Citrus Sinensis ID: 004904

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720----

MSSPYPILDNRPIDQWKVTELKEELKRRKLKSSGKKDDLIRLLDQAIRIERENAEKEARKVAEMEAAKDAFHGANITSQPVVEVKDAEVSVGSETAKDVLDVDAKRNEKVENVVVQLDINSFAPGFGPGEHQERDIRGDNNENVAALGQEKFQEGDMTGSINPARADDELGLQATTVETSTKLTENVVTEVALSGHTTVTESVVTEVAMSGQELQNSGTHGENVNTNIQLENEDSKPQLENEGLKTPHREDVLDATAPENQVSEVSAILGSQVKSDSISTDSISINEKIELKDNIIADNVKLELDVNKSGMVEPSSGNVTAVGGESHPMDVEDPLEEKASVDEKDDNIATIAVMGKKIDSVDMGYSEKLNLDRSSGDDSMEDDVLESKQIDSKDSSDEVRNRTEKNDVPVVKEESPVDVVGDGLSADIKHADVDDKSCPVIPAEKRKINDQEAVGNNEPSKRQRRWNSESLKLPEQQSTTPSSTPRDTLQPSMKRNFSRSDSAVSDDTPKERIVPPSPKSPTNSLRIDHFVRPFTLRAVQELLGKTGTFTSFWMDHIKTHCYVTYSSVEEAIETRNALYNIQWPPNNGGRPLVAEFVDPQEVKMRTEAPPPSPAAPVSTGSAAPAPAAAPTSQPQPSPRQPAARQQLPPPPTLPPPPPISNQAPARERFTLPPPPPLPEKLDPPIVTLDDLFRKTKATPRIYYLPLSEEQVAAKLEARSKSSKQ

cccccccccccccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccHHcccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHccccccccccccccEEccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccHHHHHHHHHHHHHHccc

ccccccccccccccHccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccHHccccccccccccccccccEEcccccccccEEEEccccccccccEEEEEEccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccHHHHccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccHHHHHcccccccccccHcccccccccHcccccccccccccccccccccccccccccccccccccEEEEccccccccHHHHHHHHHHcccEEEEEEccccccEEEEEccHHHHHHHHHHHccccccccccccEEEEEEccHHHHHHHHccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccHcccccccccccccccccccHHHHHHHHHcccccEEEEccccHHHHHHHHHHHHHHccc

msspypildnrpidqwKVTELKEELKRRKlkssgkkdDLIRLLDQAIRIERENAEKEARKVAEMEAAKdafhganitsqpvvevkdaevsvgsetakDVLDVDAKRNEKVENVVVQLDinsfapgfgpgehqerdirgdnnENVAALGQekfqegdmtgsinparaddelglqaTTVETSTKLTENVVTEVALSGHTTVTESVVTEVAMSGqelqnsgthgenvntniqlenedskpqleneglktphredvldatapenqvSEVSAILGSqvksdsistdsisinekielkdniiadnvkleldvnksgmvepssgnvtavggeshpmdvedpleekasvdekddnIATIAVMGKkidsvdmgyseklnldrssgddsmeddvleskqidskdssdevrnrtekndvpvvkeespvdvvgdglsadikhadvddkscpvipaekrkindqeavgnnepskrqrrwnseslklpeqqsttpsstprdtlqpsmkrnfsrsdsavsddtpkerivppspksptnslridhfvrPFTLRAVQELLGKTGTFTSFWMDHIKTHCYVTYSSVEEAIETRNALyniqwppnnggrplvaefvdpqevkmrteapppspaapvstgsaapapaaaptsqpqpsprqpaarqqlpppptlpppppisnqaparerftlppppplpekldppivtlddlfrktkatpriyylplSEEQVAAKLEARSKSSKQ

msspypildnrpidqwkvTELKEelkrrklkssgkkddlirLLDQAIRIERENAEKEARKVAEMEAAKDafhganitsqpvvEVKDAEvsvgsetakdvldvdakrnekVENVVVQLDINSFAPGFGPGEHQERDIRGDNNENVAALGQEKFQEGDMTGSINPARADDELGLQATTVetstkltenvVTEVALSGHTTVTESVVTEVAMSGQELQNSGTHGENVNTNIQLENEDSKPQLENEGLKTPHREDVLDATAPENQVSEVSAIlgsqvksdsistdsisinekielkdniiadNVKLELDVNKSGMVEPSSGNVTAVGGESHPMDVEDPLeekasvdekddnIATIAVmgkkidsvdmgySEKLNldrssgddsmeddvleskqidskdssdevrnrtekndvpvvkeespvdvvGDGLSAdikhadvddkscpvipaekrkindqeavgnnepskrqrrwnseslklpeqqsttpsstprdtlqpsmkrnfsrsdsavsddtpkerivppspksptnslridHFVRPFTLRAVQELLGKTGTFTSFWMDHIKTHCYVTYSSVEEAIETRNALYNIQWPPNNGGRPLVAEFVDPQEVKMRTEAPPPSPAAPVSTGSAAPAPAAAPTSQPQPSPRQPAARQQLPPPPTLPPPPPISNQAPARERFTLPPPPPLPEKLDPPIVTLDDLFRKTKATPRIYYLPLSEEQVAAKLEarsksskq

MSSPYPILDNRPIDQWKVTelkeelkrrklkssgkkddlIRLLDQAIRIERENAEKEARKVAEMEAAKDAFHGANITSQPVVEVKDAEVSVGSETAKDVLDVDAKRNEKVENVVVQLDINSFAPGFGPGEHQERDIRGDNNENVAALGQEKFQEGDMTGSINPARADDELGLQATTVETSTKLTENVVTEVALSGHttvtesvvtevAMSGQELQNSGTHGENVNTNIQLENEDSKPQLENEGLKTPHREDVLDATAPENQVSEVSAILGSQVKsdsistdsisiNEKIELKDNIIADNVKLELDVNKSGMVEPSSGNVTAVGGESHPMDVEDPLEEKASVDEKDDNIATIAVMGKKIDSVDMGYSEKLNLDRSSGDDSMEDDVLESKQIDSKDSSDEVRNRTEKNDVPVVKEESPVDVVGDGLSADIKHADVDDKSCPVIPAEKRKINDQEAVGNNEPSKRQRRWNSESLKLPEQQSTTPSSTPRDTLQPSMKRNFSRSDSAVSDDTPKERIVPPSPKSPTNSLRIDHFVRPFTLRAVQELLGKTGTFTSFWMDHIKTHCYVTYSSVEEAIETRNALYNIQWPPNNGGRPLVAEFVDPQEVKMRTEapppspaapvstgsaapapaaaptsqpqpsprqpaarqqlpppptlpppppISNQAPARERFTlppppplpekldppIVTLDDLFRKTKATPRIYYLPLSEEQVAAKLEARSKSSKQ

***************************************IRLL*****************************************************************KVENVVVQLDINSFA***********************************************************LTENVVTEVALSGHTTVTESVV***********************************************************************************KIELKDNIIADNVKLEL*********************************************TIAVMG**************************************************************************************************************************************************************************RIDHFVRPFTLRAVQELLGKTGTFTSFWMDHIKTHCYVTYSSVEEAIETRNALYNIQWPPNNGGRPLVAEF****************************************************************************************IVTLDDLFRKTKATPRIYYLPL******************

**SPYPI*DNRPIDQWKVTELKEELKR*KLKSSGKKDDLIRLL**************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************RIDHFVRPFTLRAVQELLGKTGTFTSFWMDHIKTHCYVTYSSVEEAIETRNALYNIQWPPNNGG*PLVA*************************************************************************************************FRKTKATPRIYYLPLSEEQVA************

MSSPYPILDNRPIDQWKVTELKEEL**********KDDLIRLLDQAIRIERENAEKEARKVAEMEAAKDAFHGANITSQPVVEVKDAEVSVGSETAKDVLDVDAKRNEKVENVVVQLDINSFAPGFGPGEHQERDIRGDNNENVAALGQEKFQEGDMTGSINPARADDELGLQATTVETSTKLTENVVTEVALSGHTTVTESVVTEVAMSGQELQNSGTHGENVNTNIQLENEDSKPQLENEGLKTPHREDVLDATAPENQVSEVSAILGS*********DSISINEKIELKDNIIADNVKLELDVNKSGMVEPSSGNVTAVGGESHPMDVEDPLEEKASVDEKDDNIATIAVMGKKIDSVDMGYSEKLNL************************************VPVVKEESPVDVVGDGLSADIKHADVDDKSCPVIPAEKRKIND***********************************************************************TNSLRIDHFVRPFTLRAVQELLGKTGTFTSFWMDHIKTHCYVTYSSVEEAIETRNALYNIQWPPNNGGRPLVAEFVDPQEVK********************************************PPPPTLPPPPPISNQAPARERFTLPPPPPLPEKLDPPIVTLDDLFRKTKATPRIYYLPLSEEQVAA***********

****YPILDNRPIDQWKVTELKEELKRRKLKSSGKKDDLIRLLDQAIRIERENA*********************************EVSV***TAKDVLDVDAKRNEKVENVVVQLDINS***************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************PTNSLRIDHFVRPFTLRAVQELLGKTGTFTSFWMDHIKTHCYVTYSSVEEAIETRNALYNIQWPPNNGGRPLVAEFVDPQEVKMRT****************************************************************************PPIVTLDDLFRKTKATPRIYYLPLSEEQVAAKLEARS*****

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSSPYPILDNRPIDQWKVTELKEELKRRKLKSSGKKDDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKDAFHGANITSQPVVEVKDAEVSVGSETAKDVLDVDAKRNEKVENVVVQLDINSFAPGFGPGEHQERDIRGDNNENVAALGQEKFQEGDMTGSINPARADDELGLQATTVETSTKLTENVVTEVALSGHTTVTESVVTEVAMSGQELQNSGTHGENVNTNIQLENEDSKPQLENEGLKTPHREDVLDATAPENQVSEVSAILGSQVKSDSISTDSISINEKIELKDNIIADNVKLELDVNKSGMVEPSSGNVTAVGGESHPMDVEDPLEEKASVDEKDDNIATIAVMGKKIDSVDMGYSEKLNLDRSSGDDSMEDDVLESKQIDSKDSSDEVRNRTEKNDVPVVKEESPVDVVGDGLSADIKHADVDDKSCPVIPAEKRKINDQEAVGNNEPSKRQRRWNSESLKLPEQQSTTPSSTPRDTLQPSMKRNFSRSDSAVSDDTPKERIVPPSPKSPTNSLRIDHFVRPFTLRAVQELLGKTGTFTSFWMDHIKTHCYVTYSSVEEAIETRNALYNIQWPPNNGGRPLVAEFVDPQEVKMRTEAPPPSPAAPVSTGSAAPAPAAAPTSQPQPSPRQPAARQQLPPPPTLPPPPPISNQAPARERFTLPPPPPLPEKLDPPIVTLDDLFRKTKATPRIYYLPLSEEQVAAKLEARSKSSKQ

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		724	2.2.26 [Sep-21-2011]
Q9UKV3		1341	Apoptotic chromatin conde	yes	no	0.154	0.083	0.434	3e-20
Q9JIX8		1338	Apoptotic chromatin conde	yes	no	0.044	0.023	0.656	8e-05

>sp\|Q9UKV3\|ACINU_HUMAN Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens GN=ACIN1 PE=1 SV=2	Back alignment and function desciption

 Score =  100 bits (250), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 79/122 (64%), Gaps = 10/122 (8%)

Query: 487  DTLQPSMKRNFSRSDSAVS---DDTPKERIVPPSPKSP-TNSLRIDHFVRPFTLRAVQEL 542
            DTL    +R+ S+  S VS   DD  +   VP  P+   +N + I + VRPFTL  ++EL
Sbjct: 975  DTL---TRRSISQQKSGVSITIDDPVRTAQVPSPPRGKISNIVHISNLVRPFTLGQLKEL 1031

Query: 543  LGKTGTFT--SFWMDHIKTHCYVTYSSVEEAIETRNALYNIQWPPNNGGRPLVAEFVDPQ 600
            LG+TGT    +FW+D IK+HC+VTYS+VEEA+ TR AL+ ++WP +N  + L A++ +  
Sbjct: 1032 LGRTGTLVEEAFWIDKIKSHCFVTYSTVEEAVATRTALHGVKWPQSN-PKFLCADYAEQD 1090

Query: 601  EV 602
            E+
Sbjct: 1091 EL 1092

Component of a splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junction on mRNAs. The EJC is a dynamic structure consisting of a few core proteins and several more peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. Induces apoptotic chromatin condensation after activation by CASP3. Regulates cyclin A1, but not cyclin A2, expression in leukemia cells.
Homo sapiens (taxid: 9606)

>sp\|Q9JIX8\|ACINU_MOUSE Apoptotic chromatin condensation inducer in the nucleus OS=Mus musculus GN=Acin1 PE=1 SV=3	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		724
224081194		690	predicted protein [Populus trichocarpa]	0.943	0.989	0.627	0.0
359480844		691	PREDICTED: uncharacterized protein LOC10	0.908	0.952	0.582	0.0
356567814		708	PREDICTED: uncharacterized protein LOC10	0.922	0.943	0.523	1e-173
356538027		705	PREDICTED: uncharacterized protein LOC10	0.928	0.953	0.523	1e-167
224093798		582	predicted protein [Populus trichocarpa]	0.679	0.845	0.694	1e-167
255576190		661	conserved hypothetical protein [Ricinus	0.730	0.800	0.514	1e-145
357463459		720	Apoptotic chromatin condensation inducer	0.676	0.680	0.608	1e-140
296082468		413	unnamed protein product [Vitis vinifera]	0.512	0.898	0.651	1e-126
357519587		804	Apoptotic chromatin condensation inducer	0.817	0.736	0.434	1e-118
108708492		715	SAP domain containing protein, expressed	0.933	0.945	0.416	1e-117

>gi\|224081194\|ref\|XP_002306329.1\| predicted protein [Populus trichocarpa] gi\|222855778\|gb\|EEE93325.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score =  768 bits (1983), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/731 (62%), Positives = 552/731 (75%), Gaps = 48/731 (6%)

Query: 1   MSSPYPILDNR-PIDQWKVTELKEELKRRKLKSSGKKDDLIRLLDQAIRIERENAEKEAR 59
           MSS Y +L N+  + QWKVTELKEEL+RRKLK+SG KDDLI+ L++AIRIERE+ E    
Sbjct: 1   MSSQYSVLGNKLDLVQWKVTELKEELRRRKLKTSGLKDDLIKRLEEAIRIEREDEEIRHE 60

Query: 60  KVAEMEAAKDAFHGANITSQPVVEVKDAE-VSVGSETAKDVLDVDAKRNEKVENVVVQLD 118
            V   E A+D  +G ++ +  VV VK++E VS  +ET + V+D  A RNEKV++V+VQ+ 
Sbjct: 61  LVNAAEVAEDVDNGVDLENPHVVGVKNSEAVSAVTETVEVVVDDAANRNEKVDDVMVQVG 120

Query: 119 INSFAPGFGPGEHQERDIRGDNNENVAALGQEKFQEGDMTGSINPARADDE-LGLQATTV 177
           I+                     E+V A+G  + QE    G +N +R ++E L + ATTV
Sbjct: 121 ID---------------------ESVKAMGPRELQEEVKMGGVNSSRVEEEELTVHATTV 159

Query: 178 ETSTKLTENVVTEVALSGHTTVTESVVTEVAMSGQELQNSGTHGENVNTNIQLENEDSKP 237
           ETS                 +VTESVV+EVA+S Q++QNSGT   N N++IQLENEDSKP
Sbjct: 160 ETSI----------------SVTESVVSEVALSVQDVQNSGTQEANENSSIQLENEDSKP 203

Query: 238 QLENEGLKTPHREDVLDATAPENQVSEVSAILGSQVKSDSISTDSISINEKIELKDNIIA 297
           QLENE  K P    VL+++AP+NQVSEV+  LG QVKSDSISTDS+SINEKIELKDNIIA
Sbjct: 204 QLENESSKPPDENVVLESSAPDNQVSEVNPNLGFQVKSDSISTDSVSINEKIELKDNIIA 263

Query: 298 DNVKLELDVNKSGMVEPSSGNVTAVGGESHPMDVEDPLEEKASVDEKDDNIATIAVMGKK 357
           D+VKLELD  K  MVEPSS NV  VGGESHPMDVE+P E+  SV++KDD+  T A M KK
Sbjct: 264 DDVKLELDDVKLEMVEPSSSNVVPVGGESHPMDVEEPQEKSPSVEKKDDSNGTNADMSKK 323

Query: 358 IDSVDMGYSEKLNLDRSSGDDSMEDDVLESKQIDSKDSSDEVRNRTE-KNDVPVVKEESP 416
             SVD+G SEKLNLDRSSGDDSME+DVLESKQIDSK ++DEV ++ + KN++P +KEE+ 
Sbjct: 324 NYSVDVGCSEKLNLDRSSGDDSMEEDVLESKQIDSKYNTDEVGDKCKIKNELPSLKEENL 383

Query: 417 VDVVGDGLSADIKHADVDDKSCPVIPAEKRKINDQEAVGNNEPSKRQRRWNSESLKLPEQ 476
           V+V G  LS D K   V++ +CPV P EKRK+NDQEAVGN EP KRQRRWNSES+K+PEQ
Sbjct: 384 VNVTGKDLSTDQKEIHVENMTCPVAPMEKRKLNDQEAVGNTEPLKRQRRWNSESIKVPEQ 443

Query: 477 QST--TPSSTPRDTLQPS-MKRNFSRSDSAVSDDTPKERIVPPSPKSPTNSLRIDHFVRP 533
           QS+  TP++TP D  QP+ ++RNFSRSDS+VS++ PKERIVPPS K PTNSLRID F+RP
Sbjct: 444 QSSNLTPTTTPNDGFQPTPLRRNFSRSDSSVSEEAPKERIVPPSQKPPTNSLRIDRFLRP 503

Query: 534 FTLRAVQELLGKTGTFTSFWMDHIKTHCYVTYSSVEEAIETRNALYNIQWPPNNGGRPLV 593
           FTL+AVQELLGKTG+ TSFWMDHIKTHCYV YSSVEEA+ETRN +YN+QWPP NGGR LV
Sbjct: 504 FTLKAVQELLGKTGSVTSFWMDHIKTHCYVMYSSVEEAVETRNTVYNLQWPP-NGGRLLV 562

Query: 594 AEFVDPQEVKMRTEAPPPSPAAPVSTGSAAPAPAAAPTSQPQPSPRQPAARQQLPPPPTL 653
           AEFVDPQEVK+R +APP SPAAPV+  + APAP      QPQPSPRQ  +RQQLPPPP+L
Sbjct: 563 AEFVDPQEVKIRVDAPPQSPAAPVTPSTPAPAPPML---QPQPSPRQQVSRQQLPPPPSL 619

Query: 654 PPPPPISNQAPARERFTLPPPPPLPEKLDPPIVTLDDLFRKTKATPRIYYLPLSEEQVAA 713
           P PPP+SN   ARER  LPPPPPLPEK DPPIVTLDDLFRKTK  PRIYYLPLSEEQVAA
Sbjct: 620 PLPPPLSNPPHARERVDLPPPPPLPEKHDPPIVTLDDLFRKTKTAPRIYYLPLSEEQVAA 679

Query: 714 KLEARSKSSKQ 724
           KL    K++KQ
Sbjct: 680 KLAGHGKNTKQ 690

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|359480844\|ref\|XP_002276745.2\| PREDICTED: uncharacterized protein LOC100252593 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|356567814\|ref\|XP_003552110.1\| PREDICTED: uncharacterized protein LOC100786288 [Glycine max]	Back alignment and taxonomy information

>gi\|356538027\|ref\|XP_003537506.1\| PREDICTED: uncharacterized protein LOC100816245 [Glycine max]	Back alignment and taxonomy information

>gi\|224093798\|ref\|XP_002309996.1\| predicted protein [Populus trichocarpa] gi\|222852899\|gb\|EEE90446.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|255576190\|ref\|XP_002528989.1\| conserved hypothetical protein [Ricinus communis] gi\|223531579\|gb\|EEF33408.1\| conserved hypothetical protein [Ricinus communis]	Back alignment and taxonomy information

>gi\|357463459\|ref\|XP_003602011.1\| Apoptotic chromatin condensation inducer in the nucleus [Medicago truncatula] gi\|355491059\|gb\|AES72262.1\| Apoptotic chromatin condensation inducer in the nucleus [Medicago truncatula]	Back alignment and taxonomy information

>gi\|296082468\|emb\|CBI21473.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|357519587\|ref\|XP_003630082.1\| Apoptotic chromatin condensation inducer in the nucleus [Medicago truncatula] gi\|355524104\|gb\|AET04558.1\| Apoptotic chromatin condensation inducer in the nucleus [Medicago truncatula]	Back alignment and taxonomy information

>gi\|108708492\|gb\|ABF96287.1\| SAP domain containing protein, expressed [Oryza sativa Japonica Group] gi\|108708493\|gb\|ABF96288.1\| SAP domain containing protein, expressed [Oryza sativa Japonica Group]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		724
TAIR\|locus:2135262		633	AT4G39680 [Arabidopsis thalian	0.459	0.526	0.536	7.7e-97
RGD\|1311945		515	Acin1 "apoptotic chromatin con	0.219	0.308	0.366	2.8e-25
UNIPROTKB\|F1MAF3		633	Acin1 "Protein Acin1" [Rattus	0.219	0.251	0.366	8e-25
UNIPROTKB\|E7EQT4		1301	ACIN1 "Apoptotic chromatin con	0.219	0.122	0.364	8.5e-25
UNIPROTKB\|G3V3B0		582	ACIN1 "Apoptotic chromatin con	0.219	0.273	0.364	3.5e-24
UNIPROTKB\|E9PTS9		1299	Acin1 "Protein Acin1" [Rattus	0.219	0.122	0.366	3.6e-24
UNIPROTKB\|E9PST5		1339	Acin1 "Protein Acin1" [Rattus	0.219	0.118	0.366	4.2e-24
UNIPROTKB\|A7Z082		582	ACIN1 "Uncharacterized protein	0.219	0.273	0.364	4.5e-24
MGI\|MGI:1891824		1338	Acin1 "apoptotic chromatin con	0.219	0.118	0.366	5.3e-24
UNIPROTKB\|F1S9D1		1338	ACIN1 "Uncharacterized protein	0.219	0.118	0.364	6.6e-24

TAIR\|locus:2135262 AT4G39680 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 834 (298.6 bits), Expect = 7.7e-97, Sum P(2) = 7.7e-97
 Identities = 197/367 (53%), Positives = 249/367 (67%)

Query:   254 DATA-PENQVSEVSAILGSQVKXXXXXXXXXXXNEKIELKDNIIADNVKLELDVNKSGMV 312
             D+ A P   V E SA+  +QV            ++ I   D++ ++N K+EL  NK    
Sbjct:   195 DSKAQPSEAVLEKSAMY-NQVSEVIPVTGFEVKSDCIST-DSV-SNNEKIELKDNKIADN 251

Query:   313 EPSSGNV------TAVGGESHPMDVEDPLEEKASVDEKDDNIATIAVMGKKIDSVDMGYS 366
                  NV      + V GESHPMDVE+PLE+K SV   DD+ A  A M K+ + +D G S
Sbjct:   252 VKLEQNVNKFQEPSTVVGESHPMDVEEPLEQKTSVGGGDDSNAANADMIKENNIIDAGDS 311

Query:   367 EKLNLDRSSGDDSMEDDVLESKQIDSKDSSDEVRNRTEKNDVPVVKEESPVDV-VGDGLS 425
             EKLNLDRSSGD+SMED+  E+KQ +S  S D    ++ K ++ + KEES  D+  G G S
Sbjct:   312 EKLNLDRSSGDESMEDEP-ETKQSESITSDD----KSAKIEM-LSKEESRADMDAGKGKS 365

Query:   426 ADIKHADVDDKSCPVIPAEKRKI--NDQEAVGNNEPSKRQRRWNSESLKLPEQQ---STT 480
              +       +KS P++ ++KRK+  NDQEAVGNNEP+KR RRWNS S+K+PE Q   S T
Sbjct:   366 PE-------NKSHPLVASDKRKLPANDQEAVGNNEPAKR-RRWNSNSIKVPEAQITNSAT 417

Query:   481 PSSTPRDTLQPSMKRNFSRSDSAVSDDTPKERIVPPSPKSPTNSLRIDHFVRPFTLRAVQ 540
             P++TPR T    +KR+FSRSDS+VS+D PKER+VPPSPK PTNSLRID F+RPFTL+AVQ
Sbjct:   418 PTTTPRST---GLKRDFSRSDSSVSEDGPKERVVPPSPKEPTNSLRIDRFLRPFTLKAVQ 474

Query:   541 ELLGKTGTFTSFWMDHIKTHCYVTYSSVEEAIETRNALYNIQWPPNNGGRPLVAEFVDPQ 600
             ELLGKTG  TSFWMDHIKTHCYV+Y SVEEA  TR A+YN+QWPPN GGR L+AEFV  +
Sbjct:   475 ELLGKTGNVTSFWMDHIKTHCYVSYPSVEEAAATREAVYNLQWPPN-GGRHLIAEFVRAE 533

Query:   601 EVKMRTE 607
             EVK + E
Sbjct:   534 EVKEKLE 540

GO:0003676 "nucleic acid binding" evidence=IEA

GO:0003677 "DNA binding" evidence=ISS

GO:0005634 "nucleus" evidence=ISS

GO:0005737 "cytoplasm" evidence=ISM

GO:0008150 "biological_process" evidence=ND

GO:0009507 "chloroplast" evidence=IDA

GO:0005829 "cytosol" evidence=IDA

GO:0006259 "DNA metabolic process" evidence=RCA

GO:0006310 "DNA recombination" evidence=RCA

GO:0007062 "sister chromatid cohesion" evidence=RCA

GO:0007126 "meiosis" evidence=RCA

GO:0009887 "organ morphogenesis" evidence=RCA

GO:0009888 "tissue development" evidence=RCA

GO:0010332 "response to gamma radiation" evidence=RCA

GO:0010564 "regulation of cell cycle process" evidence=RCA

GO:0010638 "positive regulation of organelle organization" evidence=RCA

GO:0016567 "protein ubiquitination" evidence=RCA

GO:0031048 "chromatin silencing by small RNA" evidence=RCA

GO:0032204 "regulation of telomere maintenance" evidence=RCA

GO:0033044 "regulation of chromosome organization" evidence=RCA

GO:0043247 "telomere maintenance in response to DNA damage" evidence=RCA

GO:0045132 "meiotic chromosome segregation" evidence=RCA

RGD\|1311945 Acin1 "apoptotic chromatin condensation inducer 1" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|F1MAF3 Acin1 "Protein Acin1" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|E7EQT4 ACIN1 "Apoptotic chromatin condensation inducer in the nucleus" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|G3V3B0 ACIN1 "Apoptotic chromatin condensation inducer in the nucleus" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|E9PTS9 Acin1 "Protein Acin1" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|E9PST5 Acin1 "Protein Acin1" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|A7Z082 ACIN1 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

MGI\|MGI:1891824 Acin1 "apoptotic chromatin condensation inducer 1" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|F1S9D1 ACIN1 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		724
cd12432		90	cd12432, RRM_ACINU, RNA recognition motif in apopt	6e-38
pfam02037		35	pfam02037, SAP, SAP domain	3e-07
PRK14951		618	PRK14951, PRK14951, DNA polymerase III subunits ga	3e-07
PRK07764		824	PRK07764, PRK07764, DNA polymerase III subunits ga	6e-07
PRK12270		1228	PRK12270, kgd, alpha-ketoglutarate decarboxylase;	6e-07
PRK07764		824	PRK07764, PRK07764, DNA polymerase III subunits ga	8e-07
smart00513		35	smart00513, SAP, Putative DNA-binding (bihelical)	1e-06
pfam07174		297	pfam07174, FAP, Fibronectin-attachment protein (FA	1e-06
PRK14950		585	PRK14950, PRK14950, DNA polymerase III subunits ga	2e-06
PRK12323		700	PRK12323, PRK12323, DNA polymerase III subunits ga	2e-06
PHA03247		3151	PHA03247, PHA03247, large tegument protein UL36; P	4e-06
PHA03247		3151	PHA03247, PHA03247, large tegument protein UL36; P	4e-06
smart00818		165	smart00818, Amelogenin, Amelogenins, cell adhesion	4e-06
PRK07764		824	PRK07764, PRK07764, DNA polymerase III subunits ga	7e-06
PRK06995		484	PRK06995, flhF, flagellar biosynthesis regulator F	8e-06
PRK07764		824	PRK07764, PRK07764, DNA polymerase III subunits ga	9e-06
PRK14951		618	PRK14951, PRK14951, DNA polymerase III subunits ga	1e-05
PRK07764		824	PRK07764, PRK07764, DNA polymerase III subunits ga	2e-05
PRK07764		824	PRK07764, PRK07764, DNA polymerase III subunits ga	2e-05
PRK14950		585	PRK14950, PRK14950, DNA polymerase III subunits ga	2e-05
PRK07994		647	PRK07994, PRK07994, DNA polymerase III subunits ga	2e-05
PRK07764		824	PRK07764, PRK07764, DNA polymerase III subunits ga	3e-05
PRK14965		576	PRK14965, PRK14965, DNA polymerase III subunits ga	3e-05
PRK14951		618	PRK14951, PRK14951, DNA polymerase III subunits ga	5e-05
PHA03307		1352	PHA03307, PHA03307, transcriptional regulator ICP4	5e-05
PRK14951		618	PRK14951, PRK14951, DNA polymerase III subunits ga	1e-04
PRK07764		824	PRK07764, PRK07764, DNA polymerase III subunits ga	1e-04
PRK07764		824	PRK07764, PRK07764, DNA polymerase III subunits ga	1e-04
PRK12323		700	PRK12323, PRK12323, DNA polymerase III subunits ga	1e-04
PHA03247		3151	PHA03247, PHA03247, large tegument protein UL36; P	1e-04
PHA03247		3151	PHA03247, PHA03247, large tegument protein UL36; P	1e-04
PRK07994		647	PRK07994, PRK07994, DNA polymerase III subunits ga	1e-04
PRK00404		141	PRK00404, tatB, sec-independent translocase; Provi	1e-04
PRK07764		824	PRK07764, PRK07764, DNA polymerase III subunits ga	2e-04
PRK12323		700	PRK12323, PRK12323, DNA polymerase III subunits ga	2e-04
PHA03247		3151	PHA03247, PHA03247, large tegument protein UL36; P	2e-04
PHA03247		3151	PHA03247, PHA03247, large tegument protein UL36; P	2e-04
pfam07174		297	pfam07174, FAP, Fibronectin-attachment protein (FA	3e-04
PHA03247		3151	PHA03247, PHA03247, large tegument protein UL36; P	3e-04
PHA03247		3151	PHA03247, PHA03247, large tegument protein UL36; P	3e-04
PRK07994		647	PRK07994, PRK07994, DNA polymerase III subunits ga	3e-04
PHA03247		3151	PHA03247, PHA03247, large tegument protein UL36; P	4e-04
PRK14971		614	PRK14971, PRK14971, DNA polymerase III subunits ga	4e-04
PRK11633		226	PRK11633, PRK11633, cell division protein DedD; Pr	4e-04
pfam09770		804	pfam09770, PAT1, Topoisomerase II-associated prote	4e-04
PRK12323		700	PRK12323, PRK12323, DNA polymerase III subunits ga	5e-04
PRK14971		614	PRK14971, PRK14971, DNA polymerase III subunits ga	5e-04
PRK11633		226	PRK11633, PRK11633, cell division protein DedD; Pr	5e-04
PHA02682		280	PHA02682, PHA02682, ORF080 virion core protein; Pr	5e-04
PRK09111		598	PRK09111, PRK09111, DNA polymerase III subunits ga	5e-04
pfam09770		804	pfam09770, PAT1, Topoisomerase II-associated prote	6e-04
PHA02682		280	PHA02682, PHA02682, ORF080 virion core protein; Pr	6e-04
PRK09111		598	PRK09111, PRK09111, DNA polymerase III subunits ga	6e-04
PRK03427		333	PRK03427, PRK03427, cell division protein ZipA; Pr	6e-04
COG3921		300	COG3921, COG3921, Uncharacterized protein conserve	7e-04
PRK14948		620	PRK14948, PRK14948, DNA polymerase III subunits ga	7e-04
pfam06346		160	pfam06346, Drf_FH1, Formin Homology Region 1	7e-04
PRK07994		647	PRK07994, PRK07994, DNA polymerase III subunits ga	8e-04
PRK07003		830	PRK07003, PRK07003, DNA polymerase III subunits ga	8e-04
PRK14951		618	PRK14951, PRK14951, DNA polymerase III subunits ga	0.001
PRK14950		585	PRK14950, PRK14950, DNA polymerase III subunits ga	0.001
PHA03247		3151	PHA03247, PHA03247, large tegument protein UL36; P	0.001
smart00818		165	smart00818, Amelogenin, Amelogenins, cell adhesion	0.001
PRK14948		620	PRK14948, PRK14948, DNA polymerase III subunits ga	0.001
pfam04625		407	pfam04625, DEC-1_N, DEC-1 protein, N-terminal regi	0.001
PRK14954		620	PRK14954, PRK14954, DNA polymerase III subunits ga	0.001
PRK14950		585	PRK14950, PRK14950, DNA polymerase III subunits ga	0.002
PRK12323		700	PRK12323, PRK12323, DNA polymerase III subunits ga	0.002
PHA03247		3151	PHA03247, PHA03247, large tegument protein UL36; P	0.002
PRK14971		614	PRK14971, PRK14971, DNA polymerase III subunits ga	0.002
pfam04652		315	pfam04652, DUF605, Vta1 like	0.002
pfam04652		315	pfam04652, DUF605, Vta1 like	0.002
PRK12270		1228	PRK12270, kgd, alpha-ketoglutarate decarboxylase;	0.003
PHA03247		3151	PHA03247, PHA03247, large tegument protein UL36; P	0.003
PRK07003		830	PRK07003, PRK07003, DNA polymerase III subunits ga	0.003
pfam07223		357	pfam07223, DUF1421, Protein of unknown function (D	0.003
PHA03247		3151	PHA03247, PHA03247, large tegument protein UL36; P	0.004
pfam03276		582	pfam03276, Gag_spuma, Spumavirus gag protein	0.004
PRK14963		504	PRK14963, PRK14963, DNA polymerase III subunits ga	0.004
pfam12526		115	pfam12526, DUF3729, Protein of unknown function (D	0.004

>gnl\|CDD\|240878 cd12432, RRM_ACINU, RNA recognition motif in apoptotic chromatin condensation inducer in the nucleus (acinus) and similar proteins	Back alignment and domain information

 Score =  135 bits (343), Expect = 6e-38
 Identities = 45/84 (53%), Positives = 61/84 (72%), Gaps = 3/84 (3%)

Query: 522 TNSLRIDHFVRPFTLRAVQELLGKTGTFT--SFWMDHIKTHCYVTYSSVEEAIETRNALY 579
           T +L ID+ VRPFTL  ++ELL +TGT     FWMD IK+HCYVTYS+VEEA+ TR AL+
Sbjct: 1   TRALHIDNLVRPFTLNQLKELLSETGTGVIEGFWMDKIKSHCYVTYSTVEEAVATREALH 60

Query: 580 NIQWPPNNGGRPLVAEFVDPQEVK 603
            +QWP +N  + L  +FV  +E++
Sbjct: 61  GLQWPSSN-PKRLKVDFVPQEELE 83

This subfamily corresponds to the RRM of Acinus, a caspase-3-activated nuclear factor that induces apoptotic chromatin condensation after cleavage by caspase-3 without inducing DNA fragmentation. It is essential for apoptotic chromatin condensation and may also participate in nuclear structural changes occurring in normal cells. Acinus contains a P-loop motif and an RNA recognition motif (RRM), also termed RBD (RNA binding domain) or RNP (ribonucleoprotein domain), which indicates Acinus might have ATPase and DNA/RNA-binding activity. . Length = 90

>gnl\|CDD\|202100 pfam02037, SAP, SAP domain	Back alignment and domain information

>gnl\|CDD\|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed	Back alignment and domain information

>gnl\|CDD\|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|128789 smart00513, SAP, Putative DNA-binding (bihelical) motif predicted to be involved in chromosomal organisation	Back alignment and domain information

>gnl\|CDD\|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP)	Back alignment and domain information

>gnl\|CDD\|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional	Back alignment and domain information

>gnl\|CDD\|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional	Back alignment and domain information

>gnl\|CDD\|197891 smart00818, Amelogenin, Amelogenins, cell adhesion proteins, play a role in the biomineralisation of teeth	Back alignment and domain information

>gnl\|CDD\|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>gnl\|CDD\|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional	Back alignment and domain information

>gnl\|CDD\|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional	Back alignment and domain information

>gnl\|CDD\|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional	Back alignment and domain information

>gnl\|CDD\|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|166942 PRK00404, tatB, sec-independent translocase; Provisional	Back alignment and domain information

>gnl\|CDD\|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional	Back alignment and domain information

>gnl\|CDD\|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional	Back alignment and domain information

>gnl\|CDD\|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP)	Back alignment and domain information

>gnl\|CDD\|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional	Back alignment and domain information

>gnl\|CDD\|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional	Back alignment and domain information

>gnl\|CDD\|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional	Back alignment and domain information

>gnl\|CDD\|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|236940 PRK11633, PRK11633, cell division protein DedD; Provisional	Back alignment and domain information

>gnl\|CDD\|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1	Back alignment and domain information

>gnl\|CDD\|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|236940 PRK11633, PRK11633, cell division protein DedD; Provisional	Back alignment and domain information

>gnl\|CDD\|177464 PHA02682, PHA02682, ORF080 virion core protein; Provisional	Back alignment and domain information

>gnl\|CDD\|236382 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1	Back alignment and domain information

>gnl\|CDD\|177464 PHA02682, PHA02682, ORF080 virion core protein; Provisional	Back alignment and domain information

>gnl\|CDD\|236382 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional	Back alignment and domain information

>gnl\|CDD\|226435 COG3921, COG3921, Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>gnl\|CDD\|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|148139 pfam06346, Drf_FH1, Formin Homology Region 1	Back alignment and domain information

>gnl\|CDD\|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional	Back alignment and domain information

>gnl\|CDD\|197891 smart00818, Amelogenin, Amelogenins, cell adhesion proteins, play a role in the biomineralisation of teeth	Back alignment and domain information

>gnl\|CDD\|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|113398 pfam04625, DEC-1_N, DEC-1 protein, N-terminal region	Back alignment and domain information

>gnl\|CDD\|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional	Back alignment and domain information

>gnl\|CDD\|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|218191 pfam04652, DUF605, Vta1 like	Back alignment and domain information

>gnl\|CDD\|218191 pfam04652, DUF605, Vta1 like	Back alignment and domain information

>gnl\|CDD\|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed	Back alignment and domain information

>gnl\|CDD\|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional	Back alignment and domain information

>gnl\|CDD\|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421)	Back alignment and domain information

>gnl\|CDD\|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional	Back alignment and domain information

>gnl\|CDD\|217469 pfam03276, Gag_spuma, Spumavirus gag protein	Back alignment and domain information

>gnl\|CDD\|184927 PRK14963, PRK14963, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|152960 pfam12526, DUF3729, Protein of unknown function (DUF3729)	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		724
KOG2416		718	consensus Acinus (induces apoptotic chromatin cond	100.0
PF00076		70	RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or	98.93
PLN03134		144	glycine-rich RNA-binding protein 4; Provisional	98.85
TIGR01661		352	ELAV_HUD_SF ELAV/HuD family splicing factor. These	98.85
PF13893		56	RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or	98.82
TIGR01642		509	U2AF_lg U2 snRNP auxilliary factor, large subunit,	98.67
smart00362		72	RRM_2 RNA recognition motif.	98.63
TIGR01661		352	ELAV_HUD_SF ELAV/HuD family splicing factor. These	98.62
TIGR01622		457	SF-CC1 splicing factor, CC1-like family. A homolog	98.58
PF14259		70	RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or	98.54
cd00590		74	RRM RRM (RNA recognition motif), also known as RBD	98.51
TIGR01659		346	sex-lethal sex-lethal family splicing factor. This	98.5
KOG0121		153	consensus Nuclear cap-binding protein complex, sub	98.48
TIGR01622		457	SF-CC1 splicing factor, CC1-like family. A homolog	98.46
TIGR01628		562	PABP-1234 polyadenylate binding protein, human typ	98.45
smart00360		71	RRM RNA recognition motif.	98.45
TIGR01649		481	hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor	98.45
TIGR01642		509	U2AF_lg U2 snRNP auxilliary factor, large subunit,	98.45
TIGR01649		481	hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor	98.43
KOG0114		124	consensus Predicted RNA-binding protein (RRM super	98.43
COG0724		306	RNA-binding proteins (RRM domain) [General functio	98.39
TIGR01659		346	sex-lethal sex-lethal family splicing factor. This	98.38
TIGR01628		562	PABP-1234 polyadenylate binding protein, human typ	98.38
PF02037		35	SAP: SAP domain; InterPro: IPR003034 The SAP (afte	98.36
PLN03120		260	nucleic acid binding protein; Provisional	98.36
KOG0122		270	consensus Translation initiation factor 3, subunit	98.29
TIGR01648		578	hnRNP-R-Q heterogeneous nuclear ribonucleoprotein	98.28
TIGR01645		612	half-pint poly-U binding splicing factor, half-pin	98.28
PLN03213		759	repressor of silencing 3; Provisional	98.27
TIGR01645		612	half-pint poly-U binding splicing factor, half-pin	98.27
KOG0125		376	consensus Ataxin 2-binding protein (RRM superfamil	98.11
smart00361		70	RRM_1 RNA recognition motif.	97.99
KOG0144		510	consensus RNA-binding protein CUGBP1/BRUNO (RRM su	97.94
smart00513		35	SAP Putative DNA-binding (bihelical) motif predict	97.92
KOG4661		940	consensus Hsp27-ERE-TATA-binding protein/Scaffold	97.92
PLN03121		243	nucleic acid binding protein; Provisional	97.87
TIGR01648		578	hnRNP-R-Q heterogeneous nuclear ribonucleoprotein	97.83
KOG0108		435	consensus mRNA cleavage and polyadenylation factor	97.83
KOG4207		256	consensus Predicted splicing factor, SR protein su	97.8
KOG0107		195	consensus Alternative splicing factor SRp20/9G8 (R	97.75
KOG4206		221	consensus Spliceosomal protein snRNP-U1A/U2B [RNA	97.69
KOG0144		510	consensus RNA-binding protein CUGBP1/BRUNO (RRM su	97.66
KOG4259		260	consensus Putative nucleic acid-binding protein Hc	97.55
KOG0130		170	consensus RNA-binding protein RBM8/Tsunagi (RRM su	97.51
KOG0148		321	consensus Apoptosis-promoting RNA-binding protein	97.5
KOG0117		506	consensus Heterogeneous nuclear ribonucleoprotein	97.45
PLN03124		643	poly [ADP-ribose] polymerase; Provisional	97.38
KOG0113		335	consensus U1 small nuclear ribonucleoprotein (RRM	97.29
KOG0146		371	consensus RNA-binding protein ETR-3 (RRM superfami	97.23
KOG4208		214	consensus Nucleolar RNA-binding protein NIFK [Gene	97.16
KOG0126		219	consensus Predicted RNA-binding protein (RRM super	97.15
KOG1457		284	consensus RNA binding protein (contains RRM repeat	97.15
KOG4212		608	consensus RNA-binding protein hnRNP-M [RNA process	97.1
KOG0111		298	consensus Cyclophilin-type peptidyl-prolyl cis-tra	97.1
KOG0127		678	consensus Nucleolar protein fibrillarin NOP77 (RRM	97.08
PF04059		97	RRM_2: RNA recognition motif 2; InterPro: IPR00720	97.02
KOG0123		369	consensus Polyadenylate-binding protein (RRM super	97.02
KOG0127		678	consensus Nucleolar protein fibrillarin NOP77 (RRM	97.0
KOG0117		506	consensus Heterogeneous nuclear ribonucleoprotein	96.99
KOG0145		360	consensus RNA-binding protein ELAV/HU (RRM superfa	96.93
KOG0132		894	consensus RNA polymerase II C-terminal domain-bind	96.93
KOG0110		725	consensus RNA-binding protein (RRM superfamily) [G	96.85
KOG0131		203	consensus Splicing factor 3b, subunit 4 [RNA proce	96.79
KOG0110		725	consensus RNA-binding protein (RRM superfamily) [G	96.78
KOG4660		549	consensus Protein Mei2, essential for commitment t	96.41
KOG0147		549	consensus Transcriptional coactivator CAPER (RRM s	96.36
KOG0123		369	consensus Polyadenylate-binding protein (RRM super	96.32
KOG0105		241	consensus Alternative splicing factor ASF/SF2 (RRM	96.01
KOG0120		500	consensus Splicing factor U2AF, large subunit (RRM	95.86
PF08777		105	RRM_3: RNA binding motif; InterPro: IPR014886 This	95.84
KOG0147		549	consensus Transcriptional coactivator CAPER (RRM s	95.83
KOG0153		377	consensus Predicted RNA-binding protein (RRM super	95.68
KOG0109		346	consensus RNA-binding protein LARK, contains RRM a	95.65
KOG1190		492	consensus Polypyrimidine tract-binding protein [RN	95.55
KOG0131		203	consensus Splicing factor 3b, subunit 4 [RNA proce	95.5
KOG0109		346	consensus RNA-binding protein LARK, contains RRM a	95.16
KOG0145		360	consensus RNA-binding protein ELAV/HU (RRM superfa	95.11
KOG0124		544	consensus Polypyrimidine tract-binding protein PUF	95.09
KOG4212		608	consensus RNA-binding protein hnRNP-M [RNA process	94.96
COG5175		480	MOT2 Transcriptional repressor [Transcription]	94.96
KOG0149		247	consensus Predicted RNA-binding protein SEB4 (RRM	94.88
KOG0148		321	consensus Apoptosis-promoting RNA-binding protein	94.69
KOG0146		371	consensus RNA-binding protein ETR-3 (RRM superfami	94.49
PF04847		184	Calcipressin: Calcipressin; InterPro: IPR006931 Ca	94.17
KOG1457		284	consensus RNA binding protein (contains RRM repeat	94.01
KOG4246		1194	consensus Predicted DNA-binding protein, contains	92.93
KOG0533		243	consensus RRM motif-containing protein [RNA proces	92.87
KOG0116		419	consensus RasGAP SH3 binding protein rasputin, con	92.73
KOG1190		492	consensus Polypyrimidine tract-binding protein [RN	92.09
PF04696		131	Pinin_SDK_memA: pinin/SDK/memA/ protein conserved	92.06
KOG2202		260	consensus U2 snRNP splicing factor, small subunit,	91.89
KOG1456		494	consensus Heterogeneous nuclear ribonucleoprotein	91.63
KOG0151		877	consensus Predicted splicing regulator, contains R	91.03
KOG4206		221	consensus Spliceosomal protein snRNP-U1A/U2B [RNA	90.98
KOG0415		479	consensus Predicted peptidyl prolyl cis-trans isom	90.71
PF14605		53	Nup35_RRM_2: Nup53/35/40-type RNA recognition moti	89.74
KOG0106		216	consensus Alternative splicing factor SRp55/B52/SR	89.67
KOG4209		231	consensus Splicing factor RNPS1, SR protein superf	89.55
PF11608		90	Limkain-b1: Limkain b1; InterPro: IPR024582 This e	89.2
KOG0120		500	consensus Splicing factor U2AF, large subunit (RRM	88.46
KOG0124		544	consensus Polypyrimidine tract-binding protein PUF	88.18
PF10309		62	DUF2414: Protein of unknown function (DUF2414); In	87.02
KOG4574		1007	consensus RNA-binding protein (contains RRM and Pu	86.38
KOG1924		1102	consensus RhoA GTPase effector DIA/Diaphanous [Sig	86.24
KOG4454		267	consensus RNA binding protein (RRM superfamily) [G	84.58
KOG4205		311	consensus RNA-binding protein musashi/mRNA cleavag	84.02
KOG4210		285	consensus Nuclear localization sequence binding pr	83.86
PF10208		154	Armet: Degradation arginine-rich protein for mis-f	82.52
KOG1855		484	consensus Predicted RNA-binding protein [General f	81.97
KOG4205		311	consensus RNA-binding protein musashi/mRNA cleavag	81.89
PF03467		176	Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120	80.23

>KOG2416 consensus Acinus (induces apoptotic chromatin condensation) [Chromatin structure and dynamics]	Back alignment and domain information

Probab=100.00  E-value=3.3e-73  Score=613.75  Aligned_cols=620  Identities=40%  Similarity=0.569  Sum_probs=400.8

Q ss_pred             CCCCCCCCCCCCCcccchhhHHHHHHHcccccCCchHHHHHHHHHHHHHHHHHhHHHHHH-----HHH-HHHhhhcCCCC
Q 004904            1 MSSPYPILDNRPIDQWKVTELKEELKRRKLKSSGKKDDLIRLLDQAIRIERENAEKEARK-----VAE-MEAAKDAFHGA   74 (724)
Q Consensus         1 mss~ypil~n~~~~~~kV~elk~el~~r~L~t~GlK~dL~~rL~~al~~e~~~~ekd~~~-----~a~-~~~~~~G~~~~   74 (724)
                      |+|||++|+|++|..|+|++|+++|++|+|.+.| |.+|..||.+++.+|....+-..++     .+. ..-...|.|.+
T Consensus         1 ~~sp~e~~~~~s~~p~~v~~~~~~~~~rk~~e~e-k~e~e~~~~a~~~~eec~k~p~~sq~~~~a~~~~~er~~~~ad~~   79 (718)
T KOG2416|consen    1 SSSPFEVLDNRSIDPWKVTELKEELKRRKLTERE-KEELERRLDAALRAEECEKEPINSQTVAAAEKANQERPVTVADRN   79 (718)
T ss_pred             CCCcccccCcCCCcchhHHHHHHHHHHhhhcccc-chhHHHHHHHhhhhhhcccCCchhHHHHHHhhhhhhccccccCcc
Confidence            8999999999999999999999999999999999 9999999999999988655533331     111 22233444422


Q ss_pred             CCCCCCcc--------cccccceeeccccccccchhhccccccccceeeecccCCC-CCCCCCCCCCcccccCCCCchhh
Q 004904           75 NITSQPVV--------EVKDAEVSVGSETAKDVLDVDAKRNEKVENVVVQLDINSF-APGFGPGEHQERDIRGDNNENVA  145 (724)
Q Consensus        75 ~~~~ds~~--------~~~~a~v~~~~~t~~~~~~~~~~~~~~~~~vv~~~d~~~~-~~~~~~~~~k~~~~~~~~~~~~s  145 (724)
                      -..+.+-.        .-+|+++. ..     +   .+++..+....-+.+..++. .+-..|-+           .+.+
T Consensus        80 ~~~~~s~~~~~~rtes~~~d~~~~-~~-----p---~~~~~~~~dva~~~t~~~p~~~pp~~n~s-----------~ses  139 (718)
T KOG2416|consen   80 QTTPVSPVEAAFRTESTPVDAEKT-PE-----P---TQTKITTEDVAGVETTPAPVFSPPEVNAS-----------PSES  139 (718)
T ss_pred             ccCCCCccccccccccCCCCcCCC-CC-----C---cccccccccccccccccCcccCCcccccC-----------cccc
Confidence            21222111        11222221 00     0   01111111111111111110 00000000           1112


Q ss_pred             hhcccccccccccCCCCCCccCccccccceeeeecceeccceeeeeeecCCccccchhhhhhhhccccccCCCCcCCCCC
Q 004904          146 ALGQEKFQEGDMTGSINPARADDELGLQATTVETSTKLTENVVTEVALSGHTTVTESVVTEVAMSGQELQNSGTHGENVN  225 (724)
Q Consensus       146 ~~~qe~~~~~~~~g~~~~~~~~~~~~~~~~~~~t~~~~~~~v~~ev~~~~~~~~~d~~~~e~~~~~~~~~~~~~~~~~~~  225 (724)
                      ..+.+.-+.++..|....+.                                 .-|.+. |.         .-++.++..
T Consensus       140 r~~~~~~~a~dd~~~dsp~v---------------------------------srd~~v-E~---------ke~ks~qev  176 (718)
T KOG2416|consen  140 REDEKEKDARDDAGLDSPVV---------------------------------SRDAQV-ES---------KEHKSEQEV  176 (718)
T ss_pred             hhhhhhhhhhhhhccccccc---------------------------------cccchh-hh---------ccccccccC
Confidence            22222224444444422211                                 111111 11         113344444


Q ss_pred             ccccccccCCCcccccCCCCCCCCccccccCCCCCCccccccccCcceeecccccCcccccccccccccccccccccccc
Q 004904          226 TNIQLENEDSKPQLENEGLKTPHREDVLDATAPENQVSEVSAILGSQVKSDSISTDSISINEKIELKDNIIADNVKLELD  305 (724)
Q Consensus       226 ~~~~l~~~~~k~~l~n~~~k~~~~~~~~~~s~~~nqvsev~p~lg~qvk~~sistd~vsin~k~elkd~~~a~nv~le~~  305 (724)
                      +...++....+         -|.+.++..++.+.||++++.++-|+-|++++|+.++++.|.+.+++++-+|+|+.|.+.
T Consensus       177 pTsgvd~~~q~---------ep~ee~~~~sss~~~~e~~~i~s~~l~vqs~~~~Er~~~~~~eAe~~etk~a~~~q~kq~  247 (718)
T KOG2416|consen  177 PTSGVDGGDQK---------EPPEEAVLESSSMYNQESEVIPSTGLEVQSDCISERSVSNNEEAELKETKIADNVQLKQN  247 (718)
T ss_pred             CCCCCcccccc---------cchhhhccCCCchhhhhccCCccchhhhhhhhhhcccccccccccccCCccccccchhhc
Confidence            44445444433         345788889999999999999999999999999999999999999999999999999998


Q ss_pred             cccCCcccCCCCCcccCCCCCcCCCCCchhhhcccccccCccchhhhccccccCCCCcCCcccccCCCCCC--CCcccch
Q 004904          306 VNKSGMVEPSSGNVTAVGGESHPMDVEDPLEEKASVDEKDDNIATIAVMGKKIDSVDMGYSEKLNLDRSSG--DDSMEDD  383 (724)
Q Consensus       306 ~~k~~~v~pss~~~~~~g~~~~~~d~~~~~e~~~s~~~~~~~~~~~~~~~~~~~~~d~g~~eklnldrssg--d~smeed  383 (724)
                      ..+++-  ++.     +-++.|.|+.+.+++.++.+..  .-.-....|-+.......|.++++|++|..|  |.||| +
T Consensus       248 q~s~~e--est-----~~he~~de~pE~~~e~~ad~~d--~pdP~k~s~v~~t~g~Pa~~se~~~rkrkw~~~d~s~e-~  317 (718)
T KOG2416|consen  248 QNSFQE--EST-----VVHESHDEDPEEPLEQKADVGD--GPDPAKASMVKETNGIPAGDSEKLNRKRKWGEKDESME-D  317 (718)
T ss_pred             cccccC--Ccc-----cccccCCCCcccCCCcccccCC--CCchhhhhhhccCCCCCCcccccccccccccccccccc-c
Confidence            765554  554     4469999999999999999984  4444778888999999999999999999999  99999 8


Q ss_pred             hhhhhcccCCCCchhhhcccccCCcccccccCCcccccCCccccccccccCCCCCCCCchhhccc--cccccccCCCchh
Q 004904          384 VLESKQIDSKDSSDEVRNRTEKNDVPVVKEESPVDVVGDGLSADIKHADVDDKSCPVIPAEKRKI--NDQEAVGNNEPSK  461 (724)
Q Consensus       384 ~~e~kq~ds~~~~d~~~~~~e~~~~~~~ke~~~~~~v~~~~s~~~~~~~~~~~~~~~~~~ekrk~--~~~~~v~n~ep~k  461 (724)
                      -++.+||....-.|-    +-..+. .++|+   .++-...+.++.+...+.    ..-+.++++  ++|+.+|++++.|
T Consensus       318 ~pe~~~ieT~slkd~----iadie~-~~~ee---~V~le~ageeE~e~n~D~----~~rs~~p~~paegqe~~~rdeeek  385 (718)
T KOG2416|consen  318 EPETKQIETISLKDK----IADIEM-LSKEE---SVALEDAGEEESEENKDH----LVRSDKPKLPAEGQEAVGRDEEEK  385 (718)
T ss_pred             CCccccccchhhccc----chhhhc-cCcch---hhhhhccccccCCccccc----hhhccCCCCCccccccccccchhh
Confidence            899999876543332    222212 23332   222222233333322222    112333333  7899999999999


Q ss_pred             hhhhcccCCCCCCCccCCC---CCCCCCCCccccccccccCCCCCCCCCCCccccCCCCCCCCCceEeecccCCCCCHHH
Q 004904          462 RQRRWNSESLKLPEQQSTT---PSSTPRDTLQPSMKRNFSRSDSAVSDDTPKERIVPPSPKSPTNSLRIDHFVRPFTLRA  538 (724)
Q Consensus       462 rqrrwn~~~~k~~~~~~~~---~~~tp~d~~~~~lrrs~sR~~S~~~~d~p~er~VpPs~hPpT~aLyI~NLvRPFT~~q  538 (724)
                      +| +||+...+++..+-..   |+.++.+.   -+...+++....++.+ +.+|..+|+++++|++|||+||+||||+.|
T Consensus       386 e~-~~~~~~~~~~a~~e~v~a~ppa~~e~k---~~~v~~s~~~rsvS~~-~~~RvpSPsR~~~SnvlhI~nLvRPFTlgQ  460 (718)
T KOG2416|consen  386 ER-RWNSNSIKVPAAQETVSATPPATPESK---GLKVDFSRSDRSVSED-PKERVPSPSRKEPSNVLHIDNLVRPFTLGQ  460 (718)
T ss_pred             hc-CcccccCCCchhhccccCCCCCCcccc---ccccccchhhhhhccC-ccccCCCCCCCCccceEeeecccccchHHH
Confidence            86 6999999999998876   55565543   3777788887777654 778989999999999999999999999999


Q ss_pred             HHHHhcCcC-CeeEEEecCccceEEEEecCHHHHHHHHHHhcCCcCCCCCCCCcEEEeecChhhhhhhccCCC---CCCC
Q 004904          539 VQELLGKTG-TFTSFWMDHIKTHCYVTYSSVEEAIETRNALYNIQWPPNNGGRPLVAEFVDPQEVKMRTEAPP---PSPA  614 (724)
Q Consensus       539 LkElLsetG-tI~~FWLD~IKSHCYVtFsSVEeA~aARsALhG~vWP~en~gR~LrVDFv~pEeV~~~Ie~e~---~~~a  614 (724)
                      |++||+++| .|+.||||+|||||||+|+|+++|.++|.||||++||++ |+|.|.+||...++|..++..-.   +..+
T Consensus       461 LkelL~rtgg~Vee~WmDkIKShCyV~yss~eEA~atr~AlhnV~WP~s-NPK~L~adf~~~deld~hr~~led~~ae~~  539 (718)
T KOG2416|consen  461 LKELLGRTGGNVEEFWMDKIKSHCYVSYSSVEEAAATREALHNVQWPPS-NPKHLIADFVRADELDKHRNGLEDLEAELP  539 (718)
T ss_pred             HHHHHhhccCchHHHHHHHhhcceeEecccHHHHHHHHHHHhccccCCC-CCceeEeeecchhHHHHHhccchhcccccc
Confidence            999999765 566999999999999999999999999999999999999 57789999999999997653321   1111


Q ss_pred             CC------CCCCCCCCCCCCCCCCCCCCCCCccccccCCCC--CCC--------------------------CCCCCCCC
Q 004904          615 AP------VSTGSAAPAPAAAPTSQPQPSPRQPAARQQLPP--PPT--------------------------LPPPPPIS  660 (724)
Q Consensus       615 A~------~s~~~t~pa~ap~p~~q~epsp~~~~~R~q~p~--p~s--------------------------lPppp~~~  660 (724)
                      ..      ...++.+...++.++.+. |.+.....|.+..+  ++.                          --.||.-+
T Consensus       540 ~e~~~~~~~~g~~~~~~qp~~q~v~r-p~~~~d~~rk~pra~~~h~~eR~r~~~~r~d~rs~e~er~~~r~k~~~~p~sR  618 (718)
T KOG2416|consen  540 KEGGGSQSSIGGPQPQHQPQAQTVSR-PNPPTDLPRKPPRAKPPHVVERLRNKDQRKDERSDEKERDRKRKKSETPPFSR  618 (718)
T ss_pred             cccCcccccccCCcccCCCCCCCCCC-CCCccccCCCCcccCchhhhhhhhhhhhhhhhhhhhhhhhhhhhhcccCcccc
Confidence            00      001222221111111000 00000000000000  000                          00011000


Q ss_pred             CCcccccccC-------CCCCCCCCC--CCCCCccchhhhhhhhcCCCceeeeeCCHHHHHHHHHHhhhcc
Q 004904          661 NQAPARERFT-------LPPPPPLPE--KLDPPIVTLDDLFRKTKATPRIYYLPLSEEQVAAKLEARSKSS  722 (724)
Q Consensus       661 ~~p~~REr~~-------~p~ppp~p~--k~EpP~ktLDdLFRKTka~P~IYyLPLSeeqVa~Klaa~~k~~  722 (724)
                      --.-.|||..       -+-+|+.++  +.|||+++||||||||+|.|||||||||++||++|+|++++..
T Consensus       619 gr~r~rerl~Rn~~a~sr~~~p~skek~EeEpPiklLDdLFkKTka~PcIYyLPLTeEqIAaKEAer~~k~  689 (718)
T KOG2416|consen  619 GRGRMRERLPRNEEAESRPEPPPSKEKEEEEPPIKLLDDLFKKTKAIPCIYYLPLTEEQIAAKEAERNNKG  689 (718)
T ss_pred             cchhhhhhccchhhhhccCCCCCccchhhcCcchhHHHHHHHhcccCCceeeecCCHHHHHHHHHHHhhhh
Confidence            0001122211       021333333  4679999999999999999999999999999999999987653

>PF00076 RRM_1: RNA recognition motif	Back alignment and domain information

>PLN03134 glycine-rich RNA-binding protein 4; Provisional	Back alignment and domain information

>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor	Back alignment and domain information

>PF13893 RRM_5: RNA recognition motif	Back alignment and domain information

>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor	Back alignment and domain information

>smart00362 RRM_2 RNA recognition motif	Back alignment and domain information

>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor	Back alignment and domain information

>TIGR01622 SF-CC1 splicing factor, CC1-like family	Back alignment and domain information

>PF14259 RRM_6: RNA recognition motif (a	Back alignment and domain information

>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability	Back alignment and domain information

>TIGR01659 sex-lethal sex-lethal family splicing factor	Back alignment and domain information

>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>TIGR01622 SF-CC1 splicing factor, CC1-like family	Back alignment and domain information

>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family	Back alignment and domain information

>smart00360 RRM RNA recognition motif	Back alignment and domain information

>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family	Back alignment and domain information

>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor	Back alignment and domain information

>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family	Back alignment and domain information

>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>COG0724 RNA-binding proteins (RRM domain) [General function prediction only]	Back alignment and domain information

>TIGR01659 sex-lethal sex-lethal family splicing factor	Back alignment and domain information

>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family	Back alignment and domain information

>PF02037 SAP: SAP domain; InterPro: IPR003034 The SAP (after SAF-A/B, Acinus and PIAS) motif is a putative DNA binding domain found in diverse nuclear proteins involved in chromosomal organisation [], including in apoptosis []	Back alignment and domain information

>PLN03120 nucleic acid binding protein; Provisional	Back alignment and domain information

>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family	Back alignment and domain information

>TIGR01645 half-pint poly-U binding splicing factor, half-pint family	Back alignment and domain information

>PLN03213 repressor of silencing 3; Provisional	Back alignment and domain information

>TIGR01645 half-pint poly-U binding splicing factor, half-pint family	Back alignment and domain information

>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>smart00361 RRM_1 RNA recognition motif	Back alignment and domain information

>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>smart00513 SAP Putative DNA-binding (bihelical) motif predicted to be involved in chromosomal organisation	Back alignment and domain information

>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription]	Back alignment and domain information

>PLN03121 nucleic acid binding protein; Provisional	Back alignment and domain information

>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family	Back alignment and domain information

>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification]	Back alignment and domain information

>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification]	Back alignment and domain information

>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification]	Back alignment and domain information

>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG4259 consensus Putative nucleic acid-binding protein Hcc-1/proliferation associated cytokine-inducible protein, contains SAP domain [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>PLN03124 poly [ADP-ribose] polymerase; Provisional	Back alignment and domain information

>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only]	Back alignment and domain information

>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only]	Back alignment and domain information

>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification]	Back alignment and domain information

>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2	Back alignment and domain information

>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription]	Back alignment and domain information

>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification]	Back alignment and domain information

>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription]	Back alignment and domain information

>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation	Back alignment and domain information

>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription]	Back alignment and domain information

>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only]	Back alignment and domain information

>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification]	Back alignment and domain information

>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification]	Back alignment and domain information

>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only]	Back alignment and domain information

>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification]	Back alignment and domain information

>COG5175 MOT2 Transcriptional repressor [Transcription]	Back alignment and domain information

>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells	Back alignment and domain information

>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only]	Back alignment and domain information

>KOG4246 consensus Predicted DNA-binding protein, contains SAP domain [General function prediction only]	Back alignment and domain information

>KOG0533 consensus RRM motif-containing protein [RNA processing and modification]	Back alignment and domain information

>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms]	Back alignment and domain information

>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification]	Back alignment and domain information

>PF04696 Pinin_SDK_memA: pinin/SDK/memA/ protein conserved region; InterPro: IPR006786 This conserved region is located adjacent and C-terminal to a N-terminal pinin/SKD domain IPR006787 from INTERPRO	Back alignment and domain information

>KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification]	Back alignment and domain information

>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification]	Back alignment and domain information

>KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only]	Back alignment and domain information

>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification]	Back alignment and domain information

>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif	Back alignment and domain information

>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification]	Back alignment and domain information

>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes	Back alignment and domain information

>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function	Back alignment and domain information

>KOG4574 consensus RNA-binding protein (contains RRM and Pumilio-like repeats) [General function prediction only]	Back alignment and domain information

>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification]	Back alignment and domain information

>KOG4210 consensus Nuclear localization sequence binding protein [Transcription]	Back alignment and domain information

>PF10208 Armet: Degradation arginine-rich protein for mis-folding; InterPro: IPR019345 This entry represents Armet proteins (aka mesencephalic astrocyte-derived neurotrophic factor or arginine-rich protein)	Back alignment and domain information

>KOG1855 consensus Predicted RNA-binding protein [General function prediction only]	Back alignment and domain information

>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification]	Back alignment and domain information

>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		724
4a8x_B		40	HOOK-like, isoform A; transcription, splicing, RNA	4e-12
3v1v_A		433	2-MIB synthase, 2-methylisoborneol synthase; class	9e-08
3v1v_A		433	2-MIB synthase, 2-methylisoborneol synthase; class	1e-06
3v1v_A		433	2-MIB synthase, 2-methylisoborneol synthase; class	6e-06
3v1v_A		433	2-MIB synthase, 2-methylisoborneol synthase; class	2e-05
3pgw_B		231	SM B; protein-RNA complex, U1 snRNA, SM fold, SM c	9e-07
3pgw_B		231	SM B; protein-RNA complex, U1 snRNA, SM fold, SM c	3e-06
3pgw_B		231	SM B; protein-RNA complex, U1 snRNA, SM fold, SM c	8e-06
3pgw_B		231	SM B; protein-RNA complex, U1 snRNA, SM fold, SM c	9e-05
3pgw_B		231	SM B; protein-RNA complex, U1 snRNA, SM fold, SM c	4e-04
3pgw_B		231	SM B; protein-RNA complex, U1 snRNA, SM fold, SM c	5e-04
3pgw_B		231	SM B; protein-RNA complex, U1 snRNA, SM fold, SM c	8e-04
1zrj_A		50	E1B-55KDA-associated protein 5 isoform C; SAP doma	7e-06
3q2s_C		229	Cleavage and polyadenylation specificity factor S;	7e-06
1m2v_B		926	SEC24, protein transport protein SEC24, SEC24P, SE	9e-06
1m2v_B		926	SEC24, protein transport protein SEC24, SEC24P, SE	1e-05
1m2v_B		926	SEC24, protein transport protein SEC24, SEC24P, SE	2e-05
1m2v_B		926	SEC24, protein transport protein SEC24, SEC24P, SE	3e-05
1m2v_B		926	SEC24, protein transport protein SEC24, SEC24P, SE	5e-05
1m2v_B		926	SEC24, protein transport protein SEC24, SEC24P, SE	5e-05
1m2v_B		926	SEC24, protein transport protein SEC24, SEC24P, SE	7e-05
1m2v_B		926	SEC24, protein transport protein SEC24, SEC24P, SE	8e-05
1m2v_B		926	SEC24, protein transport protein SEC24, SEC24P, SE	9e-05
1m2v_B		926	SEC24, protein transport protein SEC24, SEC24P, SE	2e-04
1m2v_B		926	SEC24, protein transport protein SEC24, SEC24P, SE	6e-04
1m2v_B		926	SEC24, protein transport protein SEC24, SEC24P, SE	7e-04
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-05
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	4e-04
2z73_A		448	Rhodopsin; visual pigment, GQ-type, G-protein coup	3e-05
2cq2_A		114	Hypothetical protein LOC91801; RRM domain, structu	4e-05
3tht_A		345	Alkylated DNA repair protein ALKB homolog 8; struc	2e-04
2grx_C		229	Protein TONB; beta barrel, outer membrane, heteroc	6e-04
2grx_C		229	Protein TONB; beta barrel, outer membrane, heteroc	7e-04
2grx_C		229	Protein TONB; beta barrel, outer membrane, heteroc	9e-04
2kvu_A		75	MKL/myocardin-like protein 1; SAP motif, DNA/RNA b	9e-04

>4a8x_B HOOK-like, isoform A; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Drosophila melanogaster} Length = 40	Back alignment and structure

 Score = 60.2 bits (145), Expect = 4e-12
 Identities = 23/40 (57%), Positives = 29/40 (72%)

Query: 679 EKLDPPIVTLDDLFRKTKATPRIYYLPLSEEQVAAKLEAR 718
           ++ +PPI  LDDLFRKTK TP IY+LPL+ E +A K   R
Sbjct: 1   KENEPPIRLLDDLFRKTKGTPCIYWLPLTPEAIAEKEAFR 40

PyMOL of 4a8x

>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433	Back alignment and structure

>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433	Back alignment and structure

>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433	Back alignment and structure

>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433	Back alignment and structure

>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231	Back alignment and structure

>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231	Back alignment and structure

>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231	Back alignment and structure

>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231	Back alignment and structure

>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231	Back alignment and structure

>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231	Back alignment and structure

>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231	Back alignment and structure

>1zrj_A E1B-55KDA-associated protein 5 isoform C; SAP domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.140.2.1 Length = 50	Back alignment and structure

>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229	Back alignment and structure

>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926	Back alignment and structure

>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926	Back alignment and structure

>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926	Back alignment and structure

>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926	Back alignment and structure

>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926	Back alignment and structure

>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926	Back alignment and structure

>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926	Back alignment and structure

>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926	Back alignment and structure

>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926	Back alignment and structure

>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926	Back alignment and structure

>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926	Back alignment and structure

>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448	Back alignment and structure

>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114	Back alignment and structure

>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Length = 345	Back alignment and structure

>2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229	Back alignment and structure

>2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229	Back alignment and structure

>2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229	Back alignment and structure

>2kvu_A MKL/myocardin-like protein 1; SAP motif, DNA/RNA binding, structural genomics, northeast structural genomics consortium (NESG), PSI-2; NMR {Homo sapiens} PDB: 2kw9_A Length = 75	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		724
4a8x_B		40	HOOK-like, isoform A; transcription, splicing, RNA	99.58
2wbr_A		89	GW182, gawky, LD47780P; DNA-binding protein, RRM,	99.34
1why_A		97	Hypothetical protein riken cDNA 1810017N16; RNA re	99.32
2ytc_A		85	PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s	99.3
2cpj_A		99	Non-POU domain-containing octamer-binding protein;	99.29
1p27_B		106	RNA-binding protein 8A; nuclear protein, mRNA spli	99.29
2dnz_A		95	Probable RNA-binding protein 23; RNA recognition m	99.29
2la6_A		99	RNA-binding protein FUS; structural genomics, nort	99.28
2cph_A		107	RNA binding motif protein 19; RNA recognition moti	99.28
2dnm_A		103	SRP46 splicing factor; RRM domain, RBD, structural	99.28
3lqv_A		115	PRE-mRNA branch site protein P14; cysless mutant,	99.28
2e5h_A		94	Zinc finger CCHC-type and RNA-binding motif- conta	99.27
1x4a_A		109	Splicing factor, arginine/serine-rich 1 (splicing	99.27
2dnh_A		105	Bruno-like 5, RNA binding protein; RRM domain, RBD	99.27
1x5u_A		105	Splicing factor 3B subunit 4 (spliceosome associat	99.27
3mdf_A		85	Peptidyl-prolyl CIS-trans isomerase E; RRM domain,	99.27
1x5p_A		97	Negative elongation factor E; structure genomics,	99.27
2dnq_A		90	RNA-binding protein 4B; RRM domain,RBD, structural	99.27
4fxv_A		99	ELAV-like protein 1; RNA recognition motif, putati	99.26
2cqc_A		95	Arginine/serine-rich splicing factor 10; RNA recog	99.26
2dgv_A		92	HnRNP M, heterogeneous nuclear ribonucleoprotein M	99.25
2dgs_A		99	DAZ-associated protein 1; RRM domain, structural g	99.25
1nu4_A		97	U1A RNA binding domain; RNA recognition motif, U1	99.25
3r27_A		100	HnRNP L, heterogeneous nuclear ribonucleoprotein L	99.24
1wex_A		104	Hypothetical protein (riken cDNA 2810036L13); stru	99.24
2la4_A		101	Nuclear and cytoplasmic polyadenylated RNA-bindin	99.24
2dgt_A		92	RNA-binding protein 30; RRM domain, structural gen	99.24
2do4_A		100	Squamous cell carcinoma antigen recognized by T- c	99.24
2xnq_A		97	Nuclear polyadenylated RNA-binding protein 3; tran	99.23
2dgp_A		106	Bruno-like 4, RNA binding protein; RRM domain, str	99.23
2kvi_A		96	Nuclear polyadenylated RNA-binding protein 3; RNA-	99.23
2do0_A		114	HnRNP M, heterogeneous nuclear ribonucleoprotein M	99.23
2cqb_A		102	Peptidyl-prolyl CIS-trans isomerase E; RNA recogni	99.22
2d9p_A		103	Polyadenylate-binding protein 3; RRM domain, struc	99.22
2x1f_A		96	MRNA 3'-END-processing protein RNA15; transcriptio	99.22
3bs9_A		87	Nucleolysin TIA-1 isoform P40; RNA recognition mot	99.22
2cq3_A		103	RNA-binding protein 9; RRM domain, structural geno	99.21
3ex7_B		126	RNA-binding protein 8A; protein-RNA complex, mRNA	99.21
3ulh_A		107	THO complex subunit 4; nuclear protein, RNA bindin	99.21
2dnp_A		90	RNA-binding protein 14; RRM domain, RBD, structura	99.21
3md1_A		83	Nuclear and cytoplasmic polyadenylated RNA-bindin	99.21
1whw_A		99	Hypothetical protein riken cDNA 1200009A02; RNA re	99.21
1oo0_B		110	CG8781-PA, drosophila Y14; RNA recognition motif,	99.21
4a8x_A		88	RNA-binding protein with serine-rich domain 1; tra	99.2
1wi8_A		104	EIF-4B, eukaryotic translation initiation factor 4	99.2
2cq0_A		103	Eukaryotic translation initiation factor 3 subunit	99.2
2cpf_A		98	RNA binding motif protein 19; RNA recognition moti	99.2
1x4h_A		111	RNA-binding protein 28; structural genomics, RRM d	99.2
2dgu_A		103	Heterogeneous nuclear ribonucleoprotein Q; RRM dom	99.2
3s8s_A		110	Histone-lysine N-methyltransferase SETD1A; chromat	99.2
2pe8_A		105	Splicing factor 45; RRM, protein binding; 2.00A {H	99.2
2e5j_A		97	Methenyltetrahydrofolate synthetase domain contain	99.19
1x5s_A		102	Cold-inducible RNA-binding protein; structure geno	99.19
2cpz_A		115	CUG triplet repeat RNA-binding protein 1; RRM doma	99.19
1x4g_A		109	Nucleolysin TIAR; structural genomics, RRM domain,	99.19
1whx_A		111	Hypothetical protein riken cDNA 1200009A02; RNA re	99.19
2jrs_A		108	RNA-binding protein 39; RNA binding motif of RBM39	99.19
1p1t_A		104	Cleavage stimulation factor, 64 kDa subunit; RNA r	99.19
2ywk_A		95	Putative RNA-binding protein 11; RRM-domain, struc	99.18
2cqi_A		103	Nucleolysin TIAR; RNA recognition motif, RRM, RNA	99.18
2cq1_A		101	PTB-like protein L; RRM domain, structural genomic	99.18
2bz2_A		121	Negative elongation factor E; NELF E, RNA recognit	99.18
1x5o_A		114	RNA binding motif, single-stranded interacting pro	99.17
2kt5_A		124	RNA and export factor-binding protein 2; chaperone	99.17
2div_A		99	TRNA selenocysteine associated protein; structural	99.17
2khc_A		118	Testis-specific RNP-type RNA binding protein; RRM,	99.17
2cq2_A		114	Hypothetical protein LOC91801; RRM domain, structu	99.17
1x5t_A		96	Splicing factor 3B subunit 4; structure genomics,	99.17
2jvo_A		108	Nucleolar protein 3; nucleus, phosphorylation, rib	99.16
2dgx_A		96	KIAA0430 protein; RRM domain, structural genomics,	99.16
2kxn_B		129	Transformer-2 protein homolog beta; SR protein, RR	99.16
1wf1_A		110	RNA-binding protein RALY; structural genomics, RRM	99.16
2dgo_A		115	Cytotoxic granule-associated RNA binding protein 1	99.16
2cpd_A		99	Apobec-1 stimulating protein; RNA recognition moti	99.16
2lxi_A		91	RNA-binding protein 10; NMR {Homo sapiens}	99.16
2e44_A		96	Insulin-like growth factor 2 mRNA binding protein	99.16
3ns6_A		100	Eukaryotic translation initiation factor 3 subuni;	99.15
2dis_A		109	Unnamed protein product; structural genomics, RRM	99.15
2lkz_A		95	RNA-binding protein 5; RRM; NMR {Homo sapiens}	99.14
2err_A		109	Ataxin-2-binding protein 1; protein-RNA complex, R	99.14
2ad9_A		119	Polypyrimidine tract-binding protein 1; RBD, RRM,	99.13
2cpe_A		113	RNA-binding protein EWS; RNA recognition motif, RR	99.13
2dng_A		103	Eukaryotic translation initiation factor 4H; RRM d	99.13
2ek1_A		95	RNA-binding protein 12; RNA recognition motif, dim	99.13
2a3j_A		127	U1 small nuclear ribonucleoprotein A; computationa	99.13
1rk8_A		165	CG8781-PA, CG8781-PA protein; mRNA processing, RRM	99.13
4f25_A		115	Polyadenylate-binding protein 1; RRM fold, transla	99.13
2nlw_A		105	Eukaryotic translation initiation factor 3 subunit	99.13
2cqh_A		93	IGF-II mRNA-binding protein 2 isoform A; RNA recog	99.12
2cpx_A		115	Hypothetical protein FLJ11016; RRM domain, structu	99.12
1x4d_A		102	Matrin 3; structural genomics, RRM domain, NPPSFA,	99.12
2ku7_A		140	MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio	99.12
1h2v_Z		156	20 kDa nuclear CAP binding protein; CAP-binding-co	99.12
1wg1_A		88	KIAA1579 protein, homolog EXC-7; RBD, structural g	99.12
2j76_E		100	EIF-4B, EIF4B, eukaryotic translation initiation f	99.11
2dit_A		112	HIV TAT specific factor 1 variant; structural geno	99.11
2dhg_A		104	TRNA selenocysteine associated protein (SECP43); R	99.11
1u6f_A		139	Tcubp1, RNA-binding protein UBP1; trypanosome, mRN	99.1
2cq4_A		114	RNA binding motif protein 23; RRM domain, structur	99.1
2i2y_A		150	Fusion protein consists of immunoglobin G- binding	99.1
2m2b_A		131	RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio	99.09
3zzy_A		130	Polypyrimidine tract-binding protein 1; protein bi	99.09
2cqd_A		116	RNA-binding region containing protein 1; RNA recog	99.09
2fc9_A		101	NCL protein; structure genomics, RRM_1 domain, str	99.08
3p5t_L		90	Cleavage and polyadenylation specificity factor S;	99.08
1x4c_A		108	Splicing factor, arginine/serine-rich 1; structura	99.08
1x4f_A		112	Matrin 3; structural genomics, RRM domain, NPPSFA,	99.08
1sjq_A		105	Polypyrimidine tract-binding protein 1; babbab mot	99.07
3v4m_A		105	Splicing factor U2AF 65 kDa subunit; canonical RNA	99.07
2hvz_A		101	Splicing factor, arginine/serine-rich 7; RRM, RNA	99.07
2e5i_A		124	Heterogeneous nuclear ribonucleoprotein L-like; RR	99.06
2cqp_A		98	RNA-binding protein 12; RNA recognition motif, RRM	99.06
1x4e_A		85	RNA binding motif, single-stranded interacting pro	99.06
3nmr_A		175	Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl	99.05
3n9u_C		156	Cleavage and polyadenylation specificity factor S;	99.05
2kn4_A		158	Immunoglobulin G-binding protein G, splicing FACT	99.05
2cpy_A		114	RNA-binding protein 12; RRM domain, structural gen	99.05
2fy1_A		116	RNA-binding motif protein, Y chromosome, family 1	99.05
1fjc_A		96	Nucleolin RBD2, protein C23; RNP, RRM, RNA binding	99.05
2krb_A		81	Eukaryotic translation initiation factor 3 subunit	99.05
1wel_A		124	RNA-binding protein 12; structural genomics, NPPSF	99.05
3ue2_A		118	Poly(U)-binding-splicing factor PUF60; RNA recogni	99.05
2cpi_A		111	CCR4-NOT transcription complex subunit 4; RNA reco	99.04
3ucg_A		89	Polyadenylate-binding protein 2; ferredoxin-like,	99.04
2lea_A		135	Serine/arginine-rich splicing factor 2; SR protein	99.04
2ki2_A		90	SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA	99.03
3md3_A		166	Nuclear and cytoplasmic polyadenylated RNA-bindin	99.03
2fc8_A		102	NCL protein; structure genomics, RRM_1 domain, str	99.03
3egn_A		143	RNA-binding protein 40; RNA recognition motif (RRM	99.03
2hzc_A		87	Splicing factor U2AF 65 kDa subunit; RNA splicing,	99.02
3s7r_A		87	Heterogeneous nuclear ribonucleoprotein A/B; ferre	99.01
2qfj_A		216	FBP-interacting repressor; protein-DNA complex; HE	99.0
2f3j_A		177	RNA and export factor binding protein 2; RRM domai	99.0
1sjr_A		164	Polypyrimidine tract-binding protein 1; extended b	99.0
2e5g_A		94	U6 snRNA-specific terminal uridylyltransferase 1;	98.99
2dh8_A		105	DAZ-associated protein 1; RRM domain, structural g	98.99
2jwn_A		124	Embryonic polyadenylate-binding protein 2-B; epabp	98.99
3s6e_A		114	RNA-binding protein 39; ferredoxin-like, structura	98.99
4f02_A		213	Polyadenylate-binding protein 1; mRNA, eukaryotic	98.98
2db1_A		118	Heterogeneous nuclear ribonucleoprotein F; RRM dom	98.98
2adc_A		229	Polypyrimidine tract-binding protein 1; RBD, RRM,	98.98
3pgw_S		437	U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM	98.97
1s79_A		103	Lupus LA protein; RRM, alpha/beta, RNA binding pro	98.97
3tht_A		345	Alkylated DNA repair protein ALKB homolog 8; struc	98.96
1qm9_A		198	Polypyrimidine tract-binding protein; ribonucleopr	98.96
2dgw_A		91	Probable RNA-binding protein 19; RRM domain, struc	98.95
2cqg_A		103	TDP-43, TAR DNA-binding protein-43; RNA recognitio	98.95
2mss_A		75	Protein (musashi1); RNA-binding domain, RNA bindin	98.95
3q2s_C		229	Cleavage and polyadenylation specificity factor S;	98.95
1fj7_A		101	Nucleolin RBD1, protein C23; RNP, RRM, RNA binding	98.94
1b7f_A		168	Protein (SXL-lethal protein), RNA (5'-R(PGPUP*UP	98.94
1x4b_A		116	Heterogeneous nuclear ribonucleoproteins A2/B1; st	98.94
2g4b_A		172	Splicing factor U2AF 65 kDa subunit; protein-RNA c	98.94
3pgw_A		282	U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c	98.93
3pgw_A		282	U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c	98.93
3md3_A		166	Nuclear and cytoplasmic polyadenylated RNA-bindin	98.93
3sde_A		261	Paraspeckle component 1; RRM, anti parallel right	98.93
1b7f_A		168	Protein (SXL-lethal protein), RNA (5'-R(PGPUP*UP	98.93
2lmi_A		107	GRSF-1, G-rich sequence factor 1; G-rich RNA seque	98.92
2jvr_A		111	Nucleolar protein 3; RNA recognition motif, nucleu	98.92
1fxl_A		167	Paraneoplastic encephalomyelitis antigen HUD; prot	98.92
1fxl_A		167	Paraneoplastic encephalomyelitis antigen HUD; prot	98.92
3beg_B		115	Splicing factor, arginine/serine-rich 1; kinase, S	98.91
2yh0_A		198	Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli	98.91
1wg5_A		104	Heterogeneous nuclear ribonucleoprotein H; structu	98.9
3tyt_A		205	Heterogeneous nuclear ribonucleoprotein L; ferredo	98.9
1uaw_A		77	Mouse-musashi-1; RNP-type structure, RNA binding p	98.9
2adc_A		229	Polypyrimidine tract-binding protein 1; RBD, RRM,	98.9
2diu_A		96	KIAA0430 protein; structural genomics, RRM domain,	98.9
2lcw_A		116	RNA-binding protein FUS; RRM, nucleic acid binding	98.42
2rs2_A		109	Musashi-1, RNA-binding protein musashi homolog 1;	98.89
1zrj_A		50	E1B-55KDA-associated protein 5 isoform C; SAP doma	98.86
2kvu_A		75	MKL/myocardin-like protein 1; SAP motif, DNA/RNA b	98.85
2hgl_A		136	HNRPF protein, heterogeneous nuclear ribonucleopro	98.85
4f02_A		213	Polyadenylate-binding protein 1; mRNA, eukaryotic	98.85
1qm9_A		198	Polypyrimidine tract-binding protein; ribonucleopr	98.85
2qfj_A		216	FBP-interacting repressor; protein-DNA complex; HE	98.85
3smz_A		284	Protein raver-1, ribonucleoprotein PTB-binding 1;	98.84
3nmr_A		175	Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl	98.84
2cjk_A		167	Nuclear polyadenylated RNA-binding protein 4; HRP1	98.84
1fje_B		175	Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin	98.82
1wez_A		102	HnRNP H', FTP-3, heterogeneous nuclear ribonucleop	98.82
1iqt_A		75	AUF1, heterogeneous nuclear ribonucleoprotein D0;	98.82
3d2w_A		89	TAR DNA-binding protein 43; DP-43 proteinopathy, T	98.81
2ghp_A		292	U4/U6 snRNA-associated splicing factor PRP24; RNA	98.8
1l3k_A		196	Heterogeneous nuclear ribonucleoprotein A1; nuclea	98.79
1l3k_A		196	Heterogeneous nuclear ribonucleoprotein A1; nuclea	98.78
3u1l_A		240	PRE-mRNA-splicing factor CWC2; CSMP, zinc finger;	98.77
2yh0_A		198	Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli	98.77
3smz_A		284	Protein raver-1, ribonucleoprotein PTB-binding 1;	98.77
1h1j_S		51	THO1 protein; SAP domain, DNA binding; NMR {Saccha	98.76
2xs2_A		102	Deleted in azoospermia-like; RNA binding protein-R	98.74
2g4b_A		172	Splicing factor U2AF 65 kDa subunit; protein-RNA c	98.73
2dha_A		123	FLJ20171 protein; RRM domain, structural genomics,	98.72
3tyt_A		205	Heterogeneous nuclear ribonucleoprotein L; ferredo	98.71
1jmt_A		104	Splicing factor U2AF 35 kDa subunit; RRM, RNA spli	98.71
2do1_A		55	Nuclear protein HCC-1; SAP domain, structural geno	98.7
2dnn_A		109	RNA-binding protein 12; RRM domain, RBD, structura	98.66
2ghp_A		292	U4/U6 snRNA-associated splicing factor PRP24; RNA	98.66
2dnl_A		114	Cytoplasmic polyadenylation element binding protei	98.65
1wf0_A		88	TDP-43, TAR DNA-binding protein-43; structural gen	98.65
2hgn_A		139	Heterogeneous nuclear ribonucleoprotein F; RNA rec	98.63
1fje_B		175	Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin	98.63
2hgm_A		126	HNRPF protein, heterogeneous nuclear ribonucleopro	98.63
3sde_A		261	Paraspeckle component 1; RRM, anti parallel right	98.58
2voo_A		193	Lupus LA protein; RNA-binding protein, RNA recogni	98.57
2cjk_A		167	Nuclear polyadenylated RNA-binding protein 4; HRP1	98.52
2d9o_A		100	DNAJ (HSP40) homolog, subfamily C, member 17; RRM	98.44
3dxb_A		222	Thioredoxin N-terminally fused to PUF60(UHM); spli	98.37
2j8a_A		136	Histone-lysine N-methyltransferase, H3 lysine-4 sp	98.29
1owx_A		121	Lupus LA protein, SS-B, LA; RRM, transcription; NM	98.1
2dnr_A		91	Synaptojanin-1; RRM domain, RBD, structural genomi	97.67
2rnn_A		114	E3 SUMO-protein ligase SIZ1; SUMO ligase, DNA bind	97.62
1wey_A		104	Calcipressin 1; structural genomics, RRM domain, r	97.5
1ufw_A		95	Synaptojanin 2; RNP domain, structural genomics, r	97.22
1jjr_A		151	KU70, thyroid autoantigen; DNA repair protein, pro	97.21
2l9w_A		117	U4/U6 snRNA-associated-splicing factor PRP24; RRM,	93.85
1whv_A		100	Poly(A)-specific ribonuclease; RNA recognition mot	93.58
1uw4_A		91	UPF3X; nonsense mediated mRNA decay protein, RNA-b	93.26
3ctr_A		101	Poly(A)-specific ribonuclease PARN; protein-RNA-co	90.8
3pq1_A		464	Poly(A) RNA polymerase; nucleotidyl transferase, R	84.52
1zbh_A		299	3'-5' exonuclease ERI1; histone mRNA 3'-END-specif	81.1
2rno_A		110	Putative DNA-binding protein; SUMO ligase, sumoyla	80.03

>4a8x_B HOOK-like, isoform A; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Drosophila melanogaster}	Back alignment and structure

Probab=99.58  E-value=2.3e-16  Score=120.56  Aligned_cols=38  Identities=61%  Similarity=0.931  Sum_probs=26.9

Q ss_pred             CCCCccchhhhhhhhcCCCceeeeeCCHHHHHHHHHHh
Q 004904          681 LDPPIVTLDDLFRKTKATPRIYYLPLSEEQVAAKLEAR  718 (724)
Q Consensus       681 ~EpP~ktLDdLFRKTka~P~IYyLPLSeeqVa~Klaa~  718 (724)
                      .|+|+++||||||||+|+|+|||||||++||++|.+.|
T Consensus         3 ~e~p~k~LDdLF~KT~a~P~IY~LPltdeqv~~k~~~~   40 (40)
T 4a8x_B            3 NEPPIRLLDDLFRKTKGTPCIYWLPLTPEAIAEKEAFR   40 (40)
T ss_dssp             ------CHHHHSEECSSSSCCEEECCCHHHHHC-----
T ss_pred             CcchhhhHHHHHHhccCCCceEEeECCHHHHHHHHhcC
Confidence            57999999999999999999999999999999998754

PyMOL of 4a8x

>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster}	Back alignment and structure

>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens}	Back alignment and structure

>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B	Back alignment and structure

>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A	Back alignment and structure

>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A*	Back alignment and structure

>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens}	Back alignment and structure

>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A	Back alignment and structure

>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ...	Back alignment and structure

>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens}	Back alignment and structure

>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A	Back alignment and structure

>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A	Back alignment and structure

>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B	Back alignment and structure

>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens}	Back alignment and structure

>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D*	Back alignment and structure

>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A	Back alignment and structure

>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0	Back alignment and structure

>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D*	Back alignment and structure

>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens}	Back alignment and structure

>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A	Back alignment and structure

>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens}	Back alignment and structure

>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A	Back alignment and structure

>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A	Back alignment and structure

>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens}	Back alignment and structure

>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens}	Back alignment and structure

>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus}	Back alignment and structure

>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster}	Back alignment and structure

>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A	Back alignment and structure

>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A	Back alignment and structure

>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A	Back alignment and structure

>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A	Back alignment and structure

>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2lxi_A RNA-binding protein 10; NMR {Homo sapiens}	Back alignment and structure

>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A	Back alignment and structure

>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens}	Back alignment and structure

>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A	Back alignment and structure

>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens}	Back alignment and structure

>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A	Back alignment and structure

>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A	Back alignment and structure

>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens}	Back alignment and structure

>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens}	Back alignment and structure

>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X	Back alignment and structure

>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A	Back alignment and structure

>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens}	Back alignment and structure

>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1	Back alignment and structure

>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A	Back alignment and structure

>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens}	Back alignment and structure

>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A	Back alignment and structure

>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C	Back alignment and structure

>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A	Back alignment and structure

>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens}	Back alignment and structure

>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A	Back alignment and structure

>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens}	Back alignment and structure

>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP}	Back alignment and structure

>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens}	Back alignment and structure

>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1	Back alignment and structure

>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens}	Back alignment and structure

>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A	Back alignment and structure

>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A	Back alignment and structure

>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A	Back alignment and structure

>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori}	Back alignment and structure

>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae}	Back alignment and structure

>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens}	Back alignment and structure

>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A	Back alignment and structure

>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A	Back alignment and structure

>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A	Back alignment and structure

>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus}	Back alignment and structure

>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A	Back alignment and structure

>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis}	Back alignment and structure

>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A	Back alignment and structure

>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A*	Back alignment and structure

>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}	Back alignment and structure

>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A	Back alignment and structure

>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A*	Back alignment and structure

>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A*	Back alignment and structure

>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1	Back alignment and structure

>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A	Back alignment and structure

>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C	Back alignment and structure

>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1	Back alignment and structure

>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(PGPUPUPGPUPUPUPUPUPUPUPU)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A	Back alignment and structure

>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A	Back alignment and structure

>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A	Back alignment and structure

>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A	Back alignment and structure

>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae}	Back alignment and structure

>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B	Back alignment and structure

>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(PGPUPUPGPUPUPUPUPUPUPUPU)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A	Back alignment and structure

>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens}	Back alignment and structure

>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A	Back alignment and structure

>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A	Back alignment and structure

>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A	Back alignment and structure

>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A	Back alignment and structure

>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A	Back alignment and structure

>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A	Back alignment and structure

>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A	Back alignment and structure

>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens}	Back alignment and structure

>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus}	Back alignment and structure

>1zrj_A E1B-55KDA-associated protein 5 isoform C; SAP domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.140.2.1	Back alignment and structure

>2kvu_A MKL/myocardin-like protein 1; SAP motif, DNA/RNA binding, structural genomics, northeast structural genomics consortium (NESG), PSI-2; NMR {Homo sapiens} PDB: 2kw9_A	Back alignment and structure

>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A	Back alignment and structure

>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A*	Back alignment and structure

>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1	Back alignment and structure

>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A	Back alignment and structure

>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E	Back alignment and structure

>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A	Back alignment and structure

>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C	Back alignment and structure

>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A	Back alignment and structure

>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A	Back alignment and structure

>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus}	Back alignment and structure

>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A	Back alignment and structure

>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A	Back alignment and structure

>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A	Back alignment and structure

>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A	Back alignment and structure

>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A	Back alignment and structure

>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E	Back alignment and structure

>1h1j_S THO1 protein; SAP domain, DNA binding; NMR {Saccharomyces cerevisiae} SCOP: a.140.2.1 PDB: 2wqg_A	Back alignment and structure

>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A	Back alignment and structure

>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A	Back alignment and structure

>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A	Back alignment and structure

>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3	Back alignment and structure

>2do1_A Nuclear protein HCC-1; SAP domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.140.2.1	Back alignment and structure

>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A	Back alignment and structure

>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A	Back alignment and structure

>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A	Back alignment and structure

>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A	Back alignment and structure

>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B	Back alignment and structure

>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A	Back alignment and structure

>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C	Back alignment and structure

>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157}	Back alignment and structure

>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae}	Back alignment and structure

>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2rnn_A E3 SUMO-protein ligase SIZ1; SUMO ligase, DNA binding, sumoylation, metal-binding, nucLeu phosphoprotein, UBL conjugation pathway; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A*	Back alignment and structure

>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4	Back alignment and structure

>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens}	Back alignment and structure

>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens}	Back alignment and structure

>1zbh_A 3'-5' exonuclease ERI1; histone mRNA 3'-END-specific recognition, structures of 3'- exonuclease and ITS RNA complex, hydrolase/RNA complex; HET: AMP; 3.00A {Homo sapiens}	Back alignment and structure

>2rno_A Putative DNA-binding protein; SUMO ligase, sumoylation, metal-BI zinc-finger, ligase; NMR {Oryza sativa subsp}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		724
d1zrja1		37	a.140.2.1 (A:1-37) Heterogeneous nuclear ribonucle	1e-08
d1h1js_		44	a.140.2.1 (S:) S/mar DNA-binding protein Tho1 {Bak	1e-06
d1jeqa1		51	a.140.2.1 (A:559-609) DNA binding C-terminal domai	2e-06
d1weya_		104	d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus)	8e-06
d1jvra_		137	a.61.1.2 (A:) HTLV-II matrix protein {Human T-cell	0.004

>d1zrja1 a.140.2.1 (A:1-37) Heterogeneous nuclear ribonucleoprotein U-like protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 37	Back information, alignment and structure


class: All alpha proteins
fold: LEM/SAP HeH motif
superfamily: SAP domain
family: SAP domain
domain: Heterogeneous nuclear ribonucleoprotein U-like protein 1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 49.1 bits (118), Expect = 1e-08
 Identities = 15/35 (42%), Positives = 22/35 (62%)

Query: 13 IDQWKVTELKEELKRRKLKSSGKKDDLIRLLDQAI 47
          + + KV EL+EEL+RR L + G K +L   L  A+
Sbjct: 3  VRRLKVNELREELQRRGLDTRGLKAELAERLQAAL 37

PyMOL of d1zrja1

>d1h1js_ a.140.2.1 (S:) S/mar DNA-binding protein Tho1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 44	Back information, alignment and structure

>d1jeqa1 a.140.2.1 (A:559-609) DNA binding C-terminal domain of ku70 {Human (Homo sapiens) [TaxId: 9606]} Length = 51	Back information, alignment and structure

>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		724
d1whya_		97	Putative RNA-binding protein 15B, Rbm15b {Mouse (M	99.39
d2bz2a1		79	Negative elongation factor E, NELF-E {Human (Homo	99.38
d2b0ga1		83	Splicesomal U1A protein {Drosophila melanogaster [	99.34
d2f9da1		114	Pre-mRNA branch site protein p14 {Human (Homo sapi	99.34
d2adca2		88	Polypyrimidine tract-binding protein {Human (Homo	99.34
d1whxa_		111	Probable RNA-binding protein 19, Rbm19 {Mouse (Mus	99.33
d1rk8a_		88	RNA-binding protein 8 {Fruit fly (Drosophila melan	99.33
d2cqba1		89	Peptidyl-prolyl cis-trans isomerase E, N-terminal	99.33
d1x5ua1		93	Splicing factor 3B subunit 4 {Human (Homo sapiens)	99.32
d2cq1a1		88	Polypyrimidine tract-binding protein 2, PTBP2 {Hum	99.32
d2cpha1		94	Probable RNA-binding protein 19, Rbm19 {Mouse (Mus	99.31
d1wexa_		104	Heterogeneous nuclear ribonucleoprotein L-like {Mo	99.3
d2cq0a1		90	Eukaryotic translation initiation factor 3 subunit	99.28
d2cpja1		86	Non-POU domain-containing octamer-binding protein,	99.27
d1p1ta_		104	Cleavage stimulation factor, 64 kda subunit {Human	99.26
d1h2vz_		93	CBP20, 20KDa nuclear cap-binding protein {Human (H	99.26
d1whwa_		99	Probable RNA-binding protein 19, Rbm19 {Mouse (Mus	99.26
d2cpda1		86	APOBEC1 stimulating protein {Human (Homo sapiens)	99.25
d1fxla1		82	Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9	99.25
d2ghpa1		81	U4/U6 snRNA-associated-splicing factor PRP24 {Bake	99.24
d1b7fa1		82	Sex-lethal protein {Drosophila melanogaster [TaxId	99.23
d2cqia1		90	Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960	99.23
d1fjca_		96	Nucleolin {Golden hamster (Mesocricetus auratus) [	99.22
d2cqca1		83	Arginine/serine-rich splicing factor 10 {Human (Ho	99.22
d2cpza1		102	CUG triplet repeat RNA-binding protein 1 {Human (H	99.21
d2cpxa1		102	RNA-binding protein 41, RBM41 {Human (Homo sapiens	99.21
d2adca1		109	Polypyrimidine tract-binding protein {Human (Homo	99.2
d1b7fa2		85	Sex-lethal protein {Drosophila melanogaster [TaxId	99.2
d1wg1a_		88	Probable RNA-binding protein KIAA1579 {Human (Homo	99.2
d1no8a_		78	Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1	99.19
d1x4ga1		96	Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960	99.18
d1u6fa1		139	RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId	99.18
d1fxla2		85	Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9	99.18
d1wi6a1		75	Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M	99.18
d1x4ha1		98	RNA-binding protein 28 {Mouse (Mus musculus) [TaxI	99.17
d2cqha1		80	IGF-II mRNA-binding protein 2 isoform A {Human (Ho	99.16
d1wf2a_		98	Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu	99.16
d1x4fa1		99	Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}	99.16
d1cvja2		89	Poly(A)-binding protein {Human (Homo sapiens) [Tax	99.14
d1wi8a_		104	Eukaryotic translation initiation factor 4B {Human	99.14
d1x5sa1		90	Cold-inducible RNA-binding protein {Human (Homo sa	99.14
d1cvja1		80	Poly(A)-binding protein {Human (Homo sapiens) [Tax	99.13
d1wg4a_		98	Splicing factor, arginine/serine-rich 9 (SFRS9) {M	99.13
d2cq3a1		93	RNA-binding protein 9 {Human (Homo sapiens) [TaxId	99.12
d2cpea1		101	RNA-binding protein EWS {Human (Homo sapiens) [Tax	99.12
d2adba1		108	Polypyrimidine tract-binding protein {Human (Homo	99.11
d1x4aa1		95	Splicing factor, arginine/serine-rich 1, SFRS1 {Hu	99.11
d1x4da1		89	Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}	99.1
d2u2fa_		85	Splicing factor U2AF 65 KDa subunit {Human (Homo s	99.09
d2cpfa1		85	Probable RNA-binding protein 19, Rbm19 {Mouse (Mus	99.09
d1nu4a_		91	Splicesomal U1A protein {Human (Homo sapiens) [Tax	99.08
d1x5oa1		101	RNA-binding motif, single-stranded-interacting pro	99.07
d3begb1		87	Splicing factor, arginine/serine-rich 1, SFRS1 {Hu	99.07
d2dita1		99	HIV Tat-specific factor 1 {Human (Homo sapiens) [T	99.06
d2cq4a1		101	RNA binding protein 23 {Human (Homo sapiens) [TaxI	99.06
d1weya_		104	Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090	99.05
d1fjeb1		91	Nucleolin {Golden hamster (Mesocricetus auratus) [	99.04
d2ghpa3		86	U4/U6 snRNA-associated-splicing factor PRP24 {Bake	99.03
d1o0pa_		104	Splicing factor U2AF 65 KDa subunit {Human (Homo s	99.03
d1x5ta1		83	Splicing factor 3B subunit 4 {Human (Homo sapiens)	99.03
d1x4ba1		103	Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu	99.0
d1x4ea1		72	RNA-binding motif, single-stranded-interacting pro	98.98
d1wf0a_		88	TAR DNA-binding protein 43, TDP-43 {Human (Homo sa	98.98
d2msta_		75	Neural RNA-binding protein Musashi-1 {Mouse (Mus m	98.97
d2cqda1		103	RNA-binding region containing protein 1 {Human (Ho	98.95
d1uawa_		77	Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]}	98.95
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_		104	U2	98.95
d1zh5a2		85	Lupus LA protein {Human (Homo sapiens) [TaxId: 960	98.95
d2cq2a1		101	Alkylation repair AlkB homolog 8, ALKBH8 {Human (H	98.95
d2cqpa1		86	RNA-binding protein 12 {Mouse (Mus musculus) [TaxI	98.93
d1zrja1		37	Heterogeneous nuclear ribonucleoprotein U-like pro	98.92
d1wg5a_		104	Heterogeneous nuclear ribonucleoprotein H' {Human	98.91
d2ghpa2		75	U4/U6 snRNA-associated-splicing factor PRP24 {Bake	98.9
d2cpia1		89	E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc	98.89
d2cqga1		90	TAR DNA-binding protein 43, TDP-43 {Human (Homo sa	98.89
d2disa1		96	Hypothetical protein FLJ20273 {Human (Homo sapiens	98.88
d1l3ka1		84	Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human	98.85
d1hd0a_		75	Heterogeneous nuclear ribonucleoprotein d0 {Human	98.84
d2cpya1		103	RNA-binding protein 12 {Human (Homo sapiens) [TaxI	98.84
d1l3ka2		79	Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human	98.8
d1weza_		102	Heterogeneous nuclear ribonucleoprotein H' {Human	98.78
d1wela1		112	RNA-binding protein 12 {Human (Homo sapiens) [TaxI	98.77
d1u1qa_		183	Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human	98.67
d1u2fa_		90	Splicing factor U2AF 65 KDa subunit {Human (Homo s	98.65
d1x0fa1		75	Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s	98.62
d1h1js_		44	S/mar DNA-binding protein Tho1 {Baker's yeast (Sac	98.53
d1owxa_		113	Lupus LA protein {Human (Homo sapiens) [TaxId: 960	98.53
d1u1qa_		183	Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human	98.19
d1jeqa1		51	DNA binding C-terminal domain of ku70 {Human (Homo	98.16
d1wwha1		81	Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090	98.14
d2do1a1		42	Nuclear protein hcc-1 {Human (Homo sapiens) [TaxId	97.7
d1uw4a_		91	RNA processing protein UPF3x, RRM domain {Human (H	87.85

>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Putative RNA-binding protein 15B, Rbm15b
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.39  E-value=5.5e-13  Score=111.55  Aligned_cols=80  Identities=16%  Similarity=0.243  Sum_probs=72.9

Q ss_pred             CCCCCceEeecccCCCCCHHHHHHHhcCcCCeeEEEecCccceEEEEecCHHHHHHHHHHhcCCcCCCCCCCCcEEEeec
Q 004904          518 PKSPTNSLRIDHFVRPFTLRAVQELLGKTGTFTSFWMDHIKTHCYVTYSSVEEAIETRNALYNIQWPPNNGGRPLVAEFV  597 (724)
Q Consensus       518 ~hPpT~aLyI~NLvRPFT~~qLkElLsetGtI~~FWLD~IKSHCYVtFsSVEeA~aARsALhG~vWP~en~gR~LrVDFv  597 (724)
                      ..+|+++|||+||-+.+|..+|+++|+++|.|..++|.+-|.+|||.|.+.++|.+|+.+|||..| .. .++.|+|+|+
T Consensus        13 ~~~Ps~tl~V~nLp~~~t~~~l~~~f~~~G~i~~~~~~~~~~~afV~f~~~~~A~~A~~~l~~~~i-~g-~~~~l~v~~a   90 (97)
T d1whya_          13 KANPTTRLWVGGLGPNTSLAALAREFDRFGSIRTIDHVKGDSFAYIQYESLDAAQAACAKMRGFPL-GG-PDRRLRVDFA   90 (97)
T ss_dssp             CCCCCSCEEEECCCSSCCHHHHHHHHHTTSCEEEEEECSSSCCEEEEESSHHHHHHHHHHHTTCBC-SS-SSCBCEEEEC
T ss_pred             CCCCCCEEEEcCCCCCCCHHHHHHHHHhhcccceEeeeccccEEEeccCCHHHHHHHHHHhCCCEe-CC-CceEEEEEeC
Confidence            457899999999999999999999999999999999999999999999999999999999999998 22 2467999998


Q ss_pred             Ch
Q 004904          598 DP  599 (724)
Q Consensus       598 ~p  599 (724)
                      .+
T Consensus        91 k~   92 (97)
T d1whya_          91 KS   92 (97)
T ss_dssp             CC
T ss_pred             CC
Confidence            63

PyMOL of d1whya_

>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]}	Back information, alignment and structure

>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]}	Back information, alignment and structure

>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]}	Back information, alignment and structure

>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]}	Back information, alignment and structure

>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]}	Back information, alignment and structure

>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]}	Back information, alignment and structure

>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1zrja1 a.140.2.1 (A:1-37) Heterogeneous nuclear ribonucleoprotein U-like protein 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h1js_ a.140.2.1 (S:) S/mar DNA-binding protein Tho1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jeqa1 a.140.2.1 (A:559-609) DNA binding C-terminal domain of ku70 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2do1a1 a.140.2.1 (A:5-46) Nuclear protein hcc-1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure