen debranching enzyme, archaeal typ 82.02
TIGR01535 648 glucan_glucosid glucan 1,4-alpha-glucosidase. Gluc 81.13
KOG1731606 consensus FAD-dependent sulfhydryl oxidase/quiesci 80.63
>KOG2244 consensus Highly conserved protein containing a thioredoxin domain [General function prediction only] Back     alignment and domain information
Probab=100.00  E-value=3.6e-155  Score=1247.85  Aligned_cols=609  Identities=60%  Similarity=1.020  Sum_probs=568.1

Q ss_pred             cccCccchhhcccCCCCCC----CCCCcccccccccCCChhhhcccCCCCccccchHHHHHHHhhcCCcEEEEEeccCCh
Q 004888           76 RPIHPYKVVAMAERTPAST----SHSRNKHTNRLAAEHSPYLLQHAHNPVDWFAWGEEAFAEARKRDVPIFLSIGYSTCH  151 (725)
Q Consensus        76 ~~~~~~~~~~~~~~~~~~~----~~~~~~~~NrL~~e~spyl~~ha~~~V~W~~~~~eAl~~Ak~e~KpI~l~~g~~wC~  151 (725)
                      |++..++++.|+.++..+.    |.+. +..|||+.++|||++|||.|||+|++|++||+++|++|||||||++|+++||
T Consensus        47 Rs~~~~s~~pm~~gg~~sh~sS~~~~v-~~~nRli~skspyllqhaynpvdwypwgqeaf~kar~enkpifLsvgystch  125 (786)
T KOG2244|consen   47 RSIASLSTLPMRRGGVRSHNSSFSSPV-PPLNRLISSKSPYLLQHAYNPVDWYPWGQEAFNKARAENKPIFLSVGYSTCH  125 (786)
T ss_pred             cccccccccccccCceecCCCCccCCC-CccccccccCCcchhhhccCCcccCcchHHHHHHHHhcCCCEEEEcccccch
Confidence            4566688888998885554    2222 3469999999999999999999999999999999999999999999999999


Q ss_pred             hhHhhhhhccCCHHHHHHHhcCcEEEEEcCCCCcchHHHHHHHHHHhcCCCCcCcEEEecCCCCccccccccCCCCCCCc
Q 004888          152 WCHVMEVESFEDEGVAKLLNDWFVSIKVDREERPDVDKVYMTYVQALYGGGGWPLSVFLSPDLKPLMGGTYFPPEDKYGR  231 (725)
Q Consensus       152 ~C~~Me~e~f~d~eVa~~ln~~FV~VkvD~ee~pd~~~~y~~~~q~~~g~~G~P~~vfl~pdG~~i~~~tY~p~~~~~~~  231 (725)
                      |||+||+|+|+|++++++||++||.||||||||||+|+.||.++++..|.||||+.||||||.+|+.+||||||++.+|+
T Consensus       126 wchvmekesfeneet~~ilnenfv~ikVDREERPDVDK~YM~Fv~assg~GGWPmsV~LTPdL~PlvgGTYFPP~d~~g~  205 (786)
T KOG2244|consen  126 WCHVMEKESFENEETGEILNENFVKIKVDREERPDVDKLYMAFVVASSGGGGWPMSVFLTPDLKPLVGGTYFPPNDNYGR  205 (786)
T ss_pred             heeeeecccccCHHHHHHHhhhhhhhccChhhcCchHHHHHHHHHhccCCCCCceeEEeCCCcccccCCcccCCCCCCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             chHHHHHHHHHHHHhhchHHHHHhHHHHHHHHHHHhhcccCCCCCCCCCCHHHHHHHHHHHHhhccccCCCCCCCCCCCC
Q 004888          232 PGFKTILRKVKDAWDKKRDMLAQSGAFAIEQLSEALSASASSNKLPDELPQNALRLCAEQLSKSYDSRFGGFGSAPKFPR  311 (725)
Q Consensus       232 ~~F~~~L~~i~~~~~~~~~~l~~~a~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~D~~~GGfg~apKFP~  311 (725)
                      ++|.++|++|+++|+++|+.+++.+..+++.|++++.+.++.           =..+++++...++.++||||.+||||.
T Consensus       206 ~gF~TvL~~I~~~w~~kr~tllet~~~~is~ls~al~peaa~-----------g~~~~ekl~e~i~~~~qGfg~apKFP~  274 (786)
T KOG2244|consen  206 PGFKTVLKKIKDAWNSKRDTLLETGTYAISELSKALSPEAAT-----------GDNRAEKLSEGISREAQGFGEAPKFPK  274 (786)
T ss_pred             ccHHHHHHHHHHHHHhhhhHHHhhhHHHHHHHHhhcCccccc-----------cchhHHHHHHHHHHHhhhhccCCCCCC
Confidence            999999999999999999999999998988888665432111           125678899999999999999999999


Q ss_pred             hhHHHHHHHhhhhccccCCCCCcHHHHHHHHHHHHHHHhCCCcccCCCeEEEEecCCCCCCCCCchhHHHHHHHHHHHHH
Q 004888          312 PVEIQMMLYHSKKLEDTGKSGEASEGQKMVLFTLQCMAKGGIHDHVGGGFHRYSVDERWHVPHFEKMLYDQGQLANVYLD  391 (725)
Q Consensus       312 ~~~l~~ll~~~~~~~~~~~~~~~~~~~~~~~~TL~~ma~gGi~D~v~GGF~RYs~D~~W~vPHFEKMLyDNA~Ll~~ya~  391 (725)
                      +..|.||+.+...       +++++.+.|+.+||+.|+.|||||||||||||||||++|++||||||||||+||+.+|++
T Consensus       275 ~~~L~FLf~~~lt-------~k~~d~~~Mvl~TL~~manGGihDHIg~GFhRYsv~~~WHvpHFEKMLYDQ~QL~~aysd  347 (786)
T KOG2244|consen  275 ACDLDFLFTFNLT-------SKADDEKSMVLFTLQGMANGGIHDHIGGGFHRYSVDECWHVPHFEKMLYDQGQLANAYSD  347 (786)
T ss_pred             ccccceeeeeccc-------ccCcHHHHHHHHHHHHHhcCCccccccCceeeccccccccchhHHHHHhhHHHHHHHHHh
Confidence            9999999987542       346799999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHccCChHHHHHHHHHHHHHHHhccCCCCceeeeccCCCccccccccccCcceEEechHHHHHHhhhh-------HHHH
Q 004888          392 AFSLTKDVFYSYICRDILDYLRRDMIGPGGEIFSAEDADSAETEGATRKKEGAFYVWTSKEVEDILGEH-------AILF  464 (725)
Q Consensus       392 Ay~~t~d~~y~~vA~~~~~fl~~~m~~~~Ggfysa~DADs~~~~~~~~~~EGayY~wt~~Ei~~~lg~~-------~~l~  464 (725)
                      ||++|+|+.|..+|++|++||.++|.+|+||||+++||||.|.+++|.++|||||+||.+||+++|||.       ++++
T Consensus       348 afklT~de~y~~va~~I~qYl~rdlsh~~GGfysaEDADSlp~h~~k~k~EGAfyaWt~dEIqqll~e~~i~p~~~fdl~  427 (786)
T KOG2244|consen  348 AFKLTKDEMYSYVARDILQYLRRDLSHPEGGFYSAEDADSLPFHGAKRKKEGAFYAWTSDEIQQLLGENAIGPASLFDLF  427 (786)
T ss_pred             hhhcchhHHHHHHHHHHHHHHHHhccCCCCCcccccccCCCcccccccccccceEEeeHHHHHHHhCCCCCCcchHHHHH
Confidence            999999999999999999999999999999999999999999999999999999999999999999975       4999


Q ss_pred             HHHhcccCCCCcCCCCCCCCCCCCCCcceeeccCCchHHHHhcCCCHHHHHHHHHHHHHHHHhhhccCCCCCCCcchhhh
Q 004888          465 KEHYYLKPTGNCDLSRMSDPHNEFKGKNVLIELNDSSASASKLGMPLEKYLNILGECRRKLFDVRSKRPRPHLDDKVIVS  544 (725)
Q Consensus       465 ~~~y~l~~~Gn~e~~~~~dp~~~f~g~nvL~~~~~~~~~a~~~g~~~e~~~~~l~~~r~kL~~~R~~R~~P~lDdKiits  544 (725)
                      +.||||++.||+  ++.+||||++.|||||+++.+.++.|..+++++++++++|.+++++|+++|.+||+|++|+|||++
T Consensus       428 a~hygvk~sGnv--s~ssDPhgel~gkNVL~vr~s~e~taanf~lsve~~kkll~e~~e~L~~aR~kRPkPHLDsKii~s  505 (786)
T KOG2244|consen  428 AEHYGVKKSGNV--SSSSDPHGELAGKNVLIVRNSTEATAANFSLSVEKYKKLLGECREKLFDARLKRPKPHLDSKIIVS  505 (786)
T ss_pred             HHHcCCCCCCCC--CCCCCCcccccCceEEEEecchHhhHhhccccHHHHHHHHHHHHHHHHHHhhcCCCCCccchheee
Confidence            999999999995  689999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cHHHHHHHHHHHHHHhhhhhhhhcccCCCCCCChHHHHHHHHHHHHHHHHhccccCCCeEEE-EecCCC----------C
Q 004888          545 WNGLVISSFARASKILKSEAESAMFNFPVVGSDRKEYMEVAESAASFIRRHLYDEQTHRLQH-SFRNGP----------S  613 (725)
Q Consensus       545 WNal~I~aLa~A~~vl~d~~~~~~~~~~~~~~~~~~yl~~A~~~a~~l~~~l~d~~~G~l~~-s~~~g~----------~  613 (725)
                      |||+||++|++|+++++.+               ++|++.|..+++|+.++|+|...+.|.+ +.++|.          .
T Consensus       506 WnGLviSgl~kag~~~~a~---------------~~y~~~a~~~a~fl~k~m~d~~eklliR~scY~ga~g~ve~~n~~~  570 (786)
T KOG2244|consen  506 WNGLVISGLAKAGKILKAE---------------PEYTKYAFPVANFLPKDMIDVAEKLLIRGSCYDGASGRVEHSNRPS  570 (786)
T ss_pred             ccchhhHHHHHHHHHhhcC---------------HHHHHHHHHHHhhhhhhhhchhhhheeecccccCCCcceeccCCcc
Confidence            9999999999999999972               6999999999999999999988777777 544432          1


Q ss_pred             CCCCCcchHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHccccCCCcccccCCCCCccccccccCCCCCCCChHHHH
Q 004888          614 KAPGFLDDYAFLISGLLDLYEFGSGTKWLVWAIELQNTQDELFLDREGGGYFNTTGEDPSVLLRVKEDHDGAEPSGNSVS  693 (725)
Q Consensus       614 ~~~~~leDyA~li~aLL~LYe~Tgd~~yL~~A~~L~~~~~~~F~D~~~Ggyf~t~~~~~~~~~r~k~~~D~a~PS~Nsv~  693 (725)
                      ..++|++||||+|.|||+||+++|+.+||+||.+|+++++.+|||  +||||.+..+++.+++|.|+++||++||+|||+
T Consensus       571 ~~~~FldDYAFlI~gLLDlYea~~~~e~LkwA~~LQdtqdklFWd--gggYF~Se~~~~~v~vRlkeDhDGAEPs~nSVs  648 (786)
T KOG2244|consen  571 KAPAFLDDYAFLISGLLDLYEAGGGIEWLKWAIKLQDTQDKLFWD--GGGYFISEKTDEDVSVRLKEDHDGAEPSGNSVS  648 (786)
T ss_pred             ccchhhhhHHHHHHHHHHHHHccCchHHHHHHHHHHHHHHHheec--CCceeeeeccCCCcceeeccccCCCCCCccchh
Confidence            345799999999999999999999999999999999999999999  899999999999999999999999999999999


Q ss_pred             HHHHHHHHHhhCCCCchHHHHHHHHHHHHhhC
Q 004888          694 VINLVRLASIVAGSKSDYYRQNAEHSLYLRQD  725 (725)
Q Consensus       694 a~~LlrL~~~t~~~~~~~y~~~A~~~l~~~~~  725 (725)
                      |+||+||+.+++.   +.|++.|.++|+.|++
T Consensus       649 ahNLvrL~~~~~~---e~yl~ka~~ll~~fse  677 (786)
T KOG2244|consen  649 AHNLVRLASIVAA---ESYLNKAHRLLAVFSE  677 (786)
T ss_pred             hhhHHHHHHHhhH---HHHHHHHHHHHHHHHH
Confidence            9999999999986   7999999999999874



>COG1331 Highly conserved protein containing a thioredoxin domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03190 Thioredox_DsbH: Protein of unknown function, DUF255; InterPro: IPR004879 This is a group of uncharacterised proteins Back     alignment and domain information
>cd02955 SSP411 TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif Back     alignment and domain information
>cd00249 AGE AGE domain; N-acyl-D-glucosamine 2-epimerase domain; Responsible for intermediate epimerization during biosynthesis of N-acetylneuraminic acid Back     alignment and domain information
>cd00249 AGE AGE domain; N-acyl-D-glucosamine 2-epimerase domain; Responsible for intermediate epimerization during biosynthesis of N-acetylneuraminic acid Back     alignment and domain information
>cd02960 AGR Anterior Gradient (AGR) family; members of this family are similar to secreted proteins encoded by the cement gland-specific genes XAG-1 and XAG-2, expressed in the anterior region of dorsal ectoderm of Xenopus Back     alignment and domain information
>PF07221 GlcNAc_2-epim: N-acylglucosamine 2-epimerase (GlcNAc 2-epimerase); InterPro: IPR010819 N-acylglucosamine 2-epimerase (AGE, 5 Back     alignment and domain information
>PF13899 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_A 1UC7_A 2JU5_A 1VRS_D 2FWG_A 2FWF_A 2FWH_A 2FWE_A 3FK8_A Back     alignment and domain information
>cd02958 UAS UAS family; UAS is a domain of unknown function Back     alignment and domain information
>COG2942 N-acyl-D-glucosamine 2-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd02959 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; ERp19 is also known as ERp18, a protein located in the ER containing one redox active TRX domain Back     alignment and domain information
>cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation Back     alignment and domain information
>smart00594 UAS UAS domain Back     alignment and domain information
>cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD Back     alignment and domain information
>PF03663 Glyco_hydro_76: Glycosyl hydrolase family 76 ; InterPro: IPR005198 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PRK00293 dipZ thiol:disulfide interchange protein precursor; Provisional Back     alignment and domain information
>COG1331 Highly conserved protein containing a thioredoxin domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07221 GlcNAc_2-epim: N-acylglucosamine 2-epimerase (GlcNAc 2-epimerase); InterPro: IPR010819 N-acylglucosamine 2-epimerase (AGE, 5 Back     alignment and domain information
>COG4232 Thiol:disulfide interchange protein [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Back     alignment and domain information
>PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A Back     alignment and domain information
>cd02991 UAS_ETEA UAS family, ETEA subfamily; composed of proteins similar to human ETEA protein, the translation product of a highly expressed gene in the T-cells and eosinophils of atopic dermatitis patients compared with those of normal individuals Back     alignment and domain information
>COG2143 Thioredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03663 Glyco_hydro_76: Glycosyl hydrolase family 76 ; InterPro: IPR005198 O-Glycosyl hydrolases 3 Back     alignment and domain information
>cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus Back     alignment and domain information
>KOG2244 consensus Highly conserved protein containing a thioredoxin domain [General function prediction only] Back     alignment and domain information
>cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein Back     alignment and domain information
>KOG0910 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains Back     alignment and domain information
>PRK10996 thioredoxin 2; Provisional Back     alignment and domain information
>cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain Back     alignment and domain information
>PLN00410 U5 snRNP protein, DIM1 family; Provisional Back     alignment and domain information
>cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein Back     alignment and domain information
>cd04791 LanC_SerThrkinase Lanthionine synthetase C-like domain associated with serine threonine kinases Back     alignment and domain information
>cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes Back     alignment and domain information
>cd02986 DLP Dim1 family, Dim1-like protein (DLP) subfamily; DLP is a novel protein which shares 38% sequence identity to Dim1 Back     alignment and domain information
>cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif Back     alignment and domain information
>cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus Back     alignment and domain information
>TIGR01126 pdi_dom protein disulfide-isomerase domain Back     alignment and domain information
>PF07470 Glyco_hydro_88: Glycosyl Hydrolase Family 88; InterPro: IPR010905 Unsaturated glucuronyl hydrolase catalyses the hydrolytic release of unsaturated glucuronic acids from oligosaccharides produced by the reactions of polysaccharide lyases [] Back     alignment and domain information
>cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases Back     alignment and domain information
>PHA02278 thioredoxin-like protein Back     alignment and domain information
>cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain Back     alignment and domain information
>KOG0907 consensus Thioredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>TIGR01068 thioredoxin thioredoxin Back     alignment and domain information
>cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library Back     alignment and domain information
>PTZ00051 thioredoxin; Provisional Back     alignment and domain information
>cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox Back     alignment and domain information
>cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 Back     alignment and domain information
>cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains Back     alignment and domain information
>PRK09381 trxA thioredoxin; Provisional Back     alignment and domain information
>TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily Back     alignment and domain information
>cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein Back     alignment and domain information
>COG2942 N-acyl-D-glucosamine 2-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15412 thiol:disulfide interchange protein DsbE; Provisional Back     alignment and domain information
>cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif Back     alignment and domain information
>PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms Back     alignment and domain information
>cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 Back     alignment and domain information
>cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding Back     alignment and domain information
>cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains Back     alignment and domain information
>cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 Back     alignment and domain information
>cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle Back     alignment and domain information
>cd02952 TRP14_like Human TRX-related protein 14 (TRP14)-like family; composed of proteins similar to TRP14, a 14kD cytosolic protein that shows disulfide reductase activity in vitro with a different substrate specificity compared with another human cytosolic protein, TRX1 Back     alignment and domain information
>cd03008 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03009 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, TryX and nucleoredoxin (NRX) subfamily; TryX and NRX are thioredoxin (TRX)-like protein disulfide oxidoreductases that alter the redox state of target proteins via the reversible oxidation of an active center CXXC motif Back     alignment and domain information
>TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative Back     alignment and domain information
>PTZ00443 Thioredoxin domain-containing protein; Provisional Back     alignment and domain information
>cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX Back     alignment and domain information
>cd04791 LanC_SerThrkinase Lanthionine synthetase C-like domain associated with serine threonine kinases Back     alignment and domain information
>cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein Back     alignment and domain information
>cd03010 TlpA_like_DsbE TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif Back     alignment and domain information
>PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional Back     alignment and domain information
>PF07944 DUF1680: Putative glycosyl hydrolase of unknown function (DUF1680); InterPro: IPR012878 The members of this family are sequences derived from hypothetical bacterial and eukaryotic proteins of unknown function Back     alignment and domain information
>cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions Back     alignment and domain information
>cd02964 TryX_like_family Tryparedoxin (TryX)-like family; composed of TryX and related proteins including nucleoredoxin (NRX), rod-derived cone viability factor (RdCVF) and the nematode homolog described as a 16-kD class of TRX Back     alignment and domain information
>PF13905 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_A 1OC8_B 1O6J_A 1OC9_B 1O81_A 3FKF_A 1O85_A 1O7U_A 1O8W_A Back     alignment and domain information
>cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO Back     alignment and domain information
>COG4225 Predicted unsaturated glucuronyl hydrolase involved in regulation of bacterial surface properties, and related proteins [General function prediction only] Back     alignment and domain information
>cd02967 mauD Methylamine utilization (mau) D family; mauD protein is the translation product of the mauD gene found in methylotrophic bacteria, which are able to use methylamine as a sole carbon source and a nitrogen source Back     alignment and domain information
>cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>PHA02125 thioredoxin-like protein Back     alignment and domain information
>cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic Back     alignment and domain information
>TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB Back     alignment and domain information
>cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions Back     alignment and domain information
>TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 Back     alignment and domain information
>KOG0908 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02740 TraF-like TraF-like protein Back     alignment and domain information
>PRK03147 thiol-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PF07470 Glyco_hydro_88: Glycosyl Hydrolase Family 88; InterPro: IPR010905 Unsaturated glucuronyl hydrolase catalyses the hydrolytic release of unsaturated glucuronic acids from oligosaccharides produced by the reactions of polysaccharide lyases [] Back     alignment and domain information
>cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>TIGR00424 APS_reduc 5'-adenylylsulfate reductase, thioredoxin-independent Back     alignment and domain information
>PLN02309 5'-adenylylsulfate reductase Back     alignment and domain information
>TIGR01626 ytfJ_HI0045 conserved hypothetical protein YtfJ-family, TIGR01626 Back     alignment and domain information
>TIGR00412 redox_disulf_2 small redox-active disulfide protein 2 Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>cd03012 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain Back     alignment and domain information
>TIGR02661 MauD methylamine dehydrogenase accessory protein MauD Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein Back     alignment and domain information
>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) Back     alignment and domain information
>cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein Back     alignment and domain information
>PF06662 C5-epim_C: D-glucuronyl C5-epimerase C-terminus; InterPro: IPR010598 This entry consists of known or predicted D-glucuronyl C5-epimerases which share a common C-terminal region Back     alignment and domain information
>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic Back     alignment and domain information
>cd04434 LanC_like LanC-like proteins Back     alignment and domain information
>cd04792 LanM-like LanM-like proteins Back     alignment and domain information
>PF08534 Redoxin: Redoxin; InterPro: IPR013740 This redoxin domain is found in peroxiredoxin, thioredoxin and glutaredoxin proteins Back     alignment and domain information
>PRK13728 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>KOG2501 consensus Thioredoxin, nucleoredoxin and related proteins [General function prediction only] Back     alignment and domain information
>PF07944 DUF1680: Putative glycosyl hydrolase of unknown function (DUF1680); InterPro: IPR012878 The members of this family are sequences derived from hypothetical bacterial and eukaryotic proteins of unknown function Back     alignment and domain information
>PTZ00062 glutaredoxin; Provisional Back     alignment and domain information
>cd03007 PDI_a_ERp29_N PDIa family, endoplasmic reticulum protein 29 (ERp29) subfamily; ERp29 is a ubiquitous ER-resident protein expressed in high levels in secretory cells Back     alignment and domain information
>PF06662 C5-epim_C: D-glucuronyl C5-epimerase C-terminus; InterPro: IPR010598 This entry consists of known or predicted D-glucuronyl C5-epimerases which share a common C-terminal region Back     alignment and domain information
>PF06917 Pectate_lyase_2: Periplasmic pectate lyase; InterPro: IPR010702 This family consists of several Enterobacterial periplasmic pectate lyase proteins Back     alignment and domain information
>cd02969 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>PLN02399 phospholipid hydroperoxide glutathione peroxidase Back     alignment and domain information
>cd02988 Phd_like_VIAF Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis Back     alignment and domain information
>COG3533 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd04793 LanC LanC is the cyclase enzyme of the lanthionine synthetase Back     alignment and domain information
>cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold Back     alignment and domain information
>cd02990 UAS_FAF1 UAS family, FAS-associated factor 1 (FAF1) subfamily; FAF1 contains a UAS domain of unknown function N-terminal to a ubiquitin-associated UBX domain Back     alignment and domain information
>PTZ00056 glutathione peroxidase; Provisional Back     alignment and domain information
>COG4225 Predicted unsaturated glucuronyl hydrolase involved in regulation of bacterial surface properties, and related proteins [General function prediction only] Back     alignment and domain information
>cd03017 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides Back     alignment and domain information
>KOG0190 consensus Protein disulfide isomerase (prolyl 4-hydroxylase beta subunit) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09437 bcp thioredoxin-dependent thiol peroxidase; Reviewed Back     alignment and domain information
>KOG0190 consensus Protein disulfide isomerase (prolyl 4-hydroxylase beta subunit) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02180 GRX_euk Glutaredoxin Back     alignment and domain information
>PF14595 Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A Back     alignment and domain information
>KOG0191 consensus Thioredoxin/protein disulfide isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02412 probable glutathione peroxidase Back     alignment and domain information
>PF00759 Glyco_hydro_9: Glycosyl hydrolase family 9; InterPro: IPR001701 O-Glycosyl hydrolases 3 Back     alignment and domain information
>COG3533 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR02540 gpx7 putative glutathione peroxidase Gpx7 Back     alignment and domain information
>KOG4277 consensus Uncharacterized conserved protein, contains thioredoxin domain [General function prediction only] Back     alignment and domain information
>COG4403 LcnDR2 Lantibiotic modifying enzyme [Defense mechanisms] Back     alignment and domain information
>cd00340 GSH_Peroxidase Glutathione (GSH) peroxidase family; tetrameric selenoenzymes that catalyze the reduction of a variety of hydroperoxides including lipid peroxidases, using GSH as a specific electron donor substrate Back     alignment and domain information
>cd02889 SQCY Squalene cyclase (SQCY) domain; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold Back     alignment and domain information
>PF00578 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Peroxiredoxins (Prxs) are a ubiquitous family of antioxidant enzymes that also control cytokine-induced peroxide levels which mediate signal transduction in mammalian cells Back     alignment and domain information
>TIGR03137 AhpC peroxiredoxin Back     alignment and domain information
>PTZ00470 glycoside hydrolase family 47 protein; Provisional Back     alignment and domain information
>cd02968 SCO SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold Back     alignment and domain information
>cd04434 LanC_like LanC-like proteins Back     alignment and domain information
>cd03014 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 2-cys PRX subfamily; composed of PRXs containing peroxidatic and resolving cysteines, similar to the homodimeric thiol specific antioxidant (TSA) protein also known as TRX-dependent thiol peroxidase (Tpx) Back     alignment and domain information
>cd04792 LanM-like LanM-like proteins Back     alignment and domain information
>PRK00522 tpx lipid hydroperoxide peroxidase; Provisional Back     alignment and domain information
>TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family Back     alignment and domain information
>KOG2787 consensus Lanthionine synthetase C-like protein 1 [Defense mechanisms] Back     alignment and domain information
>PRK10382 alkyl hydroperoxide reductase subunit C; Provisional Back     alignment and domain information
>cd03015 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides Back     alignment and domain information
>PTZ00256 glutathione peroxidase; Provisional Back     alignment and domain information
>PF01532 Glyco_hydro_47: Glycosyl hydrolase family 47; InterPro: IPR001382 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PLN03009 cellulase Back     alignment and domain information
>PLN02266 endoglucanase Back     alignment and domain information
>COG0526 TrxA Thiol-disulfide isomerase and thioredoxins [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Back     alignment and domain information
>PLN02613 endoglucanase Back     alignment and domain information
>PLN02171 endoglucanase Back     alignment and domain information
>TIGR02200 GlrX_actino Glutaredoxin-like protein Back     alignment and domain information
>cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>PLN00119 endoglucanase Back     alignment and domain information
>PF05147 LANC_like: Lanthionine synthetase C-like protein; InterPro: IPR007822 The LanC-like protein superfamily encompasses a highly divergent group of peptide-modifying enzymes, including the eukaryotic and bacterial lanthionine synthetase C-like proteins (LanC) [, , ]; subtilin biosynthesis protein SpaC from Bacillus subtilis [, ]; epidermin biosynthesis protein EpiC from Staphylococcus epidermidis []; nisin biosynthesis protein NisC from Lactococcus lactis [, , ]; GCR2 from Arabidopsis thaliana []; and many others Back     alignment and domain information
>cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile Back     alignment and domain information
>PLN02909 Endoglucanase Back     alignment and domain information
>PTZ00470 glycoside hydrolase family 47 protein; Provisional Back     alignment and domain information
>PLN02340 endoglucanase Back     alignment and domain information
>KOG2507 consensus Ubiquitin regulatory protein UBXD2, contains UAS and UBX domains [General function prediction only] Back     alignment and domain information
>PF06110 DUF953: Eukaryotic protein of unknown function (DUF953); InterPro: IPR010357 This family consists of several hypothetical eukaryotic proteins of unknown function that are thioredoxin-like Back     alignment and domain information
>PF01532 Glyco_hydro_47: Glycosyl hydrolase family 47; InterPro: IPR001382 O-Glycosyl hydrolases 3 Back     alignment and domain information
>TIGR01577 oligosac_amyl oligosaccharide amylase Back     alignment and domain information
>PRK11509 hydrogenase-1 operon protein HyaE; Provisional Back     alignment and domain information
>cd04794 euk_LANCL eukaryotic Lanthionine synthetase C-like protein Back     alignment and domain information
>PLN02420 endoglucanase Back     alignment and domain information
>PLN02345 endoglucanase Back     alignment and domain information
>PRK15000 peroxidase; Provisional Back     alignment and domain information
>PLN02308 endoglucanase Back     alignment and domain information
>cd02971 PRX_family Peroxiredoxin (PRX) family; composed of the different classes of PRXs including many proteins originally known as bacterioferritin comigratory proteins (BCP), based on their electrophoretic mobility before their function was identified Back     alignment and domain information
>KOG0191 consensus Thioredoxin/protein disulfide isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd04794 euk_LANCL eukaryotic Lanthionine synthetase C-like protein Back     alignment and domain information
>cd03018 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-like subfamily; composed of proteins similar to Mycobacterium tuberculosis AhpE Back     alignment and domain information
>PRK11657 dsbG disulfide isomerase/thiol-disulfide oxidase; Provisional Back     alignment and domain information
>PRK13190 putative peroxiredoxin; Provisional Back     alignment and domain information
>cd02892 SQCY_1 Squalene cyclase (SQCY) domain subgroup 1; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold Back     alignment and domain information
>cd04793 LanC LanC is the cyclase enzyme of the lanthionine synthetase Back     alignment and domain information
>COG4833 Predicted glycosyl hydrolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1752 consensus Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK10877 protein disulfide isomerase II DsbC; Provisional Back     alignment and domain information
>TIGR02189 GlrX-like_plant Glutaredoxin-like family Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK11200 grxA glutaredoxin 1; Provisional Back     alignment and domain information
>cd02970 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>PTZ00137 2-Cys peroxiredoxin; Provisional Back     alignment and domain information
>PF13728 TraF: F plasmid transfer operon protein Back     alignment and domain information
>PRK13599 putative peroxiredoxin; Provisional Back     alignment and domain information
>cd02892 SQCY_1 Squalene cyclase (SQCY) domain subgroup 1; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold Back     alignment and domain information
>TIGR00365 monothiol glutaredoxin, Grx4 family Back     alignment and domain information
>TIGR02183 GRXA Glutaredoxin, GrxA family Back     alignment and domain information
>PHA03050 glutaredoxin; Provisional Back     alignment and domain information
>PTZ00253 tryparedoxin peroxidase; Provisional Back     alignment and domain information
>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions Back     alignment and domain information
>PRK10606 btuE putative glutathione peroxidase; Provisional Back     alignment and domain information
>TIGR02190 GlrX-dom Glutaredoxin-family domain Back     alignment and domain information
>PF06917 Pectate_lyase_2: Periplasmic pectate lyase; InterPro: IPR010702 This family consists of several Enterobacterial periplasmic pectate lyase proteins Back     alignment and domain information
>cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins Back     alignment and domain information
>PF06202 GDE_C: Amylo-alpha-1,6-glucosidase ; InterPro: IPR010401 This family includes human glycogen branching enzyme P35573 from SWISSPROT Back     alignment and domain information
>TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH Back     alignment and domain information
>KOG3414 consensus Component of the U4/U6 Back     alignment and domain information
>PF02966 DIM1: Mitosis protein DIM1; InterPro: IPR004123 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>TIGR02739 TraF type-F conjugative transfer system pilin assembly protein TraF Back     alignment and domain information
>PRK10638 glutaredoxin 3; Provisional Back     alignment and domain information
>PRK13191 putative peroxiredoxin; Provisional Back     alignment and domain information
>PLN02175 endoglucanase Back     alignment and domain information
>cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>cd03016 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine Back     alignment and domain information
>TIGR01577 oligosac_amyl oligosaccharide amylase Back     alignment and domain information
>PF13192 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZYN_A 1HYU_A 1ILO_A 1J08_F 2YWM_B 2AYT_B 2HLS_B 1A8L_A 2K8S_B Back     alignment and domain information
>PRK13703 conjugal pilus assembly protein TraF; Provisional Back     alignment and domain information
>TIGR02181 GRX_bact Glutaredoxin, GrxC family Back     alignment and domain information
>PRK10329 glutaredoxin-like protein; Provisional Back     alignment and domain information
>PF00759 Glyco_hydro_9: Glycosyl hydrolase family 9; InterPro: IPR001701 O-Glycosyl hydrolases 3 Back     alignment and domain information
>KOG3425 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0911 consensus Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2431 consensus 1, 2-alpha-mannosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03463 osq_cycl 2,3-oxidosqualene cyclase Back     alignment and domain information
>KOG0912 consensus Thiol-disulfide isomerase and thioredoxin [Posttranslational modification, protein turnover, chaperones; Energy production and conversion] Back     alignment and domain information
>TIGR01507 hopene_cyclase squalene-hopene cyclase Back     alignment and domain information
>cd02896 complement_C3_C4_C5 Proteins similar to C3, C4 and C5 of vertebrate complement Back     alignment and domain information
>COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2204 consensus Mannosyl-oligosaccharide alpha-1,2-mannosidase and related glycosyl hydrolases [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd03020 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold Back     alignment and domain information
>PRK13189 peroxiredoxin; Provisional Back     alignment and domain information
>KOG2204 consensus Mannosyl-oligosaccharide alpha-1,2-mannosidase and related glycosyl hydrolases [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4403 LcnDR2 Lantibiotic modifying enzyme [Defense mechanisms] Back     alignment and domain information
>PF05592 Bac_rhamnosid: Bacterial alpha-L-rhamnosidase; InterPro: IPR008902 This entry consists of bacterial rhamnosidase A and B enzymes Back     alignment and domain information
>PRK12759 bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional Back     alignment and domain information
>cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria Back     alignment and domain information
>TIGR02474 pec_lyase pectate lyase, PelA/Pel-15E family Back     alignment and domain information
>PRK11097 endo-1,4-D-glucanase; Provisional Back     alignment and domain information
>TIGR01507 hopene_cyclase squalene-hopene cyclase Back     alignment and domain information
>cd02889 SQCY Squalene cyclase (SQCY) domain; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold Back     alignment and domain information
>KOG2431 consensus 1, 2-alpha-mannosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01787 squalene_cyclas squalene/oxidosqualene cyclases Back     alignment and domain information
>TIGR02474 pec_lyase pectate lyase, PelA/Pel-15E family Back     alignment and domain information
>PLN02993 lupeol synthase Back     alignment and domain information
>PF05147 LANC_like: Lanthionine synthetase C-like protein; InterPro: IPR007822 The LanC-like protein superfamily encompasses a highly divergent group of peptide-modifying enzymes, including the eukaryotic and bacterial lanthionine synthetase C-like proteins (LanC) [, , ]; subtilin biosynthesis protein SpaC from Bacillus subtilis [, ]; epidermin biosynthesis protein EpiC from Staphylococcus epidermidis []; nisin biosynthesis protein NisC from Lactococcus lactis [, , ]; GCR2 from Arabidopsis thaliana []; and many others Back     alignment and domain information
>PTZ00062 glutaredoxin; Provisional Back     alignment and domain information
>TIGR01561 gde_arch glycogen debranching enzyme, archaeal type, putative Back     alignment and domain information
>TIGR01535 glucan_glucosid glucan 1,4-alpha-glucosidase Back     alignment and domain information
>KOG1731 consensus FAD-dependent sulfhydryl oxidase/quiescin and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query725
3ira_A173 The Crystal Structure Of One Domain Of The Conserve 2e-44
>pdb|3IRA|A Chain A, The Crystal Structure Of One Domain Of The Conserved Protein From Methanosarcina Mazei Go1 Length = 173 Back     alignment and structure

Iteration: 1

Score = 177 bits (448), Expect = 2e-44, Method: Compositional matrix adjust. Identities = 78/154 (50%), Positives = 104/154 (67%) Query: 103 NRLAAEHSPYLLQHAHNPVDXXXXXXXXXXXXRKRDVPIFLSIGYSTCHWCHVMEVESFE 162 NRL E SPYLLQHA+NPVD RK + P+FLSIGYSTCHWCH+M ESFE Sbjct: 4 NRLIKEKSPYLLQHAYNPVDWYPWGEEAFEKARKENKPVFLSIGYSTCHWCHMMAHESFE 63 Query: 163 DEGVAKLLNDWFVSIKVDREERPDVDKVYMTYVQALYGGGGWPLSVFLSPDLKPLMGGTY 222 DE VA L+N+ FVSIKVDREERPD+D +YMT Q + G GGWPL++ ++P KP GTY Sbjct: 64 DEEVAGLMNEAFVSIKVDREERPDIDNIYMTVCQIILGRGGWPLNIIMTPGKKPFFAGTY 123 Query: 223 FPPEDKYGRPGFKTILRKVKDAWDKKRDMLAQSG 256 P ++ + G ++ ++K+ W+++ + + S Sbjct: 124 IPKNTRFNQIGMLELVPRIKEIWEQQHEEVLDSA 157 Database: pdbaa

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query725
3ira_A173 Conserved protein; methanosarcina mazei,structural 1e-107
2ju5_A154 Thioredoxin disulfide isomerase; protein, oxidored 3e-47
3ph9_A151 Anterior gradient protein 3 homolog; thioredoxin f 1e-34
1sen_A164 Thioredoxin-like protein P19; endoplasmic reticulu 3e-33
3f9u_A172 Putative exported cytochrome C biogenesis-related; 4e-30
3fk8_A133 Disulphide isomerase; APC61824.1, xylella fastidio 1e-28
2gz6_A388 N-acetyl-D-glucosamine 2-epimerase; anabaena SP. C 3e-20
2lst_A130 Thioredoxin; structural genomics, NEW YORK structu 1e-18
3gt5_A402 N-acetylglucosamine 2-epimerase; structural genomi 2e-13
2dlx_A153 UBX domain-containing protein 7; UAS domain, prote 1e-12
2fwh_A134 Thiol:disulfide interchange protein DSBD; thioredo 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-05
1fp3_A402 N-acyl-D-glucosamine 2-epimerase; alpha/alpha-barr 6e-07
2kuc_A130 Putative disulphide-isomerase; structural genomics 1e-06
>3ira_A Conserved protein; methanosarcina mazei,structural genomics, MCSG, protein structure initiative, midwest center for STRU genomics; 2.10A {Methanosarcina mazei} Length = 173 Back     alignment and structure
 Score =  321 bits (825), Expect = e-107
 Identities = 88/170 (51%), Positives = 119/170 (70%)

Query: 102 TNRLAAEHSPYLLQHAHNPVDWFAWGEEAFAEARKRDVPIFLSIGYSTCHWCHVMEVESF 161
            NRL  E SPYLLQHA+NPVDW+ WGEEAF +ARK + P+FLSIGYSTCHWCH+M  ESF
Sbjct: 3   PNRLIKEKSPYLLQHAYNPVDWYPWGEEAFEKARKENKPVFLSIGYSTCHWCHMMAHESF 62

Query: 162 EDEGVAKLLNDWFVSIKVDREERPDVDKVYMTYVQALYGGGGWPLSVFLSPDLKPLMGGT 221
           EDE VA L+N+ FVSIKVDREERPD+D +YMT  Q + G GGWPL++ ++P  KP   GT
Sbjct: 63  EDEEVAGLMNEAFVSIKVDREERPDIDNIYMTVCQIILGRGGWPLNIIMTPGKKPFFAGT 122

Query: 222 YFPPEDKYGRPGFKTILRKVKDAWDKKRDMLAQSGAFAIEQLSEALSASA 271
           Y P   ++ + G   ++ ++K+ W+++ + +  S       + E +  S+
Sbjct: 123 YIPKNTRFNQIGMLELVPRIKEIWEQQHEEVLDSAEKITSTIQEMIKESS 172


>2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} Length = 154 Back     alignment and structure
>3ph9_A Anterior gradient protein 3 homolog; thioredoxin fold, protein disulfide isomerase, endoplasmic R isomerase; 1.83A {Homo sapiens} Length = 151 Back     alignment and structure
>1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A Length = 164 Back     alignment and structure
>3f9u_A Putative exported cytochrome C biogenesis-related; exported cytochrome C biogenesis-related protein, bacteroide fragilis; 2.20A {Bacteroides fragilis nctc 9343} Length = 172 Back     alignment and structure
>3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} Length = 133 Back     alignment and structure
>2gz6_A N-acetyl-D-glucosamine 2-epimerase; anabaena SP. CH1, isomer; 2.00A {Anabaena SP} Length = 388 Back     alignment and structure
>2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} Length = 130 Back     alignment and structure
>3gt5_A N-acetylglucosamine 2-epimerase; structural genomics, isomerase, PSI-2; 1.70A {Xylella fastidiosa} Length = 402 Back     alignment and structure
>2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24 Length = 153 Back     alignment and structure
>2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A Length = 134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1fp3_A N-acyl-D-glucosamine 2-epimerase; alpha/alpha-barrel, isomer; 2.00A {Sus scrofa} SCOP: a.102.1.3 Length = 402 Back     alignment and structure
>2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Length = 130 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query725
3ira_A173 Conserved protein; methanosarcina mazei,structural 100.0
1fp3_A402 N-acyl-D-glucosamine 2-epimerase; alpha/alpha-barr 100.0
2gz6_A388 N-acetyl-D-glucosamine 2-epimerase; anabaena SP. C 100.0
2zbl_A421 Putative isomerase; N-acyl-D-glucosamine 2-epimera 99.97
3gt5_A402 N-acetylglucosamine 2-epimerase; structural genomi 99.96
1fp3_A402 N-acyl-D-glucosamine 2-epimerase; alpha/alpha-barr 99.93
2dlx_A153 UBX domain-containing protein 7; UAS domain, prote 99.9
2zbl_A 421 Putative isomerase; N-acyl-D-glucosamine 2-epimera 99.88
2zzr_A397 Unsaturated glucuronyl hydrolase; alpha barrel; 1. 99.86
2ahf_A377 Unsaturated glucuronyl hydrolase; alpha6/alpha6 ba 99.82
3ph9_A151 Anterior gradient protein 3 homolog; thioredoxin f 99.82
3gt5_A 402 N-acetylglucosamine 2-epimerase; structural genomi 99.79
2gz6_A 388 N-acetyl-D-glucosamine 2-epimerase; anabaena SP. C 99.76
3f9u_A172 Putative exported cytochrome C biogenesis-related; 99.75
3k7x_A349 LIN0763 protein; Q92DQ0, LKR23, NESG, structural g 99.73
2ju5_A154 Thioredoxin disulfide isomerase; protein, oxidored 99.72
3fk8_A133 Disulphide isomerase; APC61824.1, xylella fastidio 99.56
2lst_A130 Thioredoxin; structural genomics, NEW YORK structu 99.25
2kuc_A130 Putative disulphide-isomerase; structural genomics 99.46
3h7l_A 586 Endoglucanase; dehydrogenase, PSI-2, NYSGXRC, stru 99.46
3k7x_A 349 LIN0763 protein; Q92DQ0, LKR23, NESG, structural g 99.41
2fwh_A134 Thiol:disulfide interchange protein DSBD; thioredo 99.39
2ahf_A377 Unsaturated glucuronyl hydrolase; alpha6/alpha6 ba 99.33
2zzr_A397 Unsaturated glucuronyl hydrolase; alpha barrel; 1. 99.31
1sen_A164 Thioredoxin-like protein P19; endoplasmic reticulu 99.29
3dml_A116 Putative uncharacterized protein; thioredoxin, oxi 99.28
3pmm_A 382 Putative cytoplasmic protein; structural genomics, 99.25
2ec4_A178 FAS-associated factor 1; UAS domain, protein FAF1, 99.23
3hxs_A141 Thioredoxin, TRXP; electron transport; 2.00A {Bact 99.2
1ep7_A112 Thioredoxin CH1, H-type; electron transport; 2.10A 99.2
1ti3_A113 Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul 99.18
3gnj_A111 Thioredoxin domain protein; APC92103, STR genomics 99.17
2l57_A126 Uncharacterized protein; structural genomics, unkn 99.16
3f3q_A109 Thioredoxin-1; His TAG, electron transport, cytopl 99.15
1nc5_A373 Hypothetical protein YTER; structural genomics, he 99.15
2l5l_A136 Thioredoxin; structural genomics, electron transpo 99.15
1nsw_A105 Thioredoxin, TRX; thermostability, electron transp 99.14
3zzx_A105 Thioredoxin; oxidoreductase; 1.88A {Litopenaeus va 99.14
3k11_A 445 Putative glycosyl hydrolase; structural genomics, 99.14
1dby_A107 Chloroplast thioredoxin M CH2; thioredoxin CH2, ch 99.13
3tco_A109 Thioredoxin (TRXA-1); disulfide oxidoreductase, ox 99.13
3qfa_C116 Thioredoxin; protein-protein complex, rossmann fol 99.12
1xfl_A124 Thioredoxin H1; AT3G51030, structural genomics, pr 99.12
3k11_A445 Putative glycosyl hydrolase; structural genomics, 99.12
2voc_A112 Thioredoxin; electron transport, homodimer, disulf 99.11
2vm1_A118 Thioredoxin, thioredoxin H isoform 1.; oxidoreduct 99.11
1wmj_A130 Thioredoxin H-type; structural genomics, program f 99.11
2trx_A108 Thioredoxin; electron transport; 1.68A {Escherichi 99.11
1w4v_A119 Thioredoxin, mitochondrial; antioxidant enzyme, mi 99.1
2dml_A130 Protein disulfide-isomerase A6; thioredoxin domain 99.1
3d22_A139 TRXH4, thioredoxin H-type; electron transport, cyt 99.08
2av4_A160 Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI 99.08
1syr_A112 Thioredoxin; SGPP, structural genomics, PSI, prote 99.08
2vlu_A122 Thioredoxin, thioredoxin H isoform 2.; oxidoreduct 99.08
3hz4_A140 Thioredoxin; NYSGXRC, PSI-II, reduced form, protei 99.07
2i4a_A107 Thioredoxin; acidophIle, disulfide exchange, oxido 99.07
3pmm_A382 Putative cytoplasmic protein; structural genomics, 99.07
2yzu_A109 Thioredoxin; redox protein, electron transport, st 99.06
1oaz_A123 Thioredoxin 1; immune system, antibody/complex, an 99.06
4euy_A105 Uncharacterized protein; structural genomics, PSI- 99.05
1t00_A112 Thioredoxin, TRX; redox regulation, multifunction 99.05
3ul3_B128 Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 99.05
3d6i_A112 Monothiol glutaredoxin-3; thioredoxin-like, electr 99.05
1fb6_A105 Thioredoxin M; electron transport; 2.10A {Spinacia 99.05
3die_A106 Thioredoxin, TRX; electron transport, SWAP domain, 99.04
3aps_A122 DNAJ homolog subfamily C member 10; thioredoxin fo 99.04
2f51_A118 Thioredoxin; electron transport; 1.90A {Trichomona 99.03
2dj1_A140 Protein disulfide-isomerase A4; protein ERP-72, ER 99.03
3gix_A149 Thioredoxin-like protein 4B; PRE-mRNA splicing, TX 99.03
1nc5_A 373 Hypothetical protein YTER; structural genomics, he 99.03
1gh2_A107 Thioredoxin-like protein; redox-active center, ele 99.02
1x5d_A133 Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC 99.02
3m9j_A105 Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} 99.02
2oe3_A114 Thioredoxin-3; electron transport, alpha/beta sand 99.02
2o8v_B128 Thioredoxin 1; disulfide crosslinked complex, oxid 99.01
2ppt_A155 Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc 99.0
3p2a_A148 Thioredoxin 2, putative thioredoxin-like protein; 99.0
2j23_A121 Thioredoxin; immune protein, autoreactivity, cross 99.0
2wz9_A153 Glutaredoxin-3; protein binding; 1.55A {Homo sapie 99.0
2xc2_A117 Thioredoxinn; oxidoreductase, protein disulfide re 99.0
1r26_A125 Thioredoxin; redox-active disulfide, electron tran 99.0
2e0q_A104 Thioredoxin; electron transport; 1.49A {Sulfolobus 99.0
1thx_A115 Thioredoxin, thioredoxin 2; oxido-reductase, elect 98.99
1xwb_A106 Thioredoxin; dimerization, redox regulation, THI X 98.99
2i1u_A121 Thioredoxin, TRX, MPT46; redox protein, electron t 98.97
1mek_A120 Protein disulfide isomerase; electron transport, r 98.96
1qgv_A142 Spliceosomal protein U5-15KD; snRNP, thioredoxin, 98.95
2vim_A104 Thioredoxin, TRX; thioredoxin fold, oxidoreductase 98.95
3cxg_A133 Putative thioredoxin; malaria, structural GEN oxid 98.94
2dj3_A133 Protein disulfide-isomerase A4; protein ERP-72, ER 98.94
2l6c_A110 Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu 98.93
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 98.93
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.91
3h79_A127 Thioredoxin-like protein; thioredoxin fold, cataly 98.9
2pu9_C111 TRX-F, thioredoxin F-type, chloroplast; protein-pr 98.9
3uvt_A111 Thioredoxin domain-containing protein 5; thioredox 98.88
2dj0_A137 Thioredoxin-related transmembrane protein 2; AVLA2 98.87
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.87
1zma_A118 Bacterocin transport accessory protein; alpha-beta 98.84
2yj7_A106 LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti 98.34
2qsi_A137 Putative hydrogenase expression/formation protein; 98.83
1faa_A124 Thioredoxin F; electron transport; 1.85A {Spinacia 98.83
3hcz_A148 Possible thiol-disulfide isomerase; APC61559.2, cy 98.82
2qgv_A140 Hydrogenase-1 operon protein HYAE; alpha-beta prot 98.8
1z6n_A167 Hypothetical protein PA1234; alpha-beta-alpha sand 98.8
2djj_A121 PDI, protein disulfide-isomerase; thioredoxin fold 98.78
1v98_A140 Thioredoxin; oxidoreductase, structural genomics, 98.78
1x5e_A126 Thioredoxin domain containing protein 1; TMX, TXND 98.77
2b1k_A168 Thiol:disulfide interchange protein DSBE; C-termin 98.76
1lu4_A136 Soluble secreted antigen MPT53; thioredoxin-like f 98.75
3emx_A135 Thioredoxin; structural genomics, oxidoreductase, 98.75
3ewl_A142 Uncharacterized conserved protein BF1870; alpha-be 98.75
2b5x_A148 YKUV protein, TRXY; thioredoxin-like, oxidoreducta 98.73
3raz_A151 Thioredoxin-related protein; structural genomics, 98.73
4evm_A138 Thioredoxin family protein; structural genomics, n 98.73
1fo5_A85 Thioredoxin; disulfide oxidoreductase, structural 98.72
3or5_A165 Thiol:disulfide interchange protein, thioredoxin p 98.71
2lja_A152 Putative thiol-disulfide oxidoreductase; structura 98.71
3idv_A241 Protein disulfide-isomerase A4; thioredoxin-like f 98.71
1nho_A85 Probable thioredoxin; beta sheet, alpha helix, oxi 98.71
1wou_A123 Thioredoxin -related protein, 14 kDa; electron tra 98.7
1zzo_A136 RV1677; thioredoxin fold, structural genomics, PSI 98.69
2f9s_A151 Thiol-disulfide oxidoreductase RESA; thioredoxin-l 98.69
2lrn_A152 Thiol:disulfide interchange protein; structural ge 98.65
3erw_A145 Sporulation thiol-disulfide oxidoreductase A; thio 98.65
3kh7_A176 Thiol:disulfide interchange protein DSBE; TRX-like 98.65
3fkf_A148 Thiol-disulfide oxidoreductase; structural genomic 98.65
1a8l_A226 Protein disulfide oxidoreductase; PDI, thioredoxin 98.65
3gl3_A152 Putative thiol:disulfide interchange protein DSBE; 98.64
1kng_A156 Thiol:disulfide interchange protein CYCY; thioredo 98.64
2h30_A164 Thioredoxin, peptide methionine sulfoxide reductas 98.63
3hdc_A158 Thioredoxin family protein; ATCC53774, DSM 7210, , 98.62
3kcm_A154 Thioredoxin family protein; SGX, thioredoxin prote 98.61
3ha9_A165 Uncharacterized thioredoxin-like protein; PSI, MCS 98.61
3kp8_A106 Vkorc1/thioredoxin domain protein; blood coagulati 98.59
3eur_A142 Uncharacterized protein; PSI2,MCSG, conserved prot 98.59
3eyt_A158 Uncharacterized protein SPOA0173; thioredoxin-like 98.57
3lor_A160 Thiol-disulfide isomerase and thioredoxins; PSI, M 98.57
2dbc_A135 PDCL2, unnamed protein product; phosducin-like pro 98.55
1i5g_A144 Tryparedoxin II; electron transport; HET: TS5; 1.4 98.55
3s9f_A165 Tryparedoxin; thioredoxin fold, disulfide reductas 98.53
2ls5_A159 Uncharacterized protein; structural genomics, unkn 97.93
2es7_A142 Q8ZP25_salty, putative thiol-disulfide isomerase a 98.52
3idv_A241 Protein disulfide-isomerase A4; thioredoxin-like f 98.51
3q6o_A244 Sulfhydryl oxidase 1; protein disulfide isomerase, 98.51
1o8x_A146 Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot 98.5
2l5o_A153 Putative thioredoxin; structural genomics, unknown 98.5
3lwa_A183 Secreted thiol-disulfide isomerase; thioredoxin, P 98.49
1o73_A144 Tryparedoxin; electron transport, trypanosomatid, 98.49
3ed3_A298 Protein disulfide-isomerase MPD1; thioredoxin-like 98.48
1ilo_A77 Conserved hypothetical protein MTH895; beta-alpha- 98.47
3fw2_A150 Thiol-disulfide oxidoreductase; structural genomic 98.45
2lrt_A152 Uncharacterized protein; structural genomics, thio 98.44
3iv4_A112 Putative oxidoreductase; APC23140, meticillin-resi 98.43
2ywm_A229 Glutaredoxin-like protein; redox protein, structur 98.42
2lus_A143 Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carci 97.79
3ia1_A154 THIO-disulfide isomerase/thioredoxin; oxidoreducta 98.41
4fo5_A143 Thioredoxin-like protein; AHPC/TSA family protein, 98.4
2r2j_A382 Thioredoxin domain-containing protein 4; CRFS moti 98.4
1sji_A350 Calsequestrin 2, calsequestrin, cardiac muscle iso 98.4
3f8u_A481 Protein disulfide-isomerase A3ERP57; endoplasmic r 98.38
3h7l_A 586 Endoglucanase; dehydrogenase, PSI-2, NYSGXRC, stru 98.36
2b5e_A504 Protein disulfide-isomerase; 2.40A {Saccharomyces 98.32
2cvb_A188 Probable thiol-disulfide isomerase/thioredoxin; re 98.31
1jfu_A186 Thiol:disulfide interchange protein TLPA; thioredo 98.31
3ga4_A178 Dolichyl-diphosphooligosaccharide-protein glycosyl 98.29
1ttz_A87 Conserved hypothetical protein; structural genomic 98.29
2e7p_A116 Glutaredoxin; thioredoxin fold, poplar, electron t 98.29
2ywi_A196 Hypothetical conserved protein; uncharacterized co 98.28
1a0r_P245 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 98.26
2b5e_A504 Protein disulfide-isomerase; 2.40A {Saccharomyces 98.23
2rli_A171 SCO2 protein homolog, mitochondrial; copper protei 98.21
3t58_A519 Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. 98.2
2hls_A243 Protein disulfide oxidoreductase; thioredoxin fold 98.19
3qcp_A470 QSOX from trypanosoma brucei (tbqsox); ERV fold, t 98.19
2hyx_A352 Protein DIPZ; thioredoxin fold, jelly-roll, struct 98.16
3f8u_A481 Protein disulfide-isomerase A3ERP57; endoplasmic r 98.15
2vup_A190 Glutathione peroxidase-like protein; oxidoreductas 98.14
3apo_A780 DNAJ homolog subfamily C member 10; PDI family, th 98.14
3drn_A161 Peroxiredoxin, bacterioferritin comigratory prote 98.12
3us3_A367 Calsequestrin-1; calcium-binding protein; 1.74A {O 98.12
2ggt_A164 SCO1 protein homolog, mitochondrial; copper chaper 98.11
3u5r_E218 Uncharacterized protein; structural genomics, PSI- 98.11
2p5q_A170 Glutathione peroxidase 5; thioredoxin fold, oxidor 98.09
3cmi_A171 Peroxiredoxin HYR1; thioredoxin-like fold, oxidore 98.07
2trc_P217 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 98.05
3evi_A118 Phosducin-like protein 2; alpha beta, 3-layer(ABA) 98.04
2djk_A133 PDI, protein disulfide-isomerase; thioredoxin fold 98.03
3uem_A361 Protein disulfide-isomerase; thioredoxin-like doma 98.02
3apo_A780 DNAJ homolog subfamily C member 10; PDI family, th 98.01
2v1m_A169 Glutathione peroxidase; selenium, selenocysteine, 97.99
1xvw_A160 Hypothetical protein RV2238C/MT2298; thioredoxin f 97.99
3kij_A180 Probable glutathione peroxidase 8; human PDI-perox 97.99
2bmx_A195 Alkyl hydroperoxidase C; peroxiredoxin, antioxidan 97.97
2k6v_A172 Putative cytochrome C oxidase assembly protein; th 97.96
3dwv_A187 Glutathione peroxidase-like protein; alpha beta, 3 97.95
1we0_A187 Alkyl hydroperoxide reductase C; peroxiredoxin, AH 97.93
2k8s_A80 Thioredoxin; dimer, structural genomics, PSI-2, pr 97.89
2f8a_A208 Glutathione peroxidase 1; thioredoxin fold, struct 97.88
2fgx_A107 Putative thioredoxin; NET3, NESG, GFT-glutaredoxin 97.87
2p31_A181 CL683, glutathione peroxidase 7; thioredoxin fold, 97.84
2jsy_A167 Probable thiol peroxidase; solution structure, ant 97.83
1zof_A198 Alkyl hydroperoxide-reductase; decamer, toroide-sh 97.81
1xvq_A175 Thiol peroxidase; thioredoxin fold, structural gen 97.81
3e6u_A411 LANC-like protein 1; alpha barrel, cytoplasm, sign 97.79
2obi_A183 PHGPX, GPX-4, phospholipid hydroperoxide glutathio 97.78
1wjk_A100 C330018D20RIK protein; glutaredoxin, thioredoxin f 97.77
1zye_A220 Thioredoxin-dependent peroxide reductase; catenane 97.75
2h01_A192 2-Cys peroxiredoxin; thioredoxin peroxidase, struc 97.73
1a8l_A226 Protein disulfide oxidoreductase; PDI, thioredoxin 97.73
2gs3_A185 PHGPX, GPX-4, phospholipid hydroperoxide glutathio 97.71
1uul_A202 Tryparedoxin peroxidase homologue; peroxiredoxin, 97.7
2ywm_A229 Glutaredoxin-like protein; redox protein, structur 97.7
3kp9_A291 Vkorc1/thioredoxin domain protein; warfarin, disul 97.68
2c0g_A248 ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, 97.68
1xzo_A174 BSSCO, hypothetical protein YPMQ; thioredoxin-like 97.67
3ztl_A222 Thioredoxin peroxidase; oxidoreductase, reductase, 97.64
3gkn_A163 Bacterioferritin comigratory protein; BCP, PRX, at 97.63
1qmv_A197 Human thioredoxin peroxidase-B; peroxiredoxin, sul 97.59
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 97.56
1eej_A216 Thiol:disulfide interchange protein; oxidoreductas 97.54
2v8i_A543 Pectate lyase; periplasm, beta-elimination, pectin 97.54
2i81_A213 2-Cys peroxiredoxin; structural genomics consortiu 97.53
3gzk_A 537 Cellulase; fold from GH9 from CAZY database, glyco 97.53
2ht9_A146 Glutaredoxin-2; thioredoxin fold, iron-sulfur clus 97.45
4gqc_A164 Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, f 97.4
2b7k_A200 SCO1 protein; metallochaperone, cytochrome C oxida 97.39
2qc7_A240 ERP31, ERP28, endoplasmic reticulum protein ERP29; 97.37
2cq9_A130 GLRX2 protein, glutaredoxin 2; glutathione-S-trans 97.35
4hde_A170 SCO1/SENC family lipoprotein; structural genomics, 97.33
1t3b_A211 Thiol:disulfide interchange protein DSBC; oxidored 97.32
3hd5_A195 Thiol:disulfide interchange protein DSBA; protein 97.29
1ego_A85 Glutaredoxin; electron transport; NMR {Escherichia 97.28
2c0d_A221 Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, th 97.27
4g2e_A157 Peroxiredoxin; redox protein, structural genomics, 97.24
1kte_A105 Thioltransferase; redox-active center, electron tr 97.21
3gyk_A175 27KDA outer membrane protein; APC61738.2, siliciba 97.21
3p7x_A166 Probable thiol peroxidase; thioredoxin fold, oxido 97.21
2hls_A243 Protein disulfide oxidoreductase; thioredoxin fold 97.17
1v58_A241 Thiol:disulfide interchange protein DSBG; reduced 97.16
1ks8_A 433 Endo-B-1,4-glucanase; cellulase, endoglucanase, te 97.16
1clc_A 639 Endoglucanase CELD; EC: 3.2.1.4; cellulase, glycos 97.16
1psq_A163 Probable thiol peroxidase; structural genomics, NY 97.11
3ixr_A179 Bacterioferritin comigratory protein; alpha beta p 97.1
3h93_A192 Thiol:disulfide interchange protein DSBA; disulfid 97.07
1ia6_A 441 Cellulase CEL9M; cellullase, alpha barrel, hydrola 97.05
3rhb_A113 ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox 97.01
2hze_A114 Glutaredoxin-1; thioredoxin fold, arsenic, dimethy 96.97
1h75_A81 Glutaredoxin-like protein NRDH; electron transport 96.96
3c1r_A118 Glutaredoxin-1; oxidized form, oxidoreductase, cyt 96.9
3a2v_A249 Probable peroxiredoxin; thioredoxin peroxidase, hy 96.87
2yzh_A171 Probable thiol peroxidase; redox protein, antioxid 96.87
3msz_A89 Glutaredoxin 1; alpha-beta sandwich, center for st 96.86
2pn8_A211 Peroxiredoxin-4; thioredoxin, oxidoreductase, stru 96.86
3qpm_A240 Peroxiredoxin; oxidoreductase, thioredoxin fold, p 96.83
3me7_A170 Putative uncharacterized protein; electron transfe 96.8
2r37_A207 Glutathione peroxidase 3; plasma, structural genom 96.79
2i3y_A215 Epididymal secretory glutathione peroxidase; thior 96.76
3nzn_A103 Glutaredoxin; structural genomics, PSI2, MCSG, pro 96.75
2lqo_A92 Putative glutaredoxin RV3198.1/MT3292; TRX fold, o 96.69
3h8q_A114 Thioredoxin reductase 3; oxidoreductase, structura 96.68
2a4v_A159 Peroxiredoxin DOT5; yeast nuclear thiol peroxidase 96.67
1n8j_A186 AHPC, alkyl hydroperoxide reductase C22 protein; p 96.66
3keb_A224 Probable thiol peroxidase; structural genomics, AP 96.65
2yan_A105 Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H 96.61
1g87_A 614 Endocellulase 9G; endoglucanase, cellulose binding 96.55
1fov_A82 Glutaredoxin 3, GRX3; active site disulfide, CIS P 96.54
3uem_A361 Protein disulfide-isomerase; thioredoxin-like doma 96.52
3hz8_A193 Thiol:disulfide interchange protein DSBA; thiol-ox 96.49
2ri9_A475 Mannosyl-oligosaccharide alpha-1,2-mannosidase; al 96.45
1r7h_A75 NRDH-redoxin; thioredoxin, glutaredoxin, redox pro 96.42
1q98_A165 Thiol peroxidase, TPX; structural genomics, NYSGXR 96.37
3tjj_A254 Peroxiredoxin-4; thioredoxin fold, sulfenylation, 96.36
3zrd_A200 Thiol peroxidase; oxidoreductase, 2Cys peroxiredox 96.34
2klx_A89 Glutaredoxin; thioredoxin type domain, ssgcid, ele 96.31
1tf4_A 605 T. fusca endo/EXO-cellulase E4 catalytic domain an 96.29
1hcu_A503 Alpha-1,2-mannosidase; glycosylation, glycosyl hyd 96.24
3ctg_A129 Glutaredoxin-2; reduced form, electron transport, 96.16
2rem_A193 Disulfide oxidoreductase; disulfide oxidoreductase 96.16
3ic4_A92 Glutaredoxin (GRX-1); structural genomics, PSI, MC 96.14
1x9d_A538 Endoplasmic reticulum mannosyl-oligosaccharide 1, 96.1
2g0d_A409 Nisin biosynthesis protein NISC; alpha toroid, alp 95.99
2znm_A195 Thiol:disulfide interchange protein DSBA; thioredo 95.93
3qmx_A99 Glutaredoxin A, glutaredoxin 3; electron transport 95.92
1nxc_A478 Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA; 95.83
2yik_A 611 Endoglucanase; hydrolase; 2.10A {Clostridium therm 95.82
3l4n_A127 Monothiol glutaredoxin-6; C-terminal domain of GRX 95.76
2khp_A92 Glutaredoxin; thioredoxin type domain, ssgcid, ele 95.72
1wik_A109 Thioredoxin-like protein 2; picot homology 2 domai 95.55
1dl2_A511 Class I alpha-1,2-mannosidase; alpha-alpha helix b 95.53
2xfg_A 466 Endoglucanase 1; hydrolase-sugar binding protein c 95.49
2ri9_A475 Mannosyl-oligosaccharide alpha-1,2-mannosidase; al 95.21
4eo3_A322 Bacterioferritin comigratory protein/NADH dehydro; 95.1
2v2g_A233 Peroxiredoxin 6; oxidoreductase, antioxidant enzym 94.99
3gv1_A147 Disulfide interchange protein; neisseria gonorrhoe 94.91
1hcu_A503 Alpha-1,2-mannosidase; glycosylation, glycosyl hyd 94.88
1prx_A224 HORF6; peroxiredoxin, hydrogen peroxide, redox reg 94.74
1un2_A197 DSBA, thiol-disulfide interchange protein; disulfi 94.72
1tp9_A162 Peroxiredoxin, PRX D (type II); oligomer, thioredo 94.71
1nxc_A 478 Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA; 94.57
1dl2_A 511 Class I alpha-1,2-mannosidase; alpha-alpha helix b 94.56
2wfc_A167 Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidan 94.47
1z6m_A175 Conserved hypothetical protein; structural genomic 94.41
1x9d_A 538 Endoplasmic reticulum mannosyl-oligosaccharide 1, 94.26
1xcc_A220 1-Cys peroxiredoxin; unknown function, structural 94.17
1ia6_A441 Cellulase CEL9M; cellullase, alpha barrel, hydrola 93.93
1nm3_A241 Protein HI0572; hybrid, peroxiredoxin, glutaredoxi 93.76
3uma_A184 Hypothetical peroxiredoxin protein; nysgrc, PSI bi 93.47
2v8i_A543 Pectate lyase; periplasm, beta-elimination, pectin 93.41
2wci_A135 Glutaredoxin-4; redox-active center, iron-sulfur c 93.38
3e6u_A 411 LANC-like protein 1; alpha barrel, cytoplasm, sign 93.36
3ipz_A109 Monothiol glutaredoxin-S14, chloroplastic; electro 93.1
1aba_A87 Glutaredoxin; electron transport; HET: MES; 1.45A 93.07
4dvc_A184 Thiol:disulfide interchange protein DSBA; pilus as 92.91
2xfg_A466 Endoglucanase 1; hydrolase-sugar binding protein c 92.66
3gzk_A537 Cellulase; fold from GH9 from CAZY database, glyco 92.3
3zyw_A111 Glutaredoxin-3; metal binding protein; 1.84A {Homo 92.29
3mng_A173 Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, 92.16
1ks8_A433 Endo-B-1,4-glucanase; cellulase, endoglucanase, te 91.58
3sbc_A216 Peroxiredoxin TSA1; alpha-beta fold, peroxidase, c 91.58
1nm3_A241 Protein HI0572; hybrid, peroxiredoxin, glutaredoxi 91.57
3gx8_A121 Monothiol glutaredoxin-5, mitochondrial; TRX fold, 91.43
2pwj_A171 Mitochondrial peroxiredoxin; alpha and beta protei 90.96
3l9v_A189 Putative thiol-disulfide isomerase or thioredoxin; 90.91
1w6k_A732 Lanosterol synthase; cyclase, cholesterol, monotop 90.74
2wem_A118 Glutaredoxin-related protein 5; chromosome 14 open 90.63
1wzz_A 334 Probable endoglucanase; glycoside hydrolase family 89.06
3tue_A219 Tryparedoxin peroxidase; thioredoxin fold, peroxir 88.98
2g0d_A409 Nisin biosynthesis protein NISC; alpha toroid, alp 88.58
2ct6_A111 SH3 domain-binding glutamic acid-rich-like protein 88.4
1g87_A 614 Endocellulase 9G; endoglucanase, cellulose binding 88.39
3feu_A185 Putative lipoprotein; alpha-beta structure, struct 87.44
4f9z_D227 Endoplasmic reticulum resident protein 27; thiored 87.16
1ut9_A 609 Cellulose 1,4-beta-cellobiosidase; hydrolase, glyc 86.39
3f4s_A226 Alpha-DSBA1, putative uncharacterized protein; thi 86.25
1ut9_A609 Cellulose 1,4-beta-cellobiosidase; hydrolase, glyc 85.51
1t1v_A93 SH3BGRL3, SH3 domain-binding glutamic acid-rich pr 81.54
1clc_A 639 Endoglucanase CELD; EC: 3.2.1.4; cellulase, glycos 81.49
2wul_A118 Glutaredoxin related protein 5; chromosome 14 open 81.3
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 80.86
>3ira_A Conserved protein; methanosarcina mazei,structural genomics, MCSG, protein structure initiative, midwest center for STRU genomics; 2.10A {Methanosarcina mazei} Back     alignment and structure
Probab=100.00  E-value=1.5e-44  Score=355.88  Aligned_cols=168  Identities=52%  Similarity=1.035  Sum_probs=163.3

Q ss_pred             cccccccCCChhhhcccCCCCccccchHHHHHHHhhcCCcEEEEEeccCChhhHhhhhhccCCHHHHHHHhcCcEEEEEc
Q 004888          101 HTNRLAAEHSPYLLQHAHNPVDWFAWGEEAFAEARKRDVPIFLSIGYSTCHWCHVMEVESFEDEGVAKLLNDWFVSIKVD  180 (725)
Q Consensus       101 ~~NrL~~e~spyl~~ha~~~V~W~~~~~eAl~~Ak~e~KpI~l~~g~~wC~~C~~Me~e~f~d~eVa~~ln~~FV~VkvD  180 (725)
                      ++|||+.|+||||+||+++||+|++|+++++++|+++||||||+|+|+||+|||+|+.++|++++|++.+|++||+||||
T Consensus         2 ~~n~l~~~~spyl~~ha~~~v~W~~~~~ea~~~A~~~~KpVlvdF~A~WC~~Ck~m~~~~f~~~~va~~l~~~fv~ikVD   81 (173)
T 3ira_A            2 EPNRLIKEKSPYLLQHAYNPVDWYPWGEEAFEKARKENKPVFLSIGYSTCHWCHMMAHESFEDEEVAGLMNEAFVSIKVD   81 (173)
T ss_dssp             CCCGGGGCCCHHHHTTTTSSSCCBCSSHHHHHHHHHHTCCEEEEEECTTCHHHHHHHHHTTTCHHHHHHHHHHCEEEEEE
T ss_pred             CCcccccCCCHHHHhccCCCCCCCCcCHHHHHHHHHhCCCEEEecccchhHhhccccccccCCHHHHHHHHhcCceeeeC
Confidence            68999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCcchHHHHHHHHHHhcCCCCcCcEEEecCCCCccccccccCCCCCCCcchHHHHHHHHHHHHhhchHHHHHhHHHHH
Q 004888          181 REERPDVDKVYMTYVQALYGGGGWPLSVFLSPDLKPLMGGTYFPPEDKYGRPGFKTILRKVKDAWDKKRDMLAQSGAFAI  260 (725)
Q Consensus       181 ~ee~pd~~~~y~~~~q~~~g~~G~P~~vfl~pdG~~i~~~tY~p~~~~~~~~~F~~~L~~i~~~~~~~~~~l~~~a~~~~  260 (725)
                      ++++|++++.||.++|.++|++|||++||++|+|++++++||+|+++.+++++|+++|++|.+.|+++|++|++.|+++.
T Consensus        82 ~de~~~l~~~y~~~~q~~~gv~g~Pt~v~l~~dG~~v~~~ty~p~~~~~~~~~f~~~L~~v~~~~~~~~~~~~~~~~~~~  161 (173)
T 3ira_A           82 REERPDIDNIYMTVCQIILGRGGWPLNIIMTPGKKPFFAGTYIPKNTRFNQIGMLELVPRIKEIWEQQHEEVLDSAEKIT  161 (173)
T ss_dssp             TTTCHHHHHHHHHHHHHHHSCCCSSEEEEECTTSCEEEEESSCCSSCBTTBCCHHHHHHHHHHHHHHSHHHHHHHHHHTC
T ss_pred             CcccCcHHHHHHHHHHHHcCCCCCcceeeECCCCCceeeeeeCCCCcCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhh
Q 004888          261 EQLSEALS  268 (725)
Q Consensus       261 ~~l~~~~~  268 (725)
                      ++|++...
T Consensus       162 ~~~~~~~~  169 (173)
T 3ira_A          162 STIQEMIK  169 (173)
T ss_dssp             SHHHHHHH
T ss_pred             HHHHHhhc
Confidence            99987654



>1fp3_A N-acyl-D-glucosamine 2-epimerase; alpha/alpha-barrel, isomer; 2.00A {Sus scrofa} SCOP: a.102.1.3 Back     alignment and structure
>2gz6_A N-acetyl-D-glucosamine 2-epimerase; anabaena SP. CH1, isomer; 2.00A {Anabaena SP} Back     alignment and structure
>2zbl_A Putative isomerase; N-acyl-D-glucosamine 2-epimerase protein family; HET: BMA; 1.60A {Salmonella typhimurium} PDB: 2afa_A 2rgk_A* Back     alignment and structure
>3gt5_A N-acetylglucosamine 2-epimerase; structural genomics, isomerase, PSI-2; 1.70A {Xylella fastidiosa} Back     alignment and structure
>1fp3_A N-acyl-D-glucosamine 2-epimerase; alpha/alpha-barrel, isomer; 2.00A {Sus scrofa} SCOP: a.102.1.3 Back     alignment and structure
>2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24 Back     alignment and structure
>2zbl_A Putative isomerase; N-acyl-D-glucosamine 2-epimerase protein family; HET: BMA; 1.60A {Salmonella typhimurium} PDB: 2afa_A 2rgk_A* Back     alignment and structure
>2zzr_A Unsaturated glucuronyl hydrolase; alpha barrel; 1.75A {Streptococcus agalactiae} PDB: 3anj_A 3ank_A* 3ani_A* Back     alignment and structure
>2ahf_A Unsaturated glucuronyl hydrolase; alpha6/alpha6 barrel, glycoside hydrolase family 88; 1.52A {Bacillus SP} PDB: 2ahg_A* 2fv0_A* 2fv1_A* 2d5j_A 1vd5_A 2fuz_A Back     alignment and structure
>3ph9_A Anterior gradient protein 3 homolog; thioredoxin fold, protein disulfide isomerase, endoplasmic R isomerase; 1.83A {Homo sapiens} SCOP: c.47.1.0 PDB: 2lns_A 2lnt_A Back     alignment and structure
>3gt5_A N-acetylglucosamine 2-epimerase; structural genomics, isomerase, PSI-2; 1.70A {Xylella fastidiosa} Back     alignment and structure
>2gz6_A N-acetyl-D-glucosamine 2-epimerase; anabaena SP. CH1, isomer; 2.00A {Anabaena SP} Back     alignment and structure
>3f9u_A Putative exported cytochrome C biogenesis-related; exported cytochrome C biogenesis-related protein, bacteroide fragilis; 2.20A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3k7x_A LIN0763 protein; Q92DQ0, LKR23, NESG, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.89A {Listeria innocua} Back     alignment and structure
>2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} Back     alignment and structure
>3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} Back     alignment and structure
>2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} Back     alignment and structure
>2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>3h7l_A Endoglucanase; dehydrogenase, PSI-2, NYSGXRC, structural GEN protein structure initiative; 2.30A {Vibrio parahaemolyticus} Back     alignment and structure
>3k7x_A LIN0763 protein; Q92DQ0, LKR23, NESG, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.89A {Listeria innocua} Back     alignment and structure
>2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A Back     alignment and structure
>2ahf_A Unsaturated glucuronyl hydrolase; alpha6/alpha6 barrel, glycoside hydrolase family 88; 1.52A {Bacillus SP} PDB: 2ahg_A* 2fv0_A* 2fv1_A* 2d5j_A 1vd5_A 2fuz_A Back     alignment and structure
>2zzr_A Unsaturated glucuronyl hydrolase; alpha barrel; 1.75A {Streptococcus agalactiae} PDB: 3anj_A 3ank_A* 3ani_A* Back     alignment and structure
>1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A Back     alignment and structure
>3dml_A Putative uncharacterized protein; thioredoxin, oxidoreductase, sulfur oxidation, thiol- disulfide oxidoreductase; HET: MSE; 1.90A {Paracoccus denitrificans} PDB: 3d4t_A* Back     alignment and structure
>3pmm_A Putative cytoplasmic protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 1.90A {Klebsiella pneumoniae subsp} PDB: 3qwt_A Back     alignment and structure
>2ec4_A FAS-associated factor 1; UAS domain, protein FAF1, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A Back     alignment and structure
>1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A Back     alignment and structure
>1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 Back     alignment and structure
>3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0 Back     alignment and structure
>2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} Back     alignment and structure
>3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B Back     alignment and structure
>1nc5_A Hypothetical protein YTER; structural genomics, helix barrel, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Bacillus subtilis} SCOP: a.102.1.6 PDB: 2d8l_A* 2gh4_A* Back     alignment and structure
>2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} Back     alignment and structure
>1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A Back     alignment and structure
>3zzx_A Thioredoxin; oxidoreductase; 1.88A {Litopenaeus vannamei} Back     alignment and structure
>3k11_A Putative glycosyl hydrolase; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MSE MES; 1.80A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 Back     alignment and structure
>3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* Back     alignment and structure
>1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 Back     alignment and structure
>3k11_A Putative glycosyl hydrolase; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MSE MES; 1.80A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A Back     alignment and structure
>2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A Back     alignment and structure
>1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa} Back     alignment and structure
>2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... Back     alignment and structure
>1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A Back     alignment and structure
>2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A Back     alignment and structure
>2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii} Back     alignment and structure
>1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 Back     alignment and structure
>2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* Back     alignment and structure
>3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} Back     alignment and structure
>2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} Back     alignment and structure
>3pmm_A Putative cytoplasmic protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 1.90A {Klebsiella pneumoniae subsp} PDB: 3qwt_A Back     alignment and structure
>2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A Back     alignment and structure
>1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} Back     alignment and structure
>1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} Back     alignment and structure
>3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C Back     alignment and structure
>3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A Back     alignment and structure
>3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} Back     alignment and structure
>2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} Back     alignment and structure
>2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} SCOP: c.47.1.0 PDB: 1xbs_A Back     alignment and structure
>1nc5_A Hypothetical protein YTER; structural genomics, helix barrel, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Bacillus subtilis} SCOP: a.102.1.6 PDB: 2d8l_A* 2gh4_A* Back     alignment and structure
>1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 Back     alignment and structure
>1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... Back     alignment and structure
>2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A Back     alignment and structure
>2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Back     alignment and structure
>2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} Back     alignment and structure
>3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} Back     alignment and structure
>2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} Back     alignment and structure
>2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A Back     alignment and structure
>2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A Back     alignment and structure
>1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 Back     alignment and structure
>2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A Back     alignment and structure
>1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 Back     alignment and structure
>1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A Back     alignment and structure
>2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A Back     alignment and structure
>1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 Back     alignment and structure
>1qgv_A Spliceosomal protein U5-15KD; snRNP, thioredoxin, transcription; 1.40A {Homo sapiens} SCOP: c.47.1.8 PDB: 1syx_A 1pqn_A Back     alignment and structure
>2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} Back     alignment and structure
>3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} Back     alignment and structure
>2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} SCOP: c.47.1.0 Back     alignment and structure
>2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A Back     alignment and structure
>3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A Back     alignment and structure
>2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 Back     alignment and structure
>2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} Back     alignment and structure
>2qsi_A Putative hydrogenase expression/formation protein; HUPG, MCS SAD, structural genomics, protein structure initiative; 1.80A {Rhodopseudomonas palustris} Back     alignment and structure
>1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 Back     alignment and structure
>3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii} Back     alignment and structure
>2qgv_A Hydrogenase-1 operon protein HYAE; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Shigella flexneri 2A} PDB: 2hfd_A Back     alignment and structure
>1z6n_A Hypothetical protein PA1234; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.47.1.1 PDB: 3lef_A Back     alignment and structure
>2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A Back     alignment and structure
>1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} Back     alignment and structure
>1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2b1k_A Thiol:disulfide interchange protein DSBE; C-terminal thioredoxin-like domain, N-terminal beta-sheet, fingerprint rigion, oxidoreductase; 1.90A {Escherichia coli} PDB: 3k8n_A 2g0f_A 1z5y_E 2b1l_A Back     alignment and structure
>1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} Back     alignment and structure
>3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis} Back     alignment and structure
>2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A Back     alignment and structure
>3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B} Back     alignment and structure
>4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae} Back     alignment and structure
>1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 Back     alignment and structure
>3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} SCOP: c.47.1.0 Back     alignment and structure
>2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Back     alignment and structure
>1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 Back     alignment and structure
>1wou_A Thioredoxin -related protein, 14 kDa; electron transport; 1.80A {Homo sapiens} SCOP: c.47.1.16 PDB: 1v9w_A Back     alignment and structure
>1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A Back     alignment and structure
>2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A Back     alignment and structure
>2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} Back     alignment and structure
>3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} SCOP: c.47.1.0 Back     alignment and structure
>3kh7_A Thiol:disulfide interchange protein DSBE; TRX-like, thiol-disulfide exchange, cell inner membrane, CYT C-type biogenesis, disulfide bond; 1.75A {Pseudomonas aeruginosa} PDB: 3kh9_A Back     alignment and structure
>3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} Back     alignment and structure
>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Back     alignment and structure
>3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} Back     alignment and structure
>1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>2h30_A Thioredoxin, peptide methionine sulfoxide reductase MSRA/MSRB; reduced, thiol-disulfide exchange, oxidoreductase; 1.60A {Neisseria gonorrhoeae} PDB: 2jzr_A 2jzs_A 2k9f_A 2fy6_A Back     alignment and structure
>3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15} Back     alignment and structure
>3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15} Back     alignment and structure
>3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix} Back     alignment and structure
>3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP} Back     alignment and structure
>3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis} Back     alignment and structure
>3eyt_A Uncharacterized protein SPOA0173; thioredoxin-like superfamily protein SPOA0173, silicibacter DSS, structural genomics, PSI-2; 1.95A {Silicibacter pomeroyi} Back     alignment and structure
>3lor_A Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, structural genomics, midwest CE structural genomics; HET: MSE; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1i5g_A Tryparedoxin II; electron transport; HET: TS5; 1.40A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1o6j_A 1o81_A 1oc8_A 1oc9_B 1fg4_A 1oc9_A Back     alignment and structure
>3s9f_A Tryparedoxin; thioredoxin fold, disulfide reductase, electron transport; 1.80A {Leishmania major} Back     alignment and structure
>2ls5_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, NEW structural genomics research consortium; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Back     alignment and structure
>3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} Back     alignment and structure
>1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A Back     alignment and structure
>2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3lwa_A Secreted thiol-disulfide isomerase; thioredoxin, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.75A {Corynebacterium glutamicum} Back     alignment and structure
>1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10 Back     alignment and structure
>3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1 Back     alignment and structure
>3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, thiol-disulfide oxidoreduct TLPA-like family, PSI-2; 1.74A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus} Back     alignment and structure
>3iv4_A Putative oxidoreductase; APC23140, meticillin-resistant staphylococcus aureus, oxidor thioredoxin fold, structural genomics, PSI-2; HET: MSE; 1.50A {Staphylococcus aureus subsp} Back     alignment and structure
>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Back     alignment and structure
>2lus_A Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carcinoscorpius rotundicauda} Back     alignment and structure
>3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} Back     alignment and structure
>4fo5_A Thioredoxin-like protein; AHPC/TSA family protein, structural genomics, joint center F structural genomics, JCSG; 2.02A {Parabacteroides distasonis} Back     alignment and structure
>2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} Back     alignment and structure
>1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Back     alignment and structure
>3h7l_A Endoglucanase; dehydrogenase, PSI-2, NYSGXRC, structural GEN protein structure initiative; 2.30A {Vibrio parahaemolyticus} Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Back     alignment and structure
>2cvb_A Probable thiol-disulfide isomerase/thioredoxin; redox protein, structural genomics, riken struc genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.47.1.10 PDB: 2ywo_A Back     alignment and structure
>1jfu_A Thiol:disulfide interchange protein TLPA; thioredoxin-like, double disulfide bridge, membrane protein; 1.60A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>3ga4_A Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit OST6; oxidoreductase, active site loop, redox state, membrane; HET: PG4; 1.30A {Saccharomyces cerevisiae} PDB: 3g7y_A 3g9b_A* Back     alignment and structure
>1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A Back     alignment and structure
>2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A Back     alignment and structure
>2ywi_A Hypothetical conserved protein; uncharacterized conserved protein, NPPSFA, national project protein structural and functional analyses; 1.60A {Geobacillus kaustophilus} Back     alignment and structure
>1a0r_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; HET: FAR; 2.80A {Bos taurus} SCOP: c.47.1.6 PDB: 1b9y_C 1b9x_C Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Back     alignment and structure
>2rli_A SCO2 protein homolog, mitochondrial; copper protein, thioredoxin fold, metal transport, structural genomics, spine2-complexes; NMR {Homo sapiens} Back     alignment and structure
>3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* Back     alignment and structure
>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Back     alignment and structure
>3qcp_A QSOX from trypanosoma brucei (tbqsox); ERV fold, thioredoxin fold, sulfhydryl oxidase, oxidoreducta; HET: FAD; 2.30A {Trypanosoma brucei} PDB: 3qd9_A* Back     alignment and structure
>2hyx_A Protein DIPZ; thioredoxin fold, jelly-roll, structural genomics, TB struct genomics consortium, TBSGC, unknown function; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Back     alignment and structure
>2vup_A Glutathione peroxidase-like protein; oxidoreductase, trypanothione, dithiol-dependant peroxidase; 2.10A {Trypanosoma brucei} Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>3drn_A Peroxiredoxin, bacterioferritin comigratory prote homolog; bacterioferritin comigratory protein, oxidore; HET: CIT; 2.15A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3v1w_A* 3trq_A* 3trp_A* 3uom_A Back     alignment and structure
>2ggt_A SCO1 protein homolog, mitochondrial; copper chaperone, Cu-binding protein, mitochondrial assembly factor, redox, nickel, disuplhide, mitochondrion; 2.40A {Homo sapiens} SCOP: c.47.1.10 PDB: 2gqk_A 2gql_A 2gqm_A 2gt5_A 2gt6_A 2gvp_A 2hrf_A 2hrn_A 1wp0_A Back     alignment and structure
>3u5r_E Uncharacterized protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, hypothetical protein; 2.05A {Sinorhizobium meliloti} Back     alignment and structure
>2p5q_A Glutathione peroxidase 5; thioredoxin fold, oxidoreductase; 2.00A {Populus trichocarpa x populusdeltoides} PDB: 2p5r_A Back     alignment and structure
>3cmi_A Peroxiredoxin HYR1; thioredoxin-like fold, oxidoreductase, peroxidase, redox-ACT center; 2.02A {Saccharomyces cerevisiae} Back     alignment and structure
>2trc_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; 2.40A {Rattus norvegicus} SCOP: c.47.1.6 Back     alignment and structure
>3evi_A Phosducin-like protein 2; alpha beta, 3-layer(ABA) sandwich, unknown function; 2.70A {Homo sapiens} Back     alignment and structure
>2djk_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp2_A Back     alignment and structure
>3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>2v1m_A Glutathione peroxidase; selenium, selenocysteine, oxidoreductase, lipid peroxidase, schistosoma detoxification pathway; 1.00A {Schistosoma mansoni} PDB: 2wgr_A Back     alignment and structure
>1xvw_A Hypothetical protein RV2238C/MT2298; thioredoxin fold, oxidized cystein sulfenic acid, structural genomics, PSI; 1.90A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1xxu_A Back     alignment and structure
>3kij_A Probable glutathione peroxidase 8; human PDI-peroxidase, membrane, oxidoreductase, transmembrane; 1.80A {Homo sapiens} SCOP: c.47.1.0 PDB: 3cyn_A Back     alignment and structure
>2bmx_A Alkyl hydroperoxidase C; peroxiredoxin, antioxidant defense system, oxidoreductase, structural proteomics in EURO spine; 2.4A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>2k6v_A Putative cytochrome C oxidase assembly protein; thioredoxin fold, electron transfer protein, metal binding protein, electron transport; NMR {Thermus thermophilus} Back     alignment and structure
>3dwv_A Glutathione peroxidase-like protein; alpha beta, 3-layer(ABA) sandwich, glutaredoxin fold, oxidor peroxidase; 1.41A {Trypanosoma brucei} PDB: 2rm5_A 2rm6_A 3e0u_A Back     alignment and structure
>1we0_A Alkyl hydroperoxide reductase C; peroxiredoxin, AHPC, oxidoreductase; 2.90A {Amphibacillus xylanus} SCOP: c.47.1.10 Back     alignment and structure
>2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea} Back     alignment and structure
>2f8a_A Glutathione peroxidase 1; thioredoxin fold, structural genomics, structural genomics consortium, SGC, oxidoreductase; 1.50A {Homo sapiens} SCOP: c.47.1.10 PDB: 1gp1_A 2he3_A Back     alignment and structure
>2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} Back     alignment and structure
>2p31_A CL683, glutathione peroxidase 7; thioredoxin fold, NPGPX, phospholipid hydroperoxidase, struc genomics, structural genomics consortium, SGC; 2.00A {Homo sapiens} Back     alignment and structure
>2jsy_A Probable thiol peroxidase; solution structure, antioxidant, oxidoreductase; NMR {Bacillus subtilis} PDB: 2jsz_A Back     alignment and structure
>1zof_A Alkyl hydroperoxide-reductase; decamer, toroide-shaped complex, oxidoreductase; 2.95A {Helicobacter pylori} SCOP: c.47.1.10 Back     alignment and structure
>1xvq_A Thiol peroxidase; thioredoxin fold, structural genomics, PSI, protein structur initiative, TB structural genomics consortium, TBSGC; 1.75A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1y25_A Back     alignment and structure
>3e6u_A LANC-like protein 1; alpha barrel, cytoplasm, signaling protein; 2.60A {Homo sapiens} PDB: 3e73_A* Back     alignment and structure
>2obi_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase (GPX4); human GPX4, selenoprotein, thioredoxin-fold, anti-oxidatve defense system; 1.55A {Homo sapiens} Back     alignment and structure
>1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>1zye_A Thioredoxin-dependent peroxide reductase; catenane, dodecamer, peroxiredoxin, oxidoreductase; 3.30A {Bos taurus} SCOP: c.47.1.10 Back     alignment and structure
>2h01_A 2-Cys peroxiredoxin; thioredoxin peroxidase, structural genomics, SGC, structural genomics consortium, oxidoreductase; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 Back     alignment and structure
>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Back     alignment and structure
>2gs3_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase; GSHPX-4,phospholipid hydroperoxide; 1.90A {Homo sapiens} Back     alignment and structure
>1uul_A Tryparedoxin peroxidase homologue; peroxiredoxin, oxidoreductase; 2.8A {Trypanosoma cruzi} SCOP: c.47.1.10 Back     alignment and structure
>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Back     alignment and structure
>3kp9_A Vkorc1/thioredoxin domain protein; warfarin, disulfide formation, blood coagulation, oxidoreduc blood coagulation,oxidoreductase; HET: U10; 3.60A {Synechococcus SP} Back     alignment and structure
>2c0g_A ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, protein disulfide isomerase, PIPE, dorsal-ventral patterning, chaperone, WIND mutants; 1.75A {Drosophila melanogaster} SCOP: a.71.1.1 c.47.1.7 PDB: 1ovn_A 2c0f_A 2c1y_A 2c0e_A Back     alignment and structure
>1xzo_A BSSCO, hypothetical protein YPMQ; thioredoxin-like fold, structural genomics, montreal-kingsto bacterial structural genomics initiative, BSGI; 1.70A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1on4_A Back     alignment and structure
>3ztl_A Thioredoxin peroxidase; oxidoreductase, reductase, schistosomiasis, thioredoxin fold; 3.00A {Schistosoma mansoni} PDB: 3zvj_A 3zvj_D Back     alignment and structure
>3gkn_A Bacterioferritin comigratory protein; BCP, PRX, atypical 2-Cys, oxidoreduc; HET: BIH; 1.47A {Xanthomonas campestris PV} PDB: 3gkk_A 3gkm_A Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>1eej_A Thiol:disulfide interchange protein; oxidoreductase, protein disulfide isomerase, protein folding, redox protein, redox-active center; HET: MES; 1.90A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1tjd_A 1jzd_A 1jzo_A 1g0t_A 2iyj_A Back     alignment and structure
>2v8i_A Pectate lyase; periplasm, beta-elimination, pectin degradation; 1.50A {Yersinia enterocolitica} PDB: 2v8k_A* 2v8j_A Back     alignment and structure
>2i81_A 2-Cys peroxiredoxin; structural genomics consortium, SGC, oxidoreductase; 2.45A {Plasmodium vivax sai-1} PDB: 2h66_A Back     alignment and structure
>3gzk_A Cellulase; fold from GH9 from CAZY database, glycosidase, hydrolase; 1.80A {Alicyclobacillus acidocaldarius subsp} PDB: 3ez8_A 3h2w_A* 3h3k_A* 3rx5_A* 3rx7_A* 3rx8_A* Back     alignment and structure
>2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* Back     alignment and structure
>4gqc_A Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, fully folded, locally unfolded, peroxide, DTT, structural genomics, riken; 2.00A {Aeropyrum pernix} PDB: 2cx3_A 2cx4_A 4gqf_A Back     alignment and structure
>2b7k_A SCO1 protein; metallochaperone, cytochrome C oxidase, metal binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 PDB: 2b7j_A Back     alignment and structure
>2qc7_A ERP31, ERP28, endoplasmic reticulum protein ERP29; B domain (residues 33-153), D domain (residues 154-261), CHA; 2.90A {Homo sapiens} PDB: 1g7e_A 1g7d_A Back     alignment and structure
>2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4hde_A SCO1/SENC family lipoprotein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; HET: MSE; 1.32A {Bacillus anthracis} Back     alignment and structure
>1t3b_A Thiol:disulfide interchange protein DSBC; oxidoreductase, protein disulfide isomerase, protein folding, redox protein; 2.50A {Haemophilus influenzae} SCOP: c.47.1.9 d.17.3.1 Back     alignment and structure
>3hd5_A Thiol:disulfide interchange protein DSBA; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.35A {Bordetella parapertussis} Back     alignment and structure
>1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A Back     alignment and structure
>2c0d_A Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, thioredoxin dependant, mitochondrial, antioxidant, oxidoreductase, redox-active center; 1.78A {Plasmodium falciparum} Back     alignment and structure
>4g2e_A Peroxiredoxin; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 1.40A {Sulfolobus tokodaii} PDB: 2ywn_A 3hjp_A Back     alignment and structure
>1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* Back     alignment and structure
>3gyk_A 27KDA outer membrane protein; APC61738.2, silicibacter pomeroyi DSS-3, thioredoxin-like, oxidoreductase, structural genomics, PSI-2; HET: MSE; 1.76A {Silicibacter pomeroyi} Back     alignment and structure
>3p7x_A Probable thiol peroxidase; thioredoxin fold, oxidoreductase; HET: PG4; 1.96A {Staphylococcus aureus} SCOP: c.47.1.0 Back     alignment and structure
>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Back     alignment and structure
>1v58_A Thiol:disulfide interchange protein DSBG; reduced DSBG, redox protein, protein disulfide isomerase, thioredoxin fold; 1.70A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1v57_A 2h0i_A 2h0h_A 2h0g_A 2iy2_A Back     alignment and structure
>1ks8_A Endo-B-1,4-glucanase; cellulase, endoglucanase, termite, glycosyl hydrolase, family 9, (alpha/alpha)6; 1.40A {Nasutitermes takasagoensis} SCOP: a.102.1.2 PDB: 1ksc_A 1ksd_A Back     alignment and structure
>1clc_A Endoglucanase CELD; EC: 3.2.1.4; cellulase, glycosyl hydrolase; 1.90A {Clostridium thermocellum} SCOP: a.102.1.2 b.1.18.2 Back     alignment and structure
>1psq_A Probable thiol peroxidase; structural genomics, NYSGXRC, PSI, structure initiative, NEW YORK SGX research center for STRU genomics; 2.30A {Streptococcus pneumoniae} SCOP: c.47.1.10 Back     alignment and structure
>3ixr_A Bacterioferritin comigratory protein; alpha beta protein, oxidoreductase; 1.60A {Xylella fastidiosa} Back     alignment and structure
>3h93_A Thiol:disulfide interchange protein DSBA; disulfide bond, redox-active center, transcription regulator; HET: MSE GOL; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: c.47.1.0 Back     alignment and structure
>1ia6_A Cellulase CEL9M; cellullase, alpha barrel, hydrolase; 1.80A {Clostridium cellulolyticum} SCOP: a.102.1.2 PDB: 1ia7_A* Back     alignment and structure
>3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* Back     alignment and structure
>2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B Back     alignment and structure
>1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* Back     alignment and structure
>3a2v_A Probable peroxiredoxin; thioredoxin peroxidase, hydrogen peroxide, antioxidant, oxidoreductase, redox-active center; 1.65A {Aeropyrum pernix} PDB: 1x0r_A 2zct_A 2nvl_A 2e2g_A 2cv4_A* 3a5w_A 2e2m_A 3a2x_A 3a2w_A Back     alignment and structure
>2yzh_A Probable thiol peroxidase; redox protein, antioxidant, oxidoreductase, STRU genomics, NPPSFA; 1.85A {Aquifex aeolicus} Back     alignment and structure
>3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* Back     alignment and structure
>2pn8_A Peroxiredoxin-4; thioredoxin, oxidoreductase, structural genomics consortium, SGC; 1.80A {Homo sapiens} Back     alignment and structure
>3qpm_A Peroxiredoxin; oxidoreductase, thioredoxin fold, peroxidase; 1.90A {Larimichthys crocea} Back     alignment and structure
>3me7_A Putative uncharacterized protein; electron transfer protein, electron transport, structural GE PSI-2, protein structure initiative; 1.50A {Aquifex aeolicus} PDB: 3me8_A Back     alignment and structure
>2r37_A Glutathione peroxidase 3; plasma, structural genomics consort oxidoreductase, secreted, selenium, selenocysteine; 1.85A {Homo sapiens} Back     alignment and structure
>2i3y_A Epididymal secretory glutathione peroxidase; thioredoxin fold, epididymal androgen related protein, struc genomics, structural genomics consortium; 2.00A {Homo sapiens} Back     alignment and structure
>3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} Back     alignment and structure
>2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0 Back     alignment and structure
>2a4v_A Peroxiredoxin DOT5; yeast nuclear thiol peroxidase, atypical 2-Cys peroxiredoxin, oxidoreductase; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 Back     alignment and structure
>1n8j_A AHPC, alkyl hydroperoxide reductase C22 protein; peroxiredoxin, decamer, antioxidant, peroxidase, AHPF, oxidoreductase; 2.17A {Salmonella typhimurium} SCOP: c.47.1.10 PDB: 1yep_A 1yf1_A 1yf0_A 1yex_A 3emp_A Back     alignment and structure
>3keb_A Probable thiol peroxidase; structural genomics, APC40679, PSI-2, Pro structure initiative; HET: MSE; 1.80A {Chromobacterium violaceum} Back     alignment and structure
>2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} Back     alignment and structure
>1g87_A Endocellulase 9G; endoglucanase, cellulose binding domain, (ALPH 6-helix barrel, beta barrel, hydrolase; 1.60A {Clostridium cellulolyticum} SCOP: a.102.1.2 b.2.2.2 PDB: 1ga2_A* 1k72_A* 1kfg_A* Back     alignment and structure
>1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* Back     alignment and structure
>3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A Back     alignment and structure
>3hz8_A Thiol:disulfide interchange protein DSBA; thiol-oxidoreductase, disulfide bond; 1.45A {Neisseria meningitidis MC58} PDB: 3dvw_A 3a3t_A Back     alignment and structure
>2ri9_A Mannosyl-oligosaccharide alpha-1,2-mannosidase; alternative conformations, modulation of activity, glycoprot glycosidase, hydrolase; HET: NAG NDG MAN MMA; 1.95A {Penicillium citrinum} SCOP: a.102.2.1 PDB: 2ri8_A* 1kkt_A* 1kre_A* 1krf_A* Back     alignment and structure
>1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 Back     alignment and structure
>1q98_A Thiol peroxidase, TPX; structural genomics, NYSGXRC, PSI, protein structure initiative; 1.90A {Haemophilus influenzae} SCOP: c.47.1.10 Back     alignment and structure
>3tjj_A Peroxiredoxin-4; thioredoxin fold, sulfenylation, endoplasmic reticulum, oxidoreductase; HET: CSO; 1.91A {Homo sapiens} PDB: 3tjk_A 3tjb_A 3tjf_A 3tjg_A 3tkq_A 3tkp_A 3tks_A 3tkr_A 3tks_C Back     alignment and structure
>3zrd_A Thiol peroxidase; oxidoreductase, 2Cys peroxiredoxin, thioredoxin-fold, ROS PR; 1.74A {Yersinia pseudotuberculosis} PDB: 2xpe_A 2xpd_A 3zre_A 2yjh_A 4af2_A 3hvs_A* 1qxh_A* 3i43_A* 3hvv_A 3hvx_A Back     alignment and structure
>2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} Back     alignment and structure
>1tf4_A T. fusca endo/EXO-cellulase E4 catalytic domain and cellulose-binding domain; glycosyl hydrolase, cellulose degradation; 1.90A {Thermobifida fusca} SCOP: a.102.1.2 b.2.2.2 PDB: 1js4_A 3tf4_A* 4tf4_A* Back     alignment and structure
>1hcu_A Alpha-1,2-mannosidase; glycosylation, glycosyl hydrolase; HET: NAG; 2.37A {Trichoderma reesei} SCOP: a.102.2.1 Back     alignment and structure
>3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* Back     alignment and structure
>2rem_A Disulfide oxidoreductase; disulfide oxidoreductase, DSBA, thioredoxin fold, redox- active center; 1.90A {Xylella fastidiosa} Back     alignment and structure
>3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1x9d_A Endoplasmic reticulum mannosyl-oligosaccharide 1, 2-alpha-mannosidase; substrate analogue, glycosyl hydrolase; HET: SMD; 1.41A {Homo sapiens} SCOP: a.102.2.1 PDB: 1fo3_A* 1fo2_A* 1fmi_A Back     alignment and structure
>2g0d_A Nisin biosynthesis protein NISC; alpha toroid, alpha barrel, biosynthetic protein; 2.21A {Lactococcus lactis subsp} SCOP: a.102.6.1 PDB: 2g02_A Back     alignment and structure
>2znm_A Thiol:disulfide interchange protein DSBA; thioredoxin fold, DSBA-like, oxidoreductase; 2.30A {Neisseria meningitidis serogroup B} PDB: 3dvx_A Back     alignment and structure
>3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 Back     alignment and structure
>1nxc_A Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA; glycosidase, structural genomics, PSI, protein initiative; HET: NAG BMA MAN; 1.51A {Mus musculus} SCOP: a.102.2.1 Back     alignment and structure
>2yik_A Endoglucanase; hydrolase; 2.10A {Clostridium thermocellum} Back     alignment and structure
>3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} Back     alignment and structure
>1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>1dl2_A Class I alpha-1,2-mannosidase; alpha-alpha helix barrel, hydrolase; HET: NAG NDG BMA MAN; 1.54A {Saccharomyces cerevisiae} SCOP: a.102.2.1 PDB: 1g6i_A* Back     alignment and structure
>2xfg_A Endoglucanase 1; hydrolase-sugar binding protein complex, family-9 glycoside hydrolase, hydrolase, sugar binding protein; 1.68A {Clostridium thermocellum} Back     alignment and structure
>2ri9_A Mannosyl-oligosaccharide alpha-1,2-mannosidase; alternative conformations, modulation of activity, glycoprot glycosidase, hydrolase; HET: NAG NDG MAN MMA; 1.95A {Penicillium citrinum} SCOP: a.102.2.1 PDB: 2ri8_A* 1kkt_A* 1kre_A* 1krf_A* Back     alignment and structure
>4eo3_A Bacterioferritin comigratory protein/NADH dehydro; thioredoxin-fold, alpha-beta-aplha sandwich fold, antioxidan oxidoreductase, FMN binding; HET: FMN; 1.65A {Thermotoga maritima} Back     alignment and structure
>2v2g_A Peroxiredoxin 6; oxidoreductase, antioxidant enzymes; 1.60A {Arenicola marina} PDB: 2v32_A 2v41_A Back     alignment and structure
>3gv1_A Disulfide interchange protein; neisseria gonorrhoeae (strain 700825 / FA 1090), DSBC, structural genomics, unknown funct 2; 2.00A {Neisseria gonorrhoeae} Back     alignment and structure
>1hcu_A Alpha-1,2-mannosidase; glycosylation, glycosyl hydrolase; HET: NAG; 2.37A {Trichoderma reesei} SCOP: a.102.2.1 Back     alignment and structure
>1prx_A HORF6; peroxiredoxin, hydrogen peroxide, redox regulation, cellular signaling, antioxidant; 2.00A {Homo sapiens} SCOP: c.47.1.10 Back     alignment and structure
>1un2_A DSBA, thiol-disulfide interchange protein; disulfide oxidoreductase, oxidoreductase, protein disulfide isomerase, protein folding, thioredoxin; 2.4A {Escherichia coli} SCOP: c.47.1.13 Back     alignment and structure
>1tp9_A Peroxiredoxin, PRX D (type II); oligomer, thioredoxin fold, oxidoreductase; 1.62A {Populus trichocarpa} SCOP: c.47.1.10 Back     alignment and structure
>1nxc_A Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA; glycosidase, structural genomics, PSI, protein initiative; HET: NAG BMA MAN; 1.51A {Mus musculus} SCOP: a.102.2.1 Back     alignment and structure
>1dl2_A Class I alpha-1,2-mannosidase; alpha-alpha helix barrel, hydrolase; HET: NAG NDG BMA MAN; 1.54A {Saccharomyces cerevisiae} SCOP: a.102.2.1 PDB: 1g6i_A* Back     alignment and structure
>2wfc_A Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidant enzymes; 1.75A {Arenicola marina} Back     alignment and structure
>1z6m_A Conserved hypothetical protein; structural genomics, MCSG,, protein structure initiative, midwest center for structural genomics; HET: MSE; 1.30A {Enterococcus faecalis} SCOP: c.47.1.13 Back     alignment and structure
>1x9d_A Endoplasmic reticulum mannosyl-oligosaccharide 1, 2-alpha-mannosidase; substrate analogue, glycosyl hydrolase; HET: SMD; 1.41A {Homo sapiens} SCOP: a.102.2.1 PDB: 1fo3_A* 1fo2_A* 1fmi_A Back     alignment and structure
>1xcc_A 1-Cys peroxiredoxin; unknown function, structural genomics, structural genomics consortium, SGC; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 PDB: 3tb2_A Back     alignment and structure
>1ia6_A Cellulase CEL9M; cellullase, alpha barrel, hydrolase; 1.80A {Clostridium cellulolyticum} SCOP: a.102.1.2 PDB: 1ia7_A* Back     alignment and structure
>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 Back     alignment and structure
>3uma_A Hypothetical peroxiredoxin protein; nysgrc, PSI biology, structural genomics, NEW YORK structura genomics research consortium; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2v8i_A Pectate lyase; periplasm, beta-elimination, pectin degradation; 1.50A {Yersinia enterocolitica} PDB: 2v8k_A* 2v8j_A Back     alignment and structure
>2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A Back     alignment and structure
>3e6u_A LANC-like protein 1; alpha barrel, cytoplasm, signaling protein; 2.60A {Homo sapiens} PDB: 3e73_A* Back     alignment and structure
>3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A Back     alignment and structure
>1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A Back     alignment and structure
>4dvc_A Thiol:disulfide interchange protein DSBA; pilus assembly, oxidoreductase, thioredoxin fold, D disulfide bond, DSBB; HET: DMS; 1.20A {Vibrio cholerae} PDB: 2ijy_A 1bed_A Back     alignment and structure
>2xfg_A Endoglucanase 1; hydrolase-sugar binding protein complex, family-9 glycoside hydrolase, hydrolase, sugar binding protein; 1.68A {Clostridium thermocellum} Back     alignment and structure
>3gzk_A Cellulase; fold from GH9 from CAZY database, glycosidase, hydrolase; 1.80A {Alicyclobacillus acidocaldarius subsp} PDB: 3ez8_A 3h2w_A* 3h3k_A* 3rx5_A* 3rx7_A* 3rx8_A* Back     alignment and structure
>3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} Back     alignment and structure
>3mng_A Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, substrate analog, DTT, oxidoreductase; 1.45A {Homo sapiens} SCOP: c.47.1.10 PDB: 2vl3_A 1oc3_A 2vl2_A 2vl9_A 1urm_A 1hd2_A 1h4o_A Back     alignment and structure
>1ks8_A Endo-B-1,4-glucanase; cellulase, endoglucanase, termite, glycosyl hydrolase, family 9, (alpha/alpha)6; 1.40A {Nasutitermes takasagoensis} SCOP: a.102.1.2 PDB: 1ksc_A 1ksd_A Back     alignment and structure
>3sbc_A Peroxiredoxin TSA1; alpha-beta fold, peroxidase, cytosol, oxidoreductase; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 Back     alignment and structure
>3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae} Back     alignment and structure
>2pwj_A Mitochondrial peroxiredoxin; alpha and beta protein, oxidoreductase; 2.80A {Pisum sativum} Back     alignment and structure
>3l9v_A Putative thiol-disulfide isomerase or thioredoxin; thioredoxin-fold, SRGA, thiol-disulfide oxidoreductase, ISOM oxidoreductase; HET: PE8 P4C P6G; 2.15A {Salmonella enterica subsp} SCOP: c.47.1.0 Back     alignment and structure
>1w6k_A Lanosterol synthase; cyclase, cholesterol, monotopic membrane protein, B-octyl-glucoside, isomerase, steroid biosynthesis; HET: BOG LAN; 2.1A {Homo sapiens} SCOP: a.102.4.2 a.102.4.2 PDB: 1w6j_A* Back     alignment and structure
>1wzz_A Probable endoglucanase; glycoside hydrolase family 8 (GH-8), (alpha/alpha)6 barrel, structural genomics; 1.65A {Gluconacetobacter xylinus} SCOP: a.102.1.2 Back     alignment and structure
>3tue_A Tryparedoxin peroxidase; thioredoxin fold, peroxiredoxin, oxidoreductase; 3.00A {Leishmania major} PDB: 1e2y_A Back     alignment and structure
>2g0d_A Nisin biosynthesis protein NISC; alpha toroid, alpha barrel, biosynthetic protein; 2.21A {Lactococcus lactis subsp} SCOP: a.102.6.1 PDB: 2g02_A Back     alignment and structure
>2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g87_A Endocellulase 9G; endoglucanase, cellulose binding domain, (ALPH 6-helix barrel, beta barrel, hydrolase; 1.60A {Clostridium cellulolyticum} SCOP: a.102.1.2 b.2.2.2 PDB: 1ga2_A* 1k72_A* 1kfg_A* Back     alignment and structure
>3feu_A Putative lipoprotein; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Vibrio fischeri} SCOP: c.47.1.0 Back     alignment and structure
>4f9z_D Endoplasmic reticulum resident protein 27; thioredoxin fold, ER foldase, ERP57, binding protein; HET: PE3 PE4; 2.20A {Homo sapiens} PDB: 2l4c_A Back     alignment and structure
>1ut9_A Cellulose 1,4-beta-cellobiosidase; hydrolase, glycoside hydrolase, family 9, cellobiohydrolase; 2.1A {Clostridium thermocellum} SCOP: a.102.1.2 b.1.18.2 PDB: 1rq5_A* Back     alignment and structure
>3f4s_A Alpha-DSBA1, putative uncharacterized protein; thioredoxin-fold, oxidoreductase; HET: PGE; 1.55A {Wolbachia pipientis} PDB: 3f4r_A* 3f4t_A* Back     alignment and structure
>1ut9_A Cellulose 1,4-beta-cellobiosidase; hydrolase, glycoside hydrolase, family 9, cellobiohydrolase; 2.1A {Clostridium thermocellum} SCOP: a.102.1.2 b.1.18.2 PDB: 1rq5_A* Back     alignment and structure
>1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A Back     alignment and structure
>1clc_A Endoglucanase CELD; EC: 3.2.1.4; cellulase, glycosyl hydrolase; 1.90A {Clostridium thermocellum} SCOP: a.102.1.2 b.1.18.2 Back     alignment and structure
>2wul_A Glutaredoxin related protein 5; chromosome 14 open reading frame 87, oxidoreductase, thiored family, GLRX5, FLB4739; HET: GSH; 2.40A {Homo sapiens} Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 725
d1fp3a_402 a.102.1.3 (A:) N-acyl-D-glucosamine 2-epimerase {P 2e-31
d1sena_135 c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 9e-21
d2afaa1411 a.102.1.3 (A:4-415) Putative NAG isomerase YihS {S 2e-16
d2dlxa1147 c.47.1.24 (A:1-147) UBX domain-containing protein 9e-13
d2c42a1257 c.36.1.8 (A:2-258) Pyruvate-ferredoxin oxidoreduct 1e-04
>d1fp3a_ a.102.1.3 (A:) N-acyl-D-glucosamine 2-epimerase {Pig (Sus scrofa) [TaxId: 9823]} Length = 402 Back     information, alignment and structure

class: All alpha proteins
fold: alpha/alpha toroid
superfamily: Six-hairpin glycosidases
family: N-acylglucosamine (NAG) epimerase
domain: N-acyl-D-glucosamine 2-epimerase
species: Pig (Sus scrofa) [TaxId: 9823]
 Score =  124 bits (313), Expect = 2e-31
 Identities = 44/403 (10%), Positives = 93/403 (23%), Gaps = 71/403 (17%)

Query: 292 LSKSYDSRFGGF-------GSAPKFPRPVEIQM-MLYHSKKLEDTGKSGEASEGQKMVLF 343
           L  S+D   GGF       G      + V +Q   ++   +L    +     E       
Sbjct: 27  LEHSHDREHGGFFTCLGRDGRVYDDLKYVWLQGRQVWMYCRLYRKLERFHRPELLDAAKA 86

Query: 344 TLQCMAKGGIHDHVGGGFHRYSVDERWHVPHFEKMLYDQGQLANVYLDAFSLTKDVFYSY 403
             + + +             + +         ++ ++ +        + + +T +  Y  
Sbjct: 87  GGEFLLRHARVAPPEKKCA-FVLTRDGRPVKVQRSIFSECFYTMAMNELWRVTAEARYQS 145

Query: 404 ICRDILDYLRRDMIGPGGEIFSAEDADSAETEGATRKKEGAFYVWTSKEVEDILGEHAIL 463
              D++D +   +      +   +   +          E          + + LGE    
Sbjct: 146 EAVDMMDQIVHWVREDPSGLGRPQLPGA-------VASESMAVPMMLLCLVEQLGEEDEE 198

Query: 464 FKEHYYLKPTGNCDLSRMSDPHNEFKGKNVLIELNDSSASASKLGMPLEKYLNILGECRR 523
               Y     G+    R+                                          
Sbjct: 199 LAGRY--AQLGHWCARRILQHVQRDGQ-------------------------------AV 225

Query: 524 KLFDVRSKRPRPHLDDKVIVSWNGLVISSFARASKILKSEAESAMFNFPVVGSDRKEYME 583
                           +     + L    F              +        D K    
Sbjct: 226 LENVSEDGEELSGCLGRHQNPGHALEAGWF--------------LLRHSSRSGDAKLRAH 271

Query: 584 VAESAASFIRRHLYDEQTHRLQHSFRNGPSKAPGFLDD-------YAFLISGLLDLYEFG 636
           V ++      R  +D   H     F++     P  L+        ++  +   L  Y   
Sbjct: 272 VIDTFLLLPFRSGWDAD-HGGLFYFQDADGLCPTQLEWAMKLWWPHSEAMIAFLMGYSES 330

Query: 637 SGTKWLVWAIELQNTQDELFLDREGGGYFNTTGEDPSVLLRVK 679
                L    ++       F D E G +F     +  V L +K
Sbjct: 331 GDPALLRLFYQVAEYTFRQFRDPEYGEWFGYLNREGKVALTIK 373


>d1sena_ c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 {Human (Homo sapiens) [TaxId: 9606]} Length = 135 Back     information, alignment and structure
>d2afaa1 a.102.1.3 (A:4-415) Putative NAG isomerase YihS {Salmonella typhimurium [TaxId: 90371]} Length = 411 Back     information, alignment and structure
>d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} Length = 147 Back     information, alignment and structure
>d2c42a1 c.36.1.8 (A:2-258) Pyruvate-ferredoxin oxidoreductase, PFOR, domain I {Desulfovibrio africanus [TaxId: 873]} Length = 257 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query725
d1fp3a_402 N-acyl-D-glucosamine 2-epimerase {Pig (Sus scrofa) 100.0
d2afaa1411 Putative NAG isomerase YihS {Salmonella typhimuriu 99.96
d2dlxa1147 UBX domain-containing protein 7 {Human (Homo sapie 99.84
d1sena_135 Thioredoxin-like protein p19, TLP19 {Human (Homo s 99.82
d1fp3a_402 N-acyl-D-glucosamine 2-epimerase {Pig (Sus scrofa) 99.79
d2fwha1117 Thiol:disulfide interchange protein DsbD, C-termin 99.66
d2afaa1411 Putative NAG isomerase YihS {Salmonella typhimuriu 99.51
d2d5ja1377 Unsaturated glucuronyl hydrolase {Bacillus sp. GL1 99.32
d1ep7a_112 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 99.3
d1xfla_114 Thioredoxin {Thale cress (Arabidopsis thaliana) [T 99.26
d1dbya_107 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 99.24
d1ti3a_113 Thioredoxin {European aspen (Populus tremula), thi 99.22
d1qgva_137 spliceosomal protein U5-15Kd {Human (Homo sapiens) 99.19
d2trxa_108 Thioredoxin {Escherichia coli [TaxId: 562]} 99.19
d1nw2a_105 Thioredoxin {Alicyclobacillus acidocaldarius, form 99.18
d1thxa_108 Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} 99.13
d1fb6a_104 Thioredoxin {Spinach (Spinacia oleracea), thioredo 99.1
d2ifqa1105 Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} 99.07
d1xwaa_111 Thioredoxin {Fruit fly (Drosophila melanogaster) [ 99.06
d1a8la2107 Protein disulfide isomerase, PDI {Archaeon Pyrococ 99.0
d1r26a_113 Thioredoxin {Trypanosoma brucei [TaxId: 5691]} 98.98
d1syra_103 Thioredoxin {Malarial parasite (Plasmodium falcipa 98.98
d1z5ye1136 Thioredoxin-like protein CcmG (CycY, DsbE) {Escher 98.96
d1meka_120 Protein disulfide isomerase, PDI {Human (Homo sapi 98.92
d1nc5a_363 Hypothetical protein YteR {Bacillus subtilis [TaxI 98.91
d1gh2a_107 Thioredoxin-like protein, N-terminal domain {Human 98.88
d1f9ma_112 Thioredoxin {Spinach (Spinacia oleracea), thioredo 98.84
d1fo5a_85 MJ0307, thioredoxin/glutaredoxin-like protein {Arc 98.82
d2b5ea4119 Protein disulfide isomerase, PDI {Baker's yeast (S 98.79
d2d5ja1377 Unsaturated glucuronyl hydrolase {Bacillus sp. GL1 98.69
d2es7a1119 Hydrogenase-1 operon protein HyaE {Salmonella typh 98.64
d1zmaa1115 Bacterocin transport accessory protein Bta {Strept 98.64
d1woua_119 Putative 42-9-9 protein (thioredoxin containing pr 98.62
d2hfda1132 Hydrogenase-1 operon protein HyaE {Escherichia col 98.61
d1knga_144 Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyr 98.57
d1hyua496 Alkyl hydroperoxide reductase subunit F (AhpF), N- 98.54
d1zzoa1134 Lipoprotein DsbF {Mycobacterium tuberculosis [TaxI 98.51
d1lu4a_134 Soluble secreted antigen MPT53 {Mycobacterium tube 98.5
d1o73a_144 Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 98.49
d1i5ga_144 Tryparedoxin II {Crithidia fasciculata [TaxId: 565 98.47
d1nhoa_85 MTH807, thioredoxin/glutaredoxin-like protein {Arc 98.45
d2fy6a1143 Peptide methionine sulfoxide reductase MsrA/MsrB, 98.38
d2b5xa1143 thiol:disulfide oxidoreductase YkuV {Bacillus subt 98.34
d1st9a_137 Thiol-disulfide oxidoreductase ResA {Bacillus subt 98.33
d1o8xa_144 Tryparedoxin I {Crithidia fasciculata [TaxId: 5656 98.32
d2djja1116 Protein disulfide isomerase, PDI {Fungi (Humicola 98.26
d1a8ya1124 Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax 98.25
d1jfua_176 Membrane-anchored thioredoxin-like protein TlpA, s 98.2
d2b5ea1140 Protein disulfide isomerase, PDI {Baker's yeast (S 98.17
d1nc5a_ 363 Hypothetical protein YteR {Bacillus subtilis [TaxI 98.13
d2c0ga2122 Windbeutel, N-terminal domain {Fruit fly (Drosophi 98.01
d2cvba1187 Probable thiol-disulfide isomerase/thioredoxin TTH 97.99
d1wjka_100 Thioredoxin-like structure containing protein C330 97.87
d1g87a1 454 Endo/exocellulase:cellobiose E-4, N-terminal domai 97.54
d1z6na1166 Hypothetical protein PA1234 {Pseudomonas aeruginos 97.52
d2cx4a1160 Bacterioferritin comigratory protein {Archaeon Aer 97.35
d1g7ea_122 Endoplasmic reticulum protein ERP29, N-terminal do 97.27
d1ks8a_ 433 Endo-b-1,4-glucanase {Termite (Nasutitermes takasa 97.15
d1clca1 441 CelD cellulase, C-terminal domain {Clostridium the 96.98
d2trcp_217 Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} 96.96
d1t3ba1150 Disulfide bond isomerase, DsbC, C-terminal domain 96.92
d1eeja1156 Disulfide bond isomerase, DsbC, C-terminal domain 96.9
d1ia6a_431 Nonprocessive cellulase Cel9M {Clostridium cellulo 96.84
d1tf4a1 460 Endo/exocellulase:cellobiose E-4, N-terminal domai 96.65
d1ut9a1 511 Cellulose 1,4-beta-cellobiosidase CbhA {Clostridiu 96.62
d2bmxa1169 Alkyl hydroperoxide reductase AhpC {Mycobacterium 96.6
d1nxca_ 467 Class I alpha-1;2-mannosidase, catalytic domain {M 96.36
d1xzoa1172 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 96.35
d1e2ya_167 Tryparedoxin peroxidase (thioredoxin peroxidase ho 96.15
d1hcua_488 Class I alpha-1;2-mannosidase, catalytic domain {T 96.13
d1x9da1453 Class I alpha-1;2-mannosidase, catalytic domain {H 96.09
d2ri9a1475 Class I alpha-1;2-mannosidase, catalytic domain {F 95.89
d2b7ka1169 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 95.88
d1nxca_ 467 Class I alpha-1;2-mannosidase, catalytic domain {M 95.85
d1x9da1 453 Class I alpha-1;2-mannosidase, catalytic domain {H 95.77
d1dl2a_ 511 Class I alpha-1;2-mannosidase, catalytic domain {B 95.3
d1dl2a_ 511 Class I alpha-1;2-mannosidase, catalytic domain {B 95.27
d2zcta1237 Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} 95.12
d1uula_194 Tryparedoxin peroxidase (thioredoxin peroxidase ho 95.1
d1zyea1158 Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [ 95.1
d2a4va1156 Peroxiredoxin dot5 {Baker's yeast (Saccharomyces c 95.07
d1r7ha_74 Glutaredoxin-like NRDH-redoxin {Corynebacterium am 94.94
d1h75a_76 Glutaredoxin-like NRDH-redoxin {Escherichia coli [ 94.8
d1xvwa1153 Putative peroxiredoxin Rv2238c/MT2298 {Mycobacteri 94.79
d1we0a1166 Alkyl hydroperoxide reductase AhpC {Amphibacillus 94.66
d1ia6a_431 Nonprocessive cellulase Cel9M {Clostridium cellulo 94.61
d1psqa_163 Probable thiol peroxidase PsaD {Streptococcus pneu 94.57
d1xvqa_166 Thiol peroxidase Tpx {Mycobacterium tuberculosis [ 94.54
d1wp0a1160 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 93.95
d1nm3a174 C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus 93.87
d2g0da1409 Nisin biosynthesis protein NisC {Lactococcus lacti 93.71
d1ut9a1511 Cellulose 1,4-beta-cellobiosidase CbhA {Clostridiu 93.38
d1qxha_164 Thiol peroxidase Tpx {Escherichia coli [TaxId: 562 93.33
d1v58a1169 Thiol:disulfide interchange protein DsbG, C-termin 93.32
d1zofa1170 Thioredoxin reductase TsaA {Helicobacter pylori [T 93.23
d1fova_82 Glutaredoxin (Grx, thioltransferase) {Escherichia 92.83
d2f8aa1184 Glutathione peroxidase {Human (Homo sapiens) [TaxI 92.65
d1ttza_75 Hypothetical protein XCC2852 {Xanthomonas campestr 92.09
d2ri9a1 475 Class I alpha-1;2-mannosidase, catalytic domain {F 92.05
d1q98a_164 Thiol peroxidase Tpx {Haemophilus influenzae [TaxI 91.91
d1qmva_197 Thioredoxin peroxidase 2 (thioredoxin peroxidase B 91.91
d1ktea_105 Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr 91.6
d1ks8a_433 Endo-b-1,4-glucanase {Termite (Nasutitermes takasa 91.12
d1n8ja_186 Alkyl hydroperoxide reductase AhpC {Salmonella typ 91.04
d1fvka_188 Disulfide-bond formation facilitator (DsbA) {Esche 91.01
d1egoa_85 Glutaredoxin (Grx, thioltransferase) {Escherichia 90.05
d1w6ka1448 Lanosterol synthase {Human (Homo sapiens) [TaxId: 89.47
d1beda_181 Disulfide-bond formation facilitator (DsbA) {Vibri 89.47
d2h01a1170 Thioredoxin peroxidase 2 (thioredoxin peroxidase B 89.44
d1hcua_ 488 Class I alpha-1;2-mannosidase, catalytic domain {T 89.23
d1clca1 441 CelD cellulase, C-terminal domain {Clostridium the 89.05
d1prxa_220 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 88.95
d1g87a1454 Endo/exocellulase:cellobiose E-4, N-terminal domai 88.22
d2sqca1352 Squalene-hopene cyclase {Alicyclobacillus acidocal 87.29
d1wzza1 319 Probable endoglucanase CmcAX {Acetobacter xylinus 86.77
d1a8la1119 Protein disulfide isomerase, PDI {Archaeon Pyrococ 85.65
d1z6ma1172 Hypothetical protein EF0770 {Enterococcus faecalis 85.36
d1xcca_219 1-Cys peroxiredoxin {Plasmodium yoelii yoelii [Tax 82.1
d1tf4a1460 Endo/exocellulase:cellobiose E-4, N-terminal domai 81.23
>d1fp3a_ a.102.1.3 (A:) N-acyl-D-glucosamine 2-epimerase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha/alpha toroid
superfamily: Six-hairpin glycosidases
family: N-acylglucosamine (NAG) epimerase
domain: N-acyl-D-glucosamine 2-epimerase
species: Pig (Sus scrofa) [TaxId: 9823]
Probab=100.00  E-value=6e-37  Score=334.33  Aligned_cols=348  Identities=12%  Similarity=-0.001  Sum_probs=259.3

Q ss_pred             HHHHHHHH-hhccccCCCC----------CCCCCCCChh-HHHHHHH-hhhhccccCCCCCcHHHHHHHHHHHHHHHhCC
Q 004888          286 RLCAEQLS-KSYDSRFGGF----------GSAPKFPRPV-EIQMMLY-HSKKLEDTGKSGEASEGQKMVLFTLQCMAKGG  352 (725)
Q Consensus       286 ~~~~~~l~-~~~D~~~GGf----------g~apKFP~~~-~l~~ll~-~~~~~~~~~~~~~~~~~~~~~~~TL~~ma~gG  352 (725)
                      ++++..+. ..+|+++|||          -..||+.... ...+++. .+....    ...+++.+++|.++++-|.++|
T Consensus        20 ~~ilpfW~~~~~D~~~GGf~~~ld~dg~~~~~~k~~~~~~R~l~~fs~a~~~~~----~~~~~~~~~~a~~g~~~L~~~~   95 (402)
T d1fp3a_          20 DRVMAFWLEHSHDREHGGFFTCLGRDGRVYDDLKYVWLQGRQVWMYCRLYRKLE----RFHRPELLDAAKAGGEFLLRHA   95 (402)
T ss_dssp             HHHHHHHHHHSBCTTTSSBCCCBCTTSCBSCCCEEHHHHHHHHHHHHHHHHHCG----GGCCHHHHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHhcCcCcCCCCeeeeECCCCCcCCCCceeeeeHHHHHHHHHHHHHhc----ccCCHHHHHHHHHHHHHHHHhC
Confidence            44555544 5799999999          2345554431 1112222 222111    1235789999999999999999


Q ss_pred             CcccCCCeEEEEecCCCCCCCCCchhHHHHHHHHHHHHHHHHccCChHHHHHHHHHHHHHHHhccCCCCceeeeccCCCc
Q 004888          353 IHDHVGGGFHRYSVDERWHVPHFEKMLYDQGQLANVYLDAFSLTKDVFYSYICRDILDYLRRDMIGPGGEIFSAEDADSA  432 (725)
Q Consensus       353 i~D~v~GGF~RYs~D~~W~vPHFEKMLyDNA~Ll~~ya~Ay~~t~d~~y~~vA~~~~~fl~~~m~~~~Ggfysa~DADs~  432 (725)
                      ++|+.+|||| |++|++|.+||++||+||||.++.+|+.+|++||++.|+++|+++++||.++|++++||||++.|+|+.
T Consensus        96 ~~d~~~Gg~~-~~vd~dG~~~~~~k~~Yd~Af~l~a~a~~~~~tg~~~~~~~a~~~~~~i~~~~~~~~~g~~~~~~~~~~  174 (402)
T d1fp3a_          96 RVAPPEKKCA-FVLTRDGRPVKVQRSIFSECFYTMAMNELWRVTAEARYQSEAVDMMDQIVHWVREDPSGLGRPQLPGAV  174 (402)
T ss_dssp             BSSTTSCCBC-SEECTTSCEEECCSSSHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHTCGGGGCCCCCTTSC
T ss_pred             CccCCCCCEE-EEECCCCCcCcccccccccHHHHHHHHHHHhccCCHHHHHHHHHHHHHHHHHhhcccCCCCccccCCCc
Confidence            9999999998 999999999999999999999999999999999999999999999999999999999999999999985


Q ss_pred             cccccccccCcceEEechHHHHHHhhhhHHHHHHHh----cccCCCCcCCCCCCCCCCCCCCcceeeccCCchHHHHhcC
Q 004888          433 ETEGATRKKEGAFYVWTSKEVEDILGEHAILFKEHY----YLKPTGNCDLSRMSDPHNEFKGKNVLIELNDSSASASKLG  508 (725)
Q Consensus       433 ~~~~~~~~~EGayY~wt~~Ei~~~lg~~~~l~~~~y----~l~~~Gn~e~~~~~dp~~~f~g~nvL~~~~~~~~~a~~~g  508 (725)
                             +.+|.++.|...|+..+|++........+    ........+   ..+|    +...++              
T Consensus       175 -------~~~g~~~~m~l~ea~~~l~~~~~~~~~~~~~~~~~~~~~~~~---~~~~----~~~~~~--------------  226 (402)
T d1fp3a_         175 -------ASESMAVPMMLLCLVEQLGEEDEELAGRYAQLGHWCARRILQ---HVQR----DGQAVL--------------  226 (402)
T ss_dssp             -------CEEETHHHHHHHHHHHHHHTTCHHHHHHTHHHHHHHHHHHHT---TEET----TTTEEC--------------
T ss_pred             -------cccccchHHHHHHHHHHHccccchhHHHHHHHHHHHHHHHHh---hccc----cchhHH--------------
Confidence                   57889999999999999874211110000    000000000   0000    000000              


Q ss_pred             CCHHHHHHHHHHHHHHHHhhhccCCCCCCCcchhhhcHHHHHHHHH-HHHHHhhhhhhhhcccCCCCCCChHHHHHHHHH
Q 004888          509 MPLEKYLNILGECRRKLFDVRSKRPRPHLDDKVIVSWNGLVISSFA-RASKILKSEAESAMFNFPVVGSDRKEYMEVAES  587 (725)
Q Consensus       509 ~~~e~~~~~l~~~r~kL~~~R~~R~~P~lDdKiitsWNal~I~aLa-~A~~vl~d~~~~~~~~~~~~~~~~~~yl~~A~~  587 (725)
                                      .+..++.++.|..|+++++.||++.+..|+ ++++++++                ++++..|.+
T Consensus       227 ----------------e~~~~~~~~~~~~~~~~i~pGh~~e~~wLll~a~~~~~~----------------~~~~~~a~~  274 (402)
T d1fp3a_         227 ----------------ENVSEDGEELSGCLGRHQNPGHALEAGWFLLRHSSRSGD----------------AKLRAHVID  274 (402)
T ss_dssp             ----------------SEEETTSCBCCHHHHHEECHHHHHHHHHHHHHHHHHTTC----------------HHHHHHHHH
T ss_pred             ----------------hhhccccCcccCcccCcCCcchhhHHHHHHHHHHHHcCC----------------chHHHHHHH
Confidence                            011234567788899999999999987665 79999997                678887766


Q ss_pred             HH-HHHHHhccccCCCeEEEEe-cCCCCC-----CCCCcchHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHccccC
Q 004888          588 AA-SFIRRHLYDEQTHRLQHSF-RNGPSK-----APGFLDDYAFLISGLLDLYEFGSGTKWLVWAIELQNTQDELFLDRE  660 (725)
Q Consensus       588 ~a-~~l~~~l~d~~~G~l~~s~-~~g~~~-----~~~~leDyA~li~aLL~LYe~Tgd~~yL~~A~~L~~~~~~~F~D~~  660 (725)
                      .+ .++.++.+|++.|++++.. .+|.+.     ..+.+++||++|.|++.+|++|||+.|+++|.++++++.++|+|++
T Consensus       275 ~~~~~~~~~g~d~~~ggl~~~~~~~g~~~~~~~~~~k~~W~qaE~i~a~l~ly~~tgd~~~l~~a~~l~~~~~~~f~D~~  354 (402)
T d1fp3a_         275 TFLLLPFRSGWDADHGGLFYFQDADGLCPTQLEWAMKLWWPHSEAMIAFLMGYSESGDPALLRLFYQVAEYTFRQFRDPE  354 (402)
T ss_dssp             HHTHHHHHHHBCTTTCSBCSCEETTSCCCSSTTTTCEEHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHTBCTT
T ss_pred             HHHHHHHHhCccCCCCeEEEEecCCCCccccccchHHHHHHHHHHHHHHHHHHHccCCHHHHHHHHHHHHHHHHhCCCCC
Confidence            54 6678889998888887763 444432     2467888999999999999999999999999999999999999999


Q ss_pred             CCcccccCCCCCccccccccCCCCCCCChHHHHHHHHHH
Q 004888          661 GGGYFNTTGEDPSVLLRVKEDHDGAEPSGNSVSVINLVR  699 (725)
Q Consensus       661 ~Ggyf~t~~~~~~~~~r~k~~~D~a~PS~Nsv~a~~Llr  699 (725)
                      +|+||..-+.+..++...|. .-+.+|+++..+...+++
T Consensus       355 ~G~W~~~~~~~g~~~~~~k~-~p~~~~YH~~ral~~~~~  392 (402)
T d1fp3a_         355 YGEWFGYLNREGKVALTIKG-GPFKGCFHVPRCLAMCEE  392 (402)
T ss_dssp             TSSBCCEECTTSCEEECCSS-CSSCCSSHHHHHHHHHHH
T ss_pred             CCeeEeeECCCCCCCccCCC-CCCCCcchHHHHHHHHHH
Confidence            99999987777776655443 224689999886555443



>d2afaa1 a.102.1.3 (A:4-415) Putative NAG isomerase YihS {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sena_ c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp3a_ a.102.1.3 (A:) N-acyl-D-glucosamine 2-epimerase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2afaa1 a.102.1.3 (A:4-415) Putative NAG isomerase YihS {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2d5ja1 a.102.1.7 (A:1-377) Unsaturated glucuronyl hydrolase {Bacillus sp. GL1 [TaxId: 84635]} Back     information, alignment and structure
>d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} Back     information, alignment and structure
>d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} Back     information, alignment and structure
>d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1z5ye1 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG (CycY, DsbE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nc5a_ a.102.1.6 (A:) Hypothetical protein YteR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} Back     information, alignment and structure
>d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2d5ja1 a.102.1.7 (A:1-377) Unsaturated glucuronyl hydrolase {Bacillus sp. GL1 [TaxId: 84635]} Back     information, alignment and structure
>d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knga_ c.47.1.10 (A:) Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1zzoa1 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lu4a_ c.47.1.10 (A:) Soluble secreted antigen MPT53 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1o73a_ c.47.1.10 (A:) Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 5702]} Back     information, alignment and structure
>d1i5ga_ c.47.1.10 (A:) Tryparedoxin II {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2fy6a1 c.47.1.10 (A:33-175) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]} Back     information, alignment and structure
>d2b5xa1 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase YkuV {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1st9a_ c.47.1.10 (A:) Thiol-disulfide oxidoreductase ResA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1o8xa_ c.47.1.10 (A:) Tryparedoxin I {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Back     information, alignment and structure
>d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1jfua_ c.47.1.10 (A:) Membrane-anchored thioredoxin-like protein TlpA, soluble domain {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nc5a_ a.102.1.6 (A:) Hypothetical protein YteR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2c0ga2 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cvba1 c.47.1.10 (A:2-188) Probable thiol-disulfide isomerase/thioredoxin TTHA0593 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g87a1 a.102.1.2 (A:3-456) Endo/exocellulase:cellobiose E-4, N-terminal domain {Clostridium cellulolyticum, atcc 35319 [TaxId: 1521]} Back     information, alignment and structure
>d1z6na1 c.47.1.1 (A:1-166) Hypothetical protein PA1234 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2cx4a1 c.47.1.10 (A:4-163) Bacterioferritin comigratory protein {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1g7ea_ c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ks8a_ a.102.1.2 (A:) Endo-b-1,4-glucanase {Termite (Nasutitermes takasagoensis) [TaxId: 62960]} Back     information, alignment and structure
>d1clca1 a.102.1.2 (A:135-575) CelD cellulase, C-terminal domain {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d2trcp_ c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t3ba1 c.47.1.9 (A:61-210) Disulfide bond isomerase, DsbC, C-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1eeja1 c.47.1.9 (A:61-216) Disulfide bond isomerase, DsbC, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ia6a_ a.102.1.2 (A:) Nonprocessive cellulase Cel9M {Clostridium cellulolyticum [TaxId: 1521]} Back     information, alignment and structure
>d1tf4a1 a.102.1.2 (A:1-460) Endo/exocellulase:cellobiose E-4, N-terminal domain {Thermomonospora fusca [TaxId: 2021]} Back     information, alignment and structure
>d1ut9a1 a.102.1.2 (A:306-816) Cellulose 1,4-beta-cellobiosidase CbhA {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d2bmxa1 c.47.1.10 (A:2-170) Alkyl hydroperoxide reductase AhpC {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nxca_ a.102.2.1 (A:) Class I alpha-1;2-mannosidase, catalytic domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xzoa1 c.47.1.10 (A:3-174) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1e2ya_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1hcua_ a.102.2.1 (A:) Class I alpha-1;2-mannosidase, catalytic domain {Trichoderma reesei [TaxId: 51453]} Back     information, alignment and structure
>d1x9da1 a.102.2.1 (A:245-697) Class I alpha-1;2-mannosidase, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ri9a1 a.102.2.1 (A:1036-1510) Class I alpha-1;2-mannosidase, catalytic domain {Fungus (Penicillium citrinum) [TaxId: 5077]} Back     information, alignment and structure
>d2b7ka1 c.47.1.10 (A:111-279) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Baker's yeast(Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nxca_ a.102.2.1 (A:) Class I alpha-1;2-mannosidase, catalytic domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x9da1 a.102.2.1 (A:245-697) Class I alpha-1;2-mannosidase, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dl2a_ a.102.2.1 (A:) Class I alpha-1;2-mannosidase, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dl2a_ a.102.2.1 (A:) Class I alpha-1;2-mannosidase, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2zcta1 c.47.1.10 (A:6-242) Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1uula_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1zyea1 c.47.1.10 (A:6-163) Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2a4va1 c.47.1.10 (A:59-214) Peroxiredoxin dot5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} Back     information, alignment and structure
>d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xvwa1 c.47.1.10 (A:1-153) Putative peroxiredoxin Rv2238c/MT2298 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1we0a1 c.47.1.10 (A:1-166) Alkyl hydroperoxide reductase AhpC {Amphibacillus xylanus [TaxId: 1449]} Back     information, alignment and structure
>d1ia6a_ a.102.1.2 (A:) Nonprocessive cellulase Cel9M {Clostridium cellulolyticum [TaxId: 1521]} Back     information, alignment and structure
>d1psqa_ c.47.1.10 (A:) Probable thiol peroxidase PsaD {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1xvqa_ c.47.1.10 (A:) Thiol peroxidase Tpx {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wp0a1 c.47.1.10 (A:138-297) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2g0da1 a.102.6.1 (A:7-415) Nisin biosynthesis protein NisC {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1ut9a1 a.102.1.2 (A:306-816) Cellulose 1,4-beta-cellobiosidase CbhA {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1qxha_ c.47.1.10 (A:) Thiol peroxidase Tpx {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v58a1 c.47.1.9 (A:62-230) Thiol:disulfide interchange protein DsbG, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zofa1 c.47.1.10 (A:1-170) Thioredoxin reductase TsaA {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} Back     information, alignment and structure
>d2f8aa1 c.47.1.10 (A:12-195) Glutathione peroxidase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ttza_ c.47.1.1 (A:) Hypothetical protein XCC2852 {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d2ri9a1 a.102.2.1 (A:1036-1510) Class I alpha-1;2-mannosidase, catalytic domain {Fungus (Penicillium citrinum) [TaxId: 5077]} Back     information, alignment and structure
>d1q98a_ c.47.1.10 (A:) Thiol peroxidase Tpx {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qmva_ c.47.1.10 (A:) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ks8a_ a.102.1.2 (A:) Endo-b-1,4-glucanase {Termite (Nasutitermes takasagoensis) [TaxId: 62960]} Back     information, alignment and structure
>d1n8ja_ c.47.1.10 (A:) Alkyl hydroperoxide reductase AhpC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1fvka_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w6ka1 a.102.4.2 (A:6-99,A:379-732) Lanosterol synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1beda_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2h01a1 c.47.1.10 (A:2-171) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d1hcua_ a.102.2.1 (A:) Class I alpha-1;2-mannosidase, catalytic domain {Trichoderma reesei [TaxId: 51453]} Back     information, alignment and structure
>d1clca1 a.102.1.2 (A:135-575) CelD cellulase, C-terminal domain {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1prxa_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g87a1 a.102.1.2 (A:3-456) Endo/exocellulase:cellobiose E-4, N-terminal domain {Clostridium cellulolyticum, atcc 35319 [TaxId: 1521]} Back     information, alignment and structure
>d2sqca1 a.102.4.2 (A:8-36,A:308-630) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1wzza1 a.102.1.2 (A:23-341) Probable endoglucanase CmcAX {Acetobacter xylinus [TaxId: 28448]} Back     information, alignment and structure
>d1a8la1 c.47.1.2 (A:1-119) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1z6ma1 c.47.1.13 (A:1-172) Hypothetical protein EF0770 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1xcca_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d1tf4a1 a.102.1.2 (A:1-460) Endo/exocellulase:cellobiose E-4, N-terminal domain {Thermomonospora fusca [TaxId: 2021]} Back     information, alignment and structure