Citrus Sinensis ID: 004943

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720--
MEAVAEGLWGLADYHENKGEIGKAVKCLEAICQSHVSFLPIIEVKTRLRISTLLLKHTHNVNHAKSHLERSQLLLKAIPSCFELKCRTFSLLSQCYHLVGAIPPQKLILYKALDLTSSASQDVAVKLWSCNFNSQLANAFIIEGDYQSSISALQSGYVCATEISYPDLQMFFATAILHVHLMQWDDENSVLRSINQCDRVWESIDPNRRGQCLGLLFYNELLHIFYRLRICDYKNAAHHVDNLDAAMKADKQKMQEIQQLSSELDALNQSLSRPDLPSRERSALAGRQAKLQQRLRSLEDSSLTGKEFLEPSYFGNARQAWGDKLVLAPSPMDGEWLPKSAVYALVDLMVVILGRPKGLFKECMQRIQSGMQTIQDALLKLGITDGVREVDLQHSAIWMAGVYLMLLMQFLENKVAVELTRSGFVEAQEALVQMKNWFIRFPTILQACESMIEMLRGQYAHSVGCYSEAAFHYVEAAKITESKSMQAMCHAYAAVSYFCIGDAESSSQAIDLIGPVYQMKDTINGVREEASLHFAYGLLLMRQQDFQEARNRLAKGLQIAHNHMGNLQLVSQYLTILGNLALALHDTVQAREILRSSLTLAKKLYDIPTQIWALSVLTALYQQLGDRGNEMENDEYRRKKLDELQKRLADAYSSIHHIELISKVKLEVQQFHELDIKRAMANQSMSVNLDIPESIGLSTPLPVQSSSRLIDLDGGRRGKRKI
cHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHcccccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccc
cHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccccEEEHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccHcHHHcHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccccHccccccHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccccccEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcEEHHHHHcccHHHccccccccccccccccccccccccccccHHEEcccccccccccc
MEAVAEGlwgladyhenkgEIGKAVKCLEAICQSHVSFLPIIEVKTRLRISTLLLKHTHNVNHAKSHLERSQLLLKAIPSCFELKCRTFSLLSQCYhlvgaippqkLILYKAldltssasQDVAVKLWSCNFNSQLANAFIIEGDYQSSISALQSGYvcateisypDLQMFFATAILHVHLMQWDDENSVLRSINQCDRvwesidpnrrgqclGLLFYNELLHIFYRLRIcdyknaahhVDNLDAAMKADKQKMQEIQQLSSELDALnqslsrpdlpsreRSALAGRQAKLQQRLRSledssltgkeflepsyfgnarqawgdklvlapspmdgewlpkSAVYALVDLMVVILGRPKGLFKECMQRIQSGMQTIQDALLKLgitdgvrevdlqHSAIWMAGVYLMLLMQFLENKVAVELTRSGFVEAQEALVQMKNWFIRFPTILQACESMIEMLRGQYAHSVGCYSEAAFHYVEAAKITESKSMQAMCHAYAAVSYFCIgdaesssqaidligpvyqmkdtingVREEASLHFAYGLLLMRQQDFQEARNRLAKGLQIAHNHMGNLQLVSQYLTILGNLALALHDTVQAREILRSSLTLAKKLYDIPTQIWALSVLTALYQQLGdrgnemendEYRRKKLDELQKRLADAYSSIHHIELISKVKLEVQQFHELDIKRAMANQSmsvnldipesiglstplpvqsssrlidldggrrgkrki
MEAVAEGLWGLADYHENKGEIGKAVKCLEAICQSHVSFLPIIEVKTRLRISTLLLKHThnvnhakshlERSQLLLKAIPSCFELKCRTFSLLSQCYHLVGAIPPQKLILYKALDLTSSASQDVAVKLWSCNFNSQLANAFIIEGDYQSSISALQSGYVCATEISYPDLQMFFATAILHVHLMQWDDENSVLRSINQCDRVWESIDPNRRGQCLGLLFYNELLHIFYRLRICDYKNAAHHVDNLDAAMKADKQKMQEIQQLSSELDALNQSLSRPDLPSRERSALAGRQAKLQQrlrsledssltgkEFLEPSYFGNARQAWGDKLVLAPSPMDGEWLPKSAVYALVDLMVVILGRPKGLFKECMQRIQSGMQTIQDALLKLGITDGVREVDLQHSAIWMAGVYLMLLMQFLENKVAVELTRSGFVEAQEALVQMKNWFIRFPTILQACESMIEMLRGQYAHSVGCYSEAAFHYVEAAKITESKSMQAMCHAYAAVSYFCIGDAESSSQAIDLIGPVYQMKDTINGVREEASLHFAYGLLLMRQQDFQEARNRLAKGLQIAHNHMGNLQLVSQYLTILGNLALALHDTVQAREILRSSLTLAKKLYDIPTQIWALSVLTALYQQLGDRGNEMENDEYRRKKLDELQKRLADAYSSIHHIELISKVKLEVQQFHELDIKRAMANQSMSVNLDIPESIGlstplpvqsssrlidldggrrgkrki
MEAVAEGLWGLADYHENKGEIGKAVKCLEAICQSHVSFLPIIEVKTRLRISTLLLKHTHNVNHAKSHLERSQLLLKAIPSCFELKCRTFSLLSQCYHLVGAIPPQKLILYKALDLTSSASQDVAVKLWSCNFNSQLANAFIIEGDYQSSISALQSGYVCATEISYPDLQMFFATAILHVHLMQWDDENSVLRSINQCDRVWESIDPNRRGQCLGLLFYNELLHIFYRLRICDYKNAAHHVDNLDAAMKADKQKMQEIQQLSSELDALNQSLSRPDLPSRERSALAGRQAKLQQRLRSLEDSSLTGKEFLEPSYFGNARQAWGDKLVLAPSPMDGEWLPKSAVYALVDLMVVILGRPKGLFKECMQRIQSGMQTIQDALLKLGITDGVREVDLQHSAIWMAGVYLMLLMQFLENKVAVELTRSGFVEAQEALVQMKNWFIRFPTILQACESMIEMLRGQYAHSVGCYSEAAFHYVEAAKITESKSMQAMCHAYAAVSYFCIGDAESSSQAIDLIGPVYQMKDTINGVREEASLHFAYGLLLMRQQDFQEARNRLAKGLQIAHNHMGNLQLVSQYLTILGNLALALHDTVQAREILRSSLTLAKKLYDIPTQIWALSVLTALYQQLGDRGNEMENDEYRRKKLDELQKRLADAYSSIHHIELISKVKLEVQQFHELDIKRAMANQSMSVNLDIPESIGLSTPLPVQSSSRLIDLDGGRRGKRKI
*****EGLWGLADYHENKGEIGKAVKCLEAICQSHVSFLPIIEVKTRLRISTLLLKHTHNVNHAKSHLERSQLLLKAIPSCFELKCRTFSLLSQCYHLVGAIPPQKLILYKALDLTSSASQDVAVKLWSCNFNSQLANAFIIEGDYQSSISALQSGYVCATEISYPDLQMFFATAILHVHLMQWDDENSVLRSINQCDRVWESIDPNRRGQCLGLLFYNELLHIFYRLRICDYKNAAHHVDNL****************************************************************FLEPSYFGNARQAWGDKLVLAPSPMDGEWLPKSAVYALVDLMVVILGRPKGLFKECMQRIQSGMQTIQDALLKLGITDGVREVDLQHSAIWMAGVYLMLLMQFLENKVAVELTRSGFVEAQEALVQMKNWFIRFPTILQACESMIEMLRGQYAHSVGCYSEAAFHYVEAAKITESKSMQAMCHAYAAVSYFCIGDAESSSQAIDLIGPVYQMKDTINGVREEASLHFAYGLLLMRQQDFQEARNRLAKGLQIAHNHMGNLQLVSQYLTILGNLALALHDTVQAREILRSSLTLAKKLYDIPTQIWALSVLTALYQQLG*********************RLADAYSSIHHIELISKVKLEVQQFHELDIKRAM******************************************
*EAVAEGLWGLADYHENKGEIGKAVKCLEAICQSHVSFLPIIEVKTRLRISTLLLKHTHNVNHAKSHLERSQLLLKAIPSCFELKCRTFSLLSQCYHLVGAIPPQKLILYKALDLTSSASQDVAVKLWSCNFNSQLANAFIIEGDYQSSISALQSGYVCATEISYPDLQMFFATAILHVHLMQWDD*************************CLGLLFYNELLHIFYRLRICDYKNAAHHVDNLD*******************LDALNQSLSRPDLPSRERSALAGRQAKLQ*******************************KLVLAPSPMDGEWLPKSAVYALVDLMVVILGRPKGLFKECMQRIQSGMQTI********************SAIWMAGVYLMLLMQFLENKVAVELTRSGFVEAQEALVQMKNWFIRFPTILQACESMIEMLRGQYAHSVGCYSEAAFHYVEAAKITESKSMQAMCHAYAAVSYFCIGDAESSSQAIDLIGPVYQMKDT*NGVREEASLHFAYGLLLMRQQDFQEARNRLAKGLQIAHNHMGNLQLVSQYLTILGNLALALHDTVQA*EILR**LTLAKKLYDIPTQIWALSVLTALYQQLGDRGNEMENDEYRRKK******************ELISKVK*********************************************************
MEAVAEGLWGLADYHENKGEIGKAVKCLEAICQSHVSFLPIIEVKTRLRISTLLLKHTHNVNHAKSHLERSQLLLKAIPSCFELKCRTFSLLSQCYHLVGAIPPQKLILYKALDLTSSASQDVAVKLWSCNFNSQLANAFIIEGDYQSSISALQSGYVCATEISYPDLQMFFATAILHVHLMQWDDENSVLRSINQCDRVWESIDPNRRGQCLGLLFYNELLHIFYRLRICDYKNAAHHVDNLDAAMKADKQKMQEIQQLSSELDALNQSLSRPDLPSRERSALAGRQAKLQQRLRSLEDSSLTGKEFLEPSYFGNARQAWGDKLVLAPSPMDGEWLPKSAVYALVDLMVVILGRPKGLFKECMQRIQSGMQTIQDALLKLGITDGVREVDLQHSAIWMAGVYLMLLMQFLENKVAVELTRSGFVEAQEALVQMKNWFIRFPTILQACESMIEMLRGQYAHSVGCYSEAAFHYVEAAKITESKSMQAMCHAYAAVSYFCIGDAESSSQAIDLIGPVYQMKDTINGVREEASLHFAYGLLLMRQQDFQEARNRLAKGLQIAHNHMGNLQLVSQYLTILGNLALALHDTVQAREILRSSLTLAKKLYDIPTQIWALSVLTALYQQLGDRGNEMENDEYRRKKLDELQKRLADAYSSIHHIELISKVKLEVQQFHELDIKRAMANQSMSVNLDIPESIGLSTPLPVQSSSRLIDLD*********
MEAVAEGLWGLADYHENKGEIGKAVKCLEAICQSHVSFLPIIEVKTRLRISTLLLKHTHNVNHAKSHLERSQLLLKAIPSCFELKCRTFSLLSQCYHLVGAIPPQKLILYKALDLTSSASQDVAVKLWSCNFNSQLANAFIIEGDYQSSISALQSGYVCATEISYPDLQMFFATAILHVHLMQWDDENSVLRSINQCDRVWESIDPNRRGQCLGLLFYNELLHIFYRLRICDYKNAAHHVDNLDAAMKADKQKMQEIQQLSSELDALNQSLSRPDLPSRERSALAGRQAKLQQRLRSLEDSSLTGKEFLEPSYFGNARQAWGDKLVLAPSPMDGEWLPKSAVYALVDLMVVILGRPKGLFKECMQRIQSGMQTIQDALLKLGITDGVREVDLQHSAIWMAGVYLMLLMQFLENKVAVELTRSGFVEAQEALVQMKNWFIRFPTILQACESMIEMLRGQYAHSVGCYSEAAFHYVEAAKITESKSMQAMCHAYAAVSYFCIGDAESSSQAIDLIGPVYQMKDTINGVREEASLHFAYGLLLMRQQDFQEARNRLAKGLQIAHNHMGNLQLVSQYLTILGNLALALHDTVQAREILRSSLTLAKKLYDIPTQIWALSVLTALYQQLGDRGNEMENDEYRRKKLDELQKRLADAYSSIHHIELISKVKLEVQQFHELD*K*****************IGLS************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEAVAEGLWGLADYHENKGEIGKAVKCLEAICQSHVSFLPIIEVKTRLRISTLLLKHTHNVNHAKSHLERSQLLLKAIPSCFELKCRTFSLLSQCYHLVGAIPPQKLILYKALDLTSSASQDVAVKLWSCNFNSQLANAFIIEGDYQSSISALQSGYVCATEISYPDLQMFFATAILHVHLMQWDDENSVLRSINQCDRVWESIDPNRRGQCLGLLFYNELLHIFYRLRICDYKNAAHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLSRPDLPSRERSALAGRQAKLQQRLRSLEDSSLTGKEFLEPSYFGNARQAWGDKLVLAPSPMDGEWLPKSAVYALVDLMVVILGRPKGLFKECMQRIQSGMQTIQDALLKLGITDGVREVDLQHSAIWMAGVYLMLLMQFLENKVAVELTRSGFVEAQEALVQMKNWFIRFPTILQACESMIEMLRGQYAHSVGCYSEAAFHYVEAAKITESKSMQAMCHAYAAVSYFCIGDAESSSQAIDLIGPVYQMKDTINGVREEASLHFAYGLLLMRQQDFQEARNRLAKGLQIAHNHMGNLQLVSQYLTILGNLALALHDTVQAREILRSSLTLAKKLYDIPTQIWALSVLTALYQQLGDRGNEMENDEYRRKKLDELQKRLADAYSSIHHIELISKVKLEVQQFHELDIKRAMANQSMSVNLDIPESIGLSTPLPVQSSSRLIDLDGGRRGKRKI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query722 2.2.26 [Sep-21-2011]
Q16NZ8620 MAU2 chromatid cohesion f N/A no 0.731 0.851 0.201 7e-14
B4PS83632 MAU2 chromatid cohesion f N/A no 0.728 0.832 0.212 1e-13
B3M1B7639 MAU2 chromatid cohesion f N/A no 0.821 0.928 0.209 3e-13
Q9VFC0632 MAU2 chromatid cohesion f yes no 0.728 0.832 0.210 3e-13
B4JHK2623 MAU2 chromatid cohesion f N/A no 0.732 0.849 0.206 1e-12
B4NKT1663 MAU2 chromatid cohesion f N/A no 0.732 0.797 0.201 4e-12
B0WYS3616 MAU2 chromatid cohesion f N/A no 0.727 0.852 0.199 6e-12
B4K4X6625 MAU2 chromatid cohesion f N/A no 0.772 0.892 0.206 3e-11
B4M4L4621 MAU2 chromatid cohesion f N/A no 0.732 0.851 0.203 5e-11
Q9Y6X3613 MAU2 chromatid cohesion f yes no 0.193 0.228 0.298 2e-07
>sp|Q16NZ8|SCC4_AEDAE MAU2 chromatid cohesion factor homolog OS=Aedes aegypti GN=AAEL011819 PE=3 SV=1 Back     alignment and function desciption
 Score = 79.7 bits (195), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 128/634 (20%), Positives = 253/634 (39%), Gaps = 106/634 (16%)

Query: 7   GLWGLADYHENKG--EIGKAVKCLEAICQSHVSFLPI--IEVKTRLRISTLLLKHTHNVN 62
            L GLA+Y        I K ++CL+A+     +F P   +E +T L++  +L+ +T N +
Sbjct: 11  SLLGLAEYFRTSSPPNIKKCIQCLQAL----FTFKPPLKVEARTHLQLGQILMAYTKNTD 66

Query: 63  HAKSHLERSQLLLKAIPSCFELKCRTFSLLSQCYHLVGAIPPQKLILYKALDLTSSASQD 122
            A++HLE++ +L + I +  ++K  T SLL+Q Y         K +L KA++L+      
Sbjct: 67  LARNHLEQAWMLSENINNFDDVKFDTASLLAQLYQQQEQSSLAKPVLRKAIELSQHNV-- 124

Query: 123 VAVKLWSCNFNSQLANAFIIEGDYQSSISALQSGYVCATEISYPDLQMFFATAILHVHLM 182
                W C    QLA     + +Y  +   L  G     E +   L+  F  +   + ++
Sbjct: 125 ----YWHCKLLFQLAQTHATDKEYALASELLAVGVESTDETNATYLKTLFLLSRAMIMMI 180

Query: 183 QWDDENSVLRSINQCDRVWESIDPNRRGQCLGLLFYNELLHI-FYRLRICDYKNAAHHVD 241
           +      VL  +NQ   + ++   N        +   E L + FY L++C Y        
Sbjct: 181 E-RKTGDVLTILNQAGTMIDNAVQN--------IHLKEYLKVFFYVLQVCHYLQLGQ--- 228

Query: 242 NLDAAMKADKQKMQEIQQLSSELDALNQSLSRPDLPSRERSALAGRQAKLQQRLRSLEDS 301
                +K  K  ++++QQ         Q++  P+ P+ E+                    
Sbjct: 229 -----VKTVKTSLKQLQQSI-------QTIMAPNWPADEQ-------------------- 256

Query: 302 SLTGKEFLEPSYFGNARQAWGDKLVLAPSPMDGEWLPKSAVYALVDLMVVILGRPKGLFK 361
                       FG +      ++ +        WLPK  +Y LV L+ V      G   
Sbjct: 257 -----------IFGQS----NTEMFM--------WLPKEQLYVLVYLVTVSHSMMAGYMD 293

Query: 362 ECMQRIQSGMQTIQDALLKLGITDGVREVDLQHSAIWMAGVYLMLLMQFLENKVAV---E 418
           +  +  +  +  I+             ++  Q +   +A   ++LL   +  ++ +    
Sbjct: 294 KAQKYTEKALTQIE-------------KLKSQENKPILAVFQIILLEHIIMCRLVMGNKS 340

Query: 419 LTRSGFVEAQEALVQMKNWFIRFPTILQACESMIEMLRGQYAHSVGCYSEAAFHYVEAAK 478
           L       A++  +   N F     +L+   + +  L G YA S   +  A   +     
Sbjct: 341 LAIKEIALAKDVCLSSSNKF-----LLKKHSAQLHCLLGLYAMSASYFEHAERQFFACIN 395

Query: 479 ITESKSMQAMCHAYAAVSYFCIGDAESSSQAIDLIGPVYQMKDTINGVREEASLHFAYGL 538
            T  + ++   +   A+ Y  +   +   Q +D +    +     N      S ++  GL
Sbjct: 396 DTTERDLKLFANLNLAIVYLRMKREQELRQILDQVQQ--ENSQCSNSQALMGSFYYVQGL 453

Query: 539 LLMRQQDFQEARNRLAKGLQIAHNHMGNLQLVSQYLTILGNLALALHDTVQAREILRSSL 598
               +  F EA+  L + L++A+    N +L S  L +L ++ L++ ++ ++  ++  ++
Sbjct: 454 NAFHKSSFHEAKRFLRETLKMANAEDLN-RLTSCSLVLLSHVFLSIGNSKESMNMVTPAM 512

Query: 599 TLAKKLYDIPTQIWALSVLTALYQQLGDRGNEME 632
            LA K+ DI  Q+W  ++L  L++ L +   E E
Sbjct: 513 QLASKIPDIHVQLWGSAILKDLHRMLKEPALETE 546
Required for association of the cohesin complex with chromatin during interphase. Plays a role in sister chromatid cohesion and normal progression through prometaphase.
Aedes aegypti (taxid: 7159)
>sp|B4PS83|SCC4_DROYA MAU2 chromatid cohesion factor homolog OS=Drosophila yakuba GN=GE24275 PE=3 SV=1 Back     alignment and function description
>sp|B3M1B7|SCC4_DROAN MAU2 chromatid cohesion factor homolog OS=Drosophila ananassae GN=GF17837 PE=3 SV=1 Back     alignment and function description
>sp|Q9VFC0|SCC4_DROME MAU2 chromatid cohesion factor homolog OS=Drosophila melanogaster GN=CG4203 PE=2 SV=1 Back     alignment and function description
>sp|B4JHK2|SCC4_DROGR MAU2 chromatid cohesion factor homolog OS=Drosophila grimshawi GN=GH18976 PE=3 SV=1 Back     alignment and function description
>sp|B4NKT1|SCC4_DROWI MAU2 chromatid cohesion factor homolog OS=Drosophila willistoni GN=GK13302 PE=3 SV=2 Back     alignment and function description
>sp|B0WYS3|SCC4_CULQU MAU2 chromatid cohesion factor homolog OS=Culex quinquefasciatus GN=CPIJ012302 PE=3 SV=1 Back     alignment and function description
>sp|B4K4X6|SCC4_DROMO MAU2 chromatid cohesion factor homolog OS=Drosophila mojavensis GN=GI22403 PE=3 SV=1 Back     alignment and function description
>sp|B4M4L4|SCC4_DROVI MAU2 chromatid cohesion factor homolog OS=Drosophila virilis GN=GJ10962 PE=3 SV=1 Back     alignment and function description
>sp|Q9Y6X3|SCC4_HUMAN MAU2 chromatid cohesion factor homolog OS=Homo sapiens GN=MAU2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query722
297745732722 unnamed protein product [Vitis vinifera] 1.0 1.0 0.785 0.0
225434291755 PREDICTED: MAU2 chromatid cohesion facto 0.997 0.953 0.784 0.0
356500968722 PREDICTED: uncharacterized protein LOC10 1.0 1.0 0.749 0.0
449456905718 PREDICTED: uncharacterized protein LOC10 0.994 1.0 0.756 0.0
356553202722 PREDICTED: uncharacterized protein LOC10 1.0 1.0 0.750 0.0
357491593728 Cohesin loading complex subunit SCC4-lik 0.998 0.990 0.706 0.0
297792441725 binding protein [Arabidopsis lyrata subs 0.995 0.991 0.677 0.0
15242058726 cohesin-load domain-containing protein [ 0.995 0.990 0.676 0.0
110738000726 hypothetical protein [Arabidopsis thalia 0.995 0.990 0.674 0.0
449515149580 PREDICTED: uncharacterized protein LOC10 0.765 0.953 0.759 0.0
>gi|297745732|emb|CBI15788.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1187 bits (3072), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 567/722 (78%), Positives = 641/722 (88%)

Query: 1   MEAVAEGLWGLADYHENKGEIGKAVKCLEAICQSHVSFLPIIEVKTRLRISTLLLKHTHN 60
           ME VAEGLWGLAD HE KGEIGKAVKCLEA+CQS VSFLPI+E+KTRLRI+TLLLKH+HN
Sbjct: 1   METVAEGLWGLADMHEKKGEIGKAVKCLEALCQSQVSFLPILEIKTRLRIATLLLKHSHN 60

Query: 61  VNHAKSHLERSQLLLKAIPSCFELKCRTFSLLSQCYHLVGAIPPQKLILYKALDLTSSAS 120
           +NHAKSHLERSQLLLK+IPSCFELKCR +SLLSQCYHLVGAIPPQK IL KAL+LT+S+ 
Sbjct: 61  LNHAKSHLERSQLLLKSIPSCFELKCRAYSLLSQCYHLVGAIPPQKQILNKALELTASSG 120

Query: 121 QDVAVKLWSCNFNSQLANAFIIEGDYQSSISALQSGYVCATEISYPDLQMFFATAILHVH 180
              AVKLW CNFNSQLANA IIEGDYQ+SISAL+ G+ CATEI Y +LQMFFAT+ILHVH
Sbjct: 121 DGFAVKLWFCNFNSQLANALIIEGDYQNSISALERGFNCATEICYIELQMFFATSILHVH 180

Query: 181 LMQWDDENSVLRSINQCDRVWESIDPNRRGQCLGLLFYNELLHIFYRLRICDYKNAAHHV 240
           LMQWDD N V R++N+C+ VW+SI+P++R Q LGLLFYNELLHIFYRLRICDYKNAA HV
Sbjct: 181 LMQWDDVNLVERAVNKCNEVWDSIEPDKRQQSLGLLFYNELLHIFYRLRICDYKNAAQHV 240

Query: 241 DNLDAAMKADKQKMQEIQQLSSELDALNQSLSRPDLPSRERSALAGRQAKLQQRLRSLED 300
           D LDAAMKAD Q+MQ IQ+L+ ELDALNQSLSR DL   +RSAL+ +QA++Q++LR +  
Sbjct: 241 DKLDAAMKADLQQMQHIQELTKELDALNQSLSRHDLHYTDRSALSEKQAQVQEQLRRVTR 300

Query: 301 SSLTGKEFLEPSYFGNARQAWGDKLVLAPSPMDGEWLPKSAVYALVDLMVVILGRPKGLF 360
              +GKE LE +YFGN ++AWGDKL LAP P+DGEWLPKSAVY L+DLMVVI GRPKG F
Sbjct: 301 LGSSGKESLESAYFGNVKRAWGDKLDLAPPPIDGEWLPKSAVYGLIDLMVVIFGRPKGNF 360

Query: 361 KECMQRIQSGMQTIQDALLKLGITDGVREVDLQHSAIWMAGVYLMLLMQFLENKVAVELT 420
           KEC +RIQSG++TIQ+ L+KLGI+D VREVDLQHSAIWMAGVYLMLLMQFLENKVAVELT
Sbjct: 361 KECGKRIQSGLRTIQEELMKLGISDSVREVDLQHSAIWMAGVYLMLLMQFLENKVAVELT 420

Query: 421 RSGFVEAQEALVQMKNWFIRFPTILQACESMIEMLRGQYAHSVGCYSEAAFHYVEAAKIT 480
           RS FVEAQEALVQM+NWF+RFPTILQACES+IEMLRGQYAHSVGC+SEAAFH++EAAK+T
Sbjct: 421 RSEFVEAQEALVQMRNWFLRFPTILQACESIIEMLRGQYAHSVGCFSEAAFHFIEAAKLT 480

Query: 481 ESKSMQAMCHAYAAVSYFCIGDAESSSQAIDLIGPVYQMKDTINGVREEASLHFAYGLLL 540
           ESKSMQAMC  YAAVSY CIGDAESSSQA DLIGPVY+M D+  GVRE+ S+ FAYGLLL
Sbjct: 481 ESKSMQAMCQVYAAVSYICIGDAESSSQAFDLIGPVYRMMDSFVGVREKTSVLFAYGLLL 540

Query: 541 MRQQDFQEARNRLAKGLQIAHNHMGNLQLVSQYLTILGNLALALHDTVQAREILRSSLTL 600
           M+Q + QEAR RLA GLQI HNH+GNLQLVSQYLTILG+LALALHDT QAREILRSSLTL
Sbjct: 541 MKQHNLQEARIRLATGLQITHNHLGNLQLVSQYLTILGSLALALHDTGQAREILRSSLTL 600

Query: 601 AKKLYDIPTQIWALSVLTALYQQLGDRGNEMENDEYRRKKLDELQKRLADAYSSIHHIEL 660
           AKKL DIPTQIW LSVLTALYQ+LG+RGNEMEN EY+R+K D+LQKRL DA+SSIHHIEL
Sbjct: 601 AKKLCDIPTQIWVLSVLTALYQELGERGNEMENSEYQRRKADDLQKRLVDAHSSIHHIEL 660

Query: 661 ISKVKLEVQQFHELDIKRAMANQSMSVNLDIPESIGLSTPLPVQSSSRLIDLDGGRRGKR 720
           I KV+LEV+Q HELDIKRA+A  SM V+LDIPES+GL TP P  SSSRL+DLD GRRGKR
Sbjct: 661 IEKVRLEVRQLHELDIKRAVAGSSMRVSLDIPESVGLLTPSPAPSSSRLVDLDTGRRGKR 720

Query: 721 KI 722
           KI
Sbjct: 721 KI 722

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225434291|ref|XP_002275860.1| PREDICTED: MAU2 chromatid cohesion factor homolog [Vitis vinifera] Back     alignment and taxonomy information
>gi|356500968|ref|XP_003519302.1| PREDICTED: uncharacterized protein LOC100777199 [Glycine max] Back     alignment and taxonomy information
>gi|449456905|ref|XP_004146189.1| PREDICTED: uncharacterized protein LOC101207429 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356553202|ref|XP_003544947.1| PREDICTED: uncharacterized protein LOC100780498 [Glycine max] Back     alignment and taxonomy information
>gi|357491593|ref|XP_003616084.1| Cohesin loading complex subunit SCC4-like protein [Medicago truncatula] gi|355517419|gb|AES99042.1| Cohesin loading complex subunit SCC4-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|297792441|ref|XP_002864105.1| binding protein [Arabidopsis lyrata subsp. lyrata] gi|297309940|gb|EFH40364.1| binding protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15242058|ref|NP_199947.1| cohesin-load domain-containing protein [Arabidopsis thaliana] gi|9759280|dbj|BAB09745.1| unnamed protein product [Arabidopsis thaliana] gi|332008685|gb|AED96068.1| cohesin-load domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|110738000|dbj|BAF00935.1| hypothetical protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449515149|ref|XP_004164612.1| PREDICTED: uncharacterized protein LOC101227912 [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query722
TAIR|locus:2163655726 AT5G51340 "AT5G51340" [Arabido 0.995 0.990 0.676 2e-269
UNIPROTKB|B4PS83632 GE24275 "MAU2 chromatid cohesi 0.317 0.362 0.265 5.3e-20
FB|FBgn0038300632 CG4203 [Drosophila melanogaste 0.317 0.362 0.265 1.4e-19
UNIPROTKB|B3P0R4632 GG16893 "MAU2 chromatid cohesi 0.317 0.362 0.261 2.9e-19
UNIPROTKB|B4HE12632 GM24202 "MAU2 chromatid cohesi 0.317 0.362 0.261 2.9e-19
UNIPROTKB|B4QZ45632 GD18992 "MAU2 chromatid cohesi 0.317 0.362 0.261 2.9e-19
UNIPROTKB|B3M1B7639 GF17837 "MAU2 chromatid cohesi 0.317 0.358 0.257 9.7e-19
UNIPROTKB|Q7PXE1644 AgaP_AGAP001363 "AGAP001363-PA 0.318 0.357 0.270 1.6e-18
UNIPROTKB|Q16NZ8620 AAEL011819 "MAU2 chromatid coh 0.318 0.370 0.254 2e-18
UNIPROTKB|B0WYS3616 CPIJ012302 "MAU2 chromatid coh 0.318 0.373 0.250 2.9e-18
TAIR|locus:2163655 AT5G51340 "AT5G51340" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2591 (917.1 bits), Expect = 2.0e-269, P = 2.0e-269
 Identities = 489/723 (67%), Positives = 605/723 (83%)

Query:     3 AVAEGLWGLADYHENKGEIGKAVKCLEAICQSHVSFLPIIEVKTRLRISTLLLKHTHNVN 62
             AVAEGLWGLAD+H+  GEIGK +KCLEAICQS +SFLP++EVK+RLR++ LLL+++HNVN
Sbjct:     5 AVAEGLWGLADHHQKLGEIGKTIKCLEAICQSQISFLPLVEVKSRLRLAALLLRYSHNVN 64

Query:    63 HAKSHLERSQLLLKAIPSCFELKCRTFSLLSQCYHLVGAIPPQKLILYKALDLTSSASQD 122
             HAKSHLERS LLLK+IPS ++LK + +SLLS CYHL+ + PPQ+ +L KAL+L SS  QD
Sbjct:    65 HAKSHLERSLLLLKSIPSSYDLKFQNYSLLSHCYHLLASFPPQRNLLVKALELASSVPQD 124

Query:   123 VAVKLWSCNFNSQLANAFIIEGDYQSSISALQSGYVCATEISYPDLQMFFATAILHVHLM 182
             ++  LWSCNFNSQLAN FII+ D+ SS+SAL+SG++ A+ I +P+LQMFF  ++LHVH+M
Sbjct:   125 ISAYLWSCNFNSQLANTFIIQADFPSSLSALESGFLSASHICFPELQMFFTASMLHVHIM 184

Query:   183 QWDDENSVLRSINQCDRVWESIDPNRRGQCLGLLFYNELLHIFYRLRICDYKNAAHHVDN 242
             QW D+ SV +++ +CD +W++I  ++  +C GL FYNE+LH+FYRLR+CDYKNA HHVD 
Sbjct:   185 QWTDDYSVEKAVQRCDEIWQTISSDKTDRCPGLFFYNEMLHVFYRLRLCDYKNAQHHVDR 244

Query:   243 LDAAMKADKQKMQEIQQLSSELDALNQSLSRPDLPSRERSALAGRQAKLQQRLRSLEDSS 302
             LD AM A   KMQEIQQL  EL +LN SLSR DLPSRERSAL+ RQ++LQ R+ +L  SS
Sbjct:   245 LDQAMNAHSHKMQEIQQLLDELSSLNLSLSRYDLPSRERSALSARQSQLQDRVNALSPSS 304

Query:   303 LTGKEFLEPSYFGNARQAWGDKLVLAPSPMDGEWLPKSAVYALVDLMVVILGRPKGLFKE 362
              T    LEP+YFGN  + W +KL+L+PSP+DGEWLPKSA+ ALV LMVVI GRPKGLFKE
Sbjct:   305 STVNS-LEPAYFGNIDRGWTEKLLLSPSPIDGEWLPKSAIDALVHLMVVISGRPKGLFKE 363

Query:   363 CMQRIQSGMQTIQDALLKLGITDGVREVDLQHSAIWMAGVYLMLLMQFLENKVAVELTRS 422
             C +RI+SG+Q IQD L+KLGITD VRE DL+H+AIWM+ V+LML MQFLEN+VA+ELTRS
Sbjct:   364 CSKRIESGLQIIQDELIKLGITDEVREADLRHTAIWMSRVFLMLQMQFLENRVALELTRS 423

Query:   423 GFVEAQEALVQMKNWFIRFPTILQACESMIEMLRGQYAHSVGCYSEAAFHYVEAAKITES 482
              +VEA+EALV MKNWF RFPTILQA E MIEMLRGQY+HSVGCYSEAAFH +EA K+TES
Sbjct:   424 DYVEAEEALVDMKNWFTRFPTILQASECMIEMLRGQYSHSVGCYSEAAFHCIEATKLTES 483

Query:   483 KSMQAMCHAYAAVSYFCIGDAESSSQAIDLIGPVYQMKDTINGVREEASLHFAYGLLLMR 542
              SMQA C A+AAVSY  IGDAESSS+A+DLIGP+  M ++++GVREEAS+ FAYGLLLM+
Sbjct:   484 ISMQASCQAFAAVSYLTIGDAESSSKALDLIGPLNGMTNSLSGVREEASILFAYGLLLMK 543

Query:   543 QQDFQEARNRLAKGLQIAHNHMGNLQLVSQYLTILGNLALALHDTVQAREILRSSLTLAK 602
             Q+D QEARNRLAKGLQIAHNHMGNLQLV+QYLT+LGNLAL+LHDTVQAREILRSSLTLAK
Sbjct:   544 QRDLQEARNRLAKGLQIAHNHMGNLQLVAQYLTLLGNLALSLHDTVQAREILRSSLTLAK 603

Query:   603 KLYDIPTQIWALSVLTALYQQLGDRGNEMENDEYRRKKLDELQKRLADAYSSIHHIELIS 662
             KLYDIPTQ+W LS+ TALYQQLG++GNEMEN+E+R+KK DELQ RLA+A  SIHHIEL++
Sbjct:   604 KLYDIPTQLWVLSIFTALYQQLGEKGNEMENEEFRKKKWDELQSRLAEARGSIHHIELVA 663

Query:   663 KVKLEVQQFHELDIKRAM--ANQSMSVNLDIPESIGLSTPLPVQSSSRLIDLDGGRR-GK 719
             K ++E+ Q      ++++  + QSM  NLDIPES+G+  P P  SSSRL+ LD G+R GK
Sbjct:   664 KARIELYQIDNNPQEQSLVASAQSMQGNLDIPESVGIEGPSPAPSSSRLVGLDTGKRWGK 723

Query:   720 RKI 722
             R++
Sbjct:   724 RRM 726
GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0000956 "nuclear-transcribed mRNA catabolic process" evidence=RCA
GO:0006487 "protein N-linked glycosylation" evidence=RCA
UNIPROTKB|B4PS83 GE24275 "MAU2 chromatid cohesion factor homolog" [Drosophila yakuba (taxid:7245)] Back     alignment and assigned GO terms
FB|FBgn0038300 CG4203 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|B3P0R4 GG16893 "MAU2 chromatid cohesion factor homolog" [Drosophila erecta (taxid:7220)] Back     alignment and assigned GO terms
UNIPROTKB|B4HE12 GM24202 "MAU2 chromatid cohesion factor homolog" [Drosophila sechellia (taxid:7238)] Back     alignment and assigned GO terms
UNIPROTKB|B4QZ45 GD18992 "MAU2 chromatid cohesion factor homolog" [Drosophila simulans (taxid:7240)] Back     alignment and assigned GO terms
UNIPROTKB|B3M1B7 GF17837 "MAU2 chromatid cohesion factor homolog" [Drosophila ananassae (taxid:7217)] Back     alignment and assigned GO terms
UNIPROTKB|Q7PXE1 AgaP_AGAP001363 "AGAP001363-PA" [Anopheles gambiae (taxid:7165)] Back     alignment and assigned GO terms
UNIPROTKB|Q16NZ8 AAEL011819 "MAU2 chromatid cohesion factor homolog" [Aedes aegypti (taxid:7159)] Back     alignment and assigned GO terms
UNIPROTKB|B0WYS3 CPIJ012302 "MAU2 chromatid cohesion factor homolog" [Culex quinquefasciatus (taxid:7176)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00023909001
SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (722 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query722
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 3e-05
pfam10345592 pfam10345, Cohesin_load, Cohesin loading factor 1e-04
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information 
 Score = 42.4 bits (100), Expect = 3e-05
 Identities = 23/77 (29%), Positives = 35/77 (45%)

Query: 527 REEASLHFAYGLLLMRQQDFQEARNRLAKGLQIAHNHMGNLQLVSQYLTILGNLALALHD 586
            + A+      L+L R  D+ EA   L K L++A     +    ++ L  L  L LAL D
Sbjct: 2   PDLAAALNNLALVLRRLGDYDEALELLEKALELARELGEDHPETARALNNLARLYLALGD 61

Query: 587 TVQAREILRSSLTLAKK 603
             +A E L  +L L + 
Sbjct: 62  YDEALEYLEKALALREA 78

Length = 78
>gnl|CDD|220706 pfam10345, Cohesin_load, Cohesin loading factor Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 722
KOG2300629 consensus Uncharacterized conserved protein [Funct 100.0
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 100.0
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 99.7
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.7
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.65
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.6
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 99.6
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.59
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.57
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.57
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.55
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.53
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.42
PRK04841903 transcriptional regulator MalT; Provisional 99.41
PRK11788389 tetratricopeptide repeat protein; Provisional 99.39
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.37
PRK04841 903 transcriptional regulator MalT; Provisional 99.28
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.25
PRK11788389 tetratricopeptide repeat protein; Provisional 99.24
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.22
KOG1941 518 consensus Acetylcholine receptor-associated protei 99.21
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.12
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.09
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.09
KOG1941518 consensus Acetylcholine receptor-associated protei 99.06
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.03
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 98.98
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 98.96
PRK12370553 invasion protein regulator; Provisional 98.93
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.89
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 98.89
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.89
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 98.83
PRK12370553 invasion protein regulator; Provisional 98.82
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 98.8
PRK11189296 lipoprotein NlpI; Provisional 98.79
PRK11189296 lipoprotein NlpI; Provisional 98.76
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.75
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.73
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 98.69
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.69
KOG1126638 consensus DNA-binding cell division cycle control 98.68
PRK14574 822 hmsH outer membrane protein; Provisional 98.68
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.6
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.59
PRK10747398 putative protoheme IX biogenesis protein; Provisio 98.59
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.56
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.55
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.52
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.51
KOG1126638 consensus DNA-binding cell division cycle control 98.49
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.43
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.38
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 98.37
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 98.35
KOG0547606 consensus Translocase of outer mitochondrial membr 98.35
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.3
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.29
KOG2300629 consensus Uncharacterized conserved protein [Funct 98.28
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.25
PRK10747398 putative protoheme IX biogenesis protein; Provisio 98.22
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 98.21
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.2
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 98.18
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 98.17
KOG1129478 consensus TPR repeat-containing protein [General f 98.16
PLN03218 1060 maturation of RBCL 1; Provisional 98.16
KOG2003840 consensus TPR repeat-containing protein [General f 98.16
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.14
KOG2076 895 consensus RNA polymerase III transcription factor 98.13
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.13
PLN03218 1060 maturation of RBCL 1; Provisional 98.12
PRK10370198 formate-dependent nitrite reductase complex subuni 98.06
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.01
KOG1129478 consensus TPR repeat-containing protein [General f 97.99
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.97
PRK10370198 formate-dependent nitrite reductase complex subuni 97.94
PLN03077 857 Protein ECB2; Provisional 97.94
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.92
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 97.88
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 97.85
PRK14574 822 hmsH outer membrane protein; Provisional 97.82
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 97.82
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.79
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.78
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 97.75
PRK15359144 type III secretion system chaperone protein SscB; 97.74
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.73
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.67
PRK15359144 type III secretion system chaperone protein SscB; 97.64
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.62
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 97.59
PF1286294 Apc5: Anaphase-promoting complex subunit 5 97.58
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 97.58
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 97.54
PLN03077 857 Protein ECB2; Provisional 97.5
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.48
KOG2003 840 consensus TPR repeat-containing protein [General f 97.47
KOG1125579 consensus TPR repeat-containing protein [General f 97.47
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.43
PF12688120 TPR_5: Tetratrico peptide repeat 97.4
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 97.4
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.39
KOG1585308 consensus Protein required for fusion of vesicles 97.38
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.37
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.32
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.31
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.29
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 97.27
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.21
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.19
KOG0548 539 consensus Molecular co-chaperone STI1 [Posttransla 97.19
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.18
PF12688120 TPR_5: Tetratrico peptide repeat 97.13
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.13
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.09
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 97.09
KOG2376 652 consensus Signal recognition particle, subunit Srp 97.09
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 97.07
KOG0547606 consensus Translocase of outer mitochondrial membr 97.06
COG4700251 Uncharacterized protein conserved in bacteria cont 97.05
KOG2076 895 consensus RNA polymerase III transcription factor 97.04
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.03
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 97.02
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 96.93
KOG1125579 consensus TPR repeat-containing protein [General f 96.93
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 96.9
PRK14720 906 transcript cleavage factor/unknown domain fusion p 96.9
KOG0495913 consensus HAT repeat protein [RNA processing and m 96.88
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 96.83
PRK10803263 tol-pal system protein YbgF; Provisional 96.76
KOG4555175 consensus TPR repeat-containing protein [Function 96.76
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 96.71
KOG1586288 consensus Protein required for fusion of vesicles 96.7
KOG1128777 consensus Uncharacterized conserved protein, conta 96.69
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 96.67
PF1286294 Apc5: Anaphase-promoting complex subunit 5 96.66
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 96.66
PRK10803263 tol-pal system protein YbgF; Provisional 96.63
KOG1585308 consensus Protein required for fusion of vesicles 96.58
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 96.56
KOG2376652 consensus Signal recognition particle, subunit Srp 96.55
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 96.48
KOG1586288 consensus Protein required for fusion of vesicles 96.46
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 96.43
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.41
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.39
PRK10153517 DNA-binding transcriptional activator CadC; Provis 96.39
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 96.36
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 96.32
PLN02789320 farnesyltranstransferase 96.27
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 96.19
KOG0495913 consensus HAT repeat protein [RNA processing and m 96.12
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 96.09
KOG4555175 consensus TPR repeat-containing protein [Function 96.08
COG4105254 ComL DNA uptake lipoprotein [General function pred 96.08
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 96.03
KOG4340 459 consensus Uncharacterized conserved protein [Funct 96.01
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 95.98
COG4783484 Putative Zn-dependent protease, contains TPR repea 95.93
PRK11906458 transcriptional regulator; Provisional 95.79
PF1337173 TPR_9: Tetratricopeptide repeat 95.78
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 95.7
KOG0553304 consensus TPR repeat-containing protein [General f 95.69
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 95.68
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 95.58
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.52
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 95.43
COG4783484 Putative Zn-dependent protease, contains TPR repea 95.41
KOG2471696 consensus TPR repeat-containing protein [General f 95.39
KOG1128777 consensus Uncharacterized conserved protein, conta 95.38
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.3
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 95.29
COG2976207 Uncharacterized protein conserved in bacteria [Fun 95.18
COG2976207 Uncharacterized protein conserved in bacteria [Fun 95.08
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 94.91
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 94.89
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 94.83
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 94.83
PRK14720 906 transcript cleavage factor/unknown domain fusion p 94.78
COG0457291 NrfG FOG: TPR repeat [General function prediction 94.77
PRK15331165 chaperone protein SicA; Provisional 94.74
KOG0553304 consensus TPR repeat-containing protein [General f 94.73
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 94.62
PRK15331165 chaperone protein SicA; Provisional 94.53
COG0457291 NrfG FOG: TPR repeat [General function prediction 94.53
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 94.51
KOG2796366 consensus Uncharacterized conserved protein [Funct 94.51
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 94.45
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 94.31
PF09986214 DUF2225: Uncharacterized protein conserved in bact 94.26
COG1729262 Uncharacterized protein conserved in bacteria [Fun 94.2
COG4235287 Cytochrome c biogenesis factor [Posttranslational 94.17
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 94.15
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 94.14
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 94.14
COG3898 531 Uncharacterized membrane-bound protein [Function u 94.09
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 94.05
COG1729262 Uncharacterized protein conserved in bacteria [Fun 94.01
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 93.89
PF13512142 TPR_18: Tetratricopeptide repeat 93.87
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 93.74
PF09986214 DUF2225: Uncharacterized protein conserved in bact 93.53
COG4700251 Uncharacterized protein conserved in bacteria cont 93.5
COG4235287 Cytochrome c biogenesis factor [Posttranslational 93.32
PF1337173 TPR_9: Tetratricopeptide repeat 93.14
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 93.12
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 93.11
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 93.03
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 92.95
KOG2471 696 consensus TPR repeat-containing protein [General f 92.89
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 92.75
COG3898 531 Uncharacterized membrane-bound protein [Function u 92.5
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 92.33
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 92.18
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 92.11
PLN02789320 farnesyltranstransferase 91.98
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 91.9
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 91.82
KOG4340459 consensus Uncharacterized conserved protein [Funct 91.52
PF03704146 BTAD: Bacterial transcriptional activator domain; 91.38
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 91.11
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 91.09
KOG1463411 consensus 26S proteasome regulatory complex, subun 90.93
PRK11906458 transcriptional regulator; Provisional 90.68
KOG2047 835 consensus mRNA splicing factor [RNA processing and 90.49
KOG3616 1636 consensus Selective LIM binding factor [Transcript 90.41
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 90.37
COG4105254 ComL DNA uptake lipoprotein [General function pred 90.21
PF13512142 TPR_18: Tetratricopeptide repeat 89.66
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 89.6
PF03704146 BTAD: Bacterial transcriptional activator domain; 89.43
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 89.34
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 89.23
KOG2581493 consensus 26S proteasome regulatory complex, subun 88.77
COG4649221 Uncharacterized protein conserved in bacteria [Fun 86.75
KOG3060289 consensus Uncharacterized conserved protein [Funct 86.53
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 85.32
KOG3785 557 consensus Uncharacterized conserved protein [Funct 84.45
PF1342844 TPR_14: Tetratricopeptide repeat 84.43
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 83.98
KOG3783546 consensus Uncharacterized conserved protein [Funct 83.79
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 83.28
KOG3616 1636 consensus Selective LIM binding factor [Transcript 82.84
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 82.8
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 82.61
PF1342844 TPR_14: Tetratricopeptide repeat 82.03
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 81.88
KOG3785 557 consensus Uncharacterized conserved protein [Funct 81.81
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 81.61
COG5159421 RPN6 26S proteasome regulatory complex component [ 81.18
KOG4234271 consensus TPR repeat-containing protein [General f 81.01
KOG1463411 consensus 26S proteasome regulatory complex, subun 80.87
COG5159 421 RPN6 26S proteasome regulatory complex component [ 80.71
KOG2796366 consensus Uncharacterized conserved protein [Funct 80.38
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 80.36
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information 
Probab=100.00  E-value=5.4e-115  Score=926.03  Aligned_cols=617  Identities=39%  Similarity=0.630  Sum_probs=555.1

Q ss_pred             hhHHHHHHHhHHHHHhhc--cHhHHhHHHHHHhccCCCCChHHHHHHHHHHHHHHHhhcCChHHHHHHHHHHHHHHhcCC
Q 004943            2 EAVAEGLWGLADYHENKG--EIGKAVKCLEAICQSHVSFLPIIEVKTRLRISTLLLKHTHNVNHAKSHLERSQLLLKAIP   79 (722)
Q Consensus         2 ~~~~~~L~~lAe~~~~~~--~i~~ai~CLeA~l~~~~~l~p~~EA~~rLrla~iL~e~T~N~~~A~thLeka~~l~~~~~   79 (722)
                      |+||++||||||+|||++  +|++|||||+|+|+|++  |-++|||||||+|.+||.||+|+++||+||||||+++++||
T Consensus         4 dAva~aLlGlAe~~rt~~PPkIkk~IkClqA~~~~~i--s~~veart~LqLg~lL~~yT~N~elAksHLekA~~i~~~ip   81 (629)
T KOG2300|consen    4 DAVAEALLGLAEHFRTSGPPKIKKCIKCLQAIFQFQI--SFLVEARTHLQLGALLLRYTKNVELAKSHLEKAWLISKSIP   81 (629)
T ss_pred             hHHHHHHHHHHHHHhhcCChhHHHHHHHHHHHhccCC--hHHHHHHHHHHHHHHHHHHhccHHHHHHHHHHHHHHHcccc
Confidence            599999999999999999  99999999999999999  88999999999999999999999999999999999999999


Q ss_pred             cchhhhhhhhHHHHHHHHHcC-CCchHHHHHHHHHHHhhhhhcccccchhHHHHhhHHHhHhhhcCChHHHHHHHHhHHH
Q 004943           80 SCFELKCRTFSLLSQCYHLVG-AIPPQKLILYKALDLTSSASQDVAVKLWSCNFNSQLANAFIIEGDYQSSISALQSGYV  158 (722)
Q Consensus        80 ~~~dlk~~~~~lLa~~y~~~~-~~~~~k~~l~k~i~~~~~~~~~~~~~~W~~~f~f~la~~~~~~~d~~~A~~~L~~g~~  158 (722)
                      +|+|+||.+.||||++|++.+ +..++|.+++|+|+++++      .++|+|+|+||+|++|.+++|+.+|++.|..|+.
T Consensus        82 ~fydvKf~a~SlLa~lh~~~~~s~~~~KalLrkaielsq~------~p~wsckllfQLaql~~idkD~~sA~elLavga~  155 (629)
T KOG2300|consen   82 SFYDVKFQAASLLAHLHHQLAQSFPPAKALLRKAIELSQS------VPYWSCKLLFQLAQLHIIDKDFPSALELLAVGAE  155 (629)
T ss_pred             cHHhhhhHHHHHHHHHHHHhcCCCchHHHHHHHHHHHhcC------CchhhHHHHHHHHHHHhhhccchhHHHHHhcccc
Confidence            999999999999999999999 669999999999999998      7899999999999999999999999999999999


Q ss_pred             HHhhcCChhHHHHHHHHHHHHHhcccCChhHHHHHHHhhhHHhhhcCccccccccchhhhhhHHHHHH-Hhhhhhhhhhh
Q 004943          159 CATEISYPDLQMFFATAILHVHLMQWDDENSVLRSINQCDRVWESIDPNRRGQCLGLLFYNELLHIFY-RLRICDYKNAA  237 (722)
Q Consensus       159 ~A~~~~~~~~~v~f~l~~~~~~L~~~~~~~~v~~~l~~~~~~~~~i~~~~~~~~~g~~~~~e~l~i~~-~l~ic~~~~~~  237 (722)
                      .|...+.++++++|.++.+|+++|+| |..+|++.+++|+++|+        ++++.++++|+||||| +|++|.|...|
T Consensus       156 sAd~~~~~ylr~~ftls~~~ll~me~-d~~dV~~ll~~~~qi~~--------n~~sdk~~~E~LkvFyl~lql~yy~~~g  226 (629)
T KOG2300|consen  156 SADHICFPYLRMLFTLSMLMLLIMER-DDYDVEKLLQRCGQIWQ--------NISSDKTQKEMLKVFYLVLQLSYYLLPG  226 (629)
T ss_pred             ccchhhhHHHHHHHHHHHHHHHHhCc-cHHHHHHHHHHHHHHHh--------ccCCChHHHHHHHHHHHHHHHHHHhccc
Confidence            99999999999999999999999997 78899999999999999        8888889999999999 89999999999


Q ss_pred             hhhhhHHHHHHHhHHHHHHHHHHhhhhHHhhhhcCCCCCChhhhHHHHHHHHHHHHHHHhcccCcCcccccCCccccCCC
Q 004943          238 HHVDNLDAAMKADKQKMQEIQQLSSELDALNQSLSRPDLPSRERSALAGRQAKLQQRLRSLEDSSLTGKEFLEPSYFGNA  317 (722)
Q Consensus       238 ~~v~~~~~~~~~~~~~~~~~~~l~~~l~~l~~~l~~~~~~~~~~~~~~~~~~~lq~~l~~~~~~~~~~~~~l~~~~~~~~  317 (722)
                      + |+.+++|+                                         ||||++++++..++               
T Consensus       227 q-~rt~k~~l-----------------------------------------kQLQ~siqtist~~---------------  249 (629)
T KOG2300|consen  227 Q-VRTVKPAL-----------------------------------------KQLQDSIQTISTSS---------------  249 (629)
T ss_pred             c-hhhhHHHH-----------------------------------------HHHHHHHhccCCCC---------------
Confidence            9 99999998                                         68999999833111               


Q ss_pred             ccccCcccccCCCCCcccccCcchhHHHHHHHHHHhhccCCChHHHHHHHHHHHHHHHHHHHhcCCCCCcccchhhhhHH
Q 004943          318 RQAWGDKLVLAPSPMDGEWLPKSAVYALVDLMVVILGRPKGLFKECMQRIQSGMQTIQDALLKLGITDGVREVDLQHSAI  397 (722)
Q Consensus       318 ~~~~~d~~~~~~~~~~~~WLpk~~l~aLvylls~~~~~~kg~~~kA~k~~~~AL~~i~~~~~~lg~~~g~~e~~l~~~~~  397 (722)
                       ...++++...+++..|+||||+++|||||+++|+++|+.|+|++|.||.++++..    .+++...++           
T Consensus       250 -~~h~e~ilgsps~~l~~wlpkeqicaLV~l~tv~hsm~~gy~~~~~K~tDe~i~q----~eklkq~d~-----------  313 (629)
T KOG2300|consen  250 -RGHDEKILGSPSPILFEWLPKEQICALVYLVTVIHSMPAGYFKKAQKYTDEAIKQ----TEKLKQADL-----------  313 (629)
T ss_pred             -CCccccccCCCChHHHhhccHhhhHhhhhhhHHhhhhhhHHHHHHHHHHHHHHHH----Hhhcccccc-----------
Confidence             1134444444556669999999999999999999999999999999999999999    555554443           


Q ss_pred             HHHHHHHHHHHHHHHhhHHHHHhhCCHHHHHHHHHHHHHHHHhCCc--hhhhhHHHHHHHHHHHHHHhCCHHHHHHHHHH
Q 004943          398 WMAGVYLMLLMQFLENKVAVELTRSGFVEAQEALVQMKNWFIRFPT--ILQACESMIEMLRGQYAHSVGCYSEAAFHYVE  475 (722)
Q Consensus       398 w~~~~y~~l~a~lLe~Lg~~~l~~g~~~eA~~~l~~Al~l~~~~~d--~~~~~~a~i~~llG~~~~alG~~~~Al~~f~~  475 (722)
                       +.+++.++++.+||++++|.+++|++.+|++.+.+++++|.++|.  +++.+.+.+|+++|.|+++.|+|+.|+.||..
T Consensus       314 -~srilsm~km~~LE~iv~c~lv~~~~~~al~~i~dm~~w~~r~p~~~Llr~~~~~ih~LlGlys~sv~~~enAe~hf~~  392 (629)
T KOG2300|consen  314 -MSRILSMFKMILLEHIVMCRLVRGDYVEALEEIVDMKNWCTRFPTPLLLRAHEAQIHMLLGLYSHSVNCYENAEFHFIE  392 (629)
T ss_pred             -hhHHHHHHHHHHHHHHHHHHHHhCCHHHHHHHHHHHHHHHHhCCchHHHHHhHHHHHHHHhhHhhhcchHHHHHHHHHH
Confidence             457888999999999999999999999999999999999999998  88899999999999999999999999999999


Q ss_pred             HHHhhcchhHHHHHHHHHHHHHHhcCChhHHHHHHHHhcchhcccccccChHHHHHHHHHHHHHHHhcCCHHHHHHHHHH
Q 004943          476 AAKITESKSMQAMCHAYAAVSYFCIGDAESSSQAIDLIGPVYQMKDTINGVREEASLHFAYGLLLMRQQDFQEARNRLAK  555 (722)
Q Consensus       476 AL~l~~~~~~~A~allnla~v~l~~G~~e~a~~aL~l~~~l~r~~~~~~~~~~~A~al~~lG~~~~~~G~~~eAk~~L~q  555 (722)
                      |++.+.....+|+|+.|+|++|++.|+.+.+.++++.++|..+.+.  .+.+.++.++++.|...+.+|+++|||+++++
T Consensus       393 a~k~t~~~dl~a~~nlnlAi~YL~~~~~ed~y~~ld~i~p~nt~s~--ssq~l~a~~~~v~glfaf~qn~lnEaK~~l~e  470 (629)
T KOG2300|consen  393 ATKLTESIDLQAFCNLNLAISYLRIGDAEDLYKALDLIGPLNTNSL--SSQRLEASILYVYGLFAFKQNDLNEAKRFLRE  470 (629)
T ss_pred             HHHhhhHHHHHHHHHHhHHHHHHHhccHHHHHHHHHhcCCCCCCcc--hHHHHHHHHHHHHHHHHHHhccHHHHHHHHHH
Confidence            9999999999999999999999999999999999999999854433  23445899999999999999999999999999


Q ss_pred             HHHHHHHhcCChHHHHHHHHHHHHHHHhCCChHHHHHHHHHHHHHHHHcCChhHHHHHHHHHHHHHHHcCC--chhHhHH
Q 004943          556 GLQIAHNHMGNLQLVSQYLTILGNLALALHDTVQAREILRSSLTLAKKLYDIPTQIWALSVLTALYQQLGD--RGNEMEN  633 (722)
Q Consensus       556 AL~la~~~~gd~~l~a~~L~~LG~~~~a~g~~~qA~~~l~~Al~lAkki~D~~~q~~al~~L~~l~~~~Gd--~~~A~e~  633 (722)
                      .|++++. .++-++++++|++||.++...||+.|+++++++|+++|+|++|.++|+|++.++.++|.+.|+  .+.+.+.
T Consensus       471 ~Lkmana-ed~~rL~a~~LvLLs~v~lslgn~~es~nmvrpamqlAkKi~Di~vqLws~si~~~L~~a~g~~~~~~e~e~  549 (629)
T KOG2300|consen  471 TLKMANA-EDLNRLTACSLVLLSHVFLSLGNTVESRNMVRPAMQLAKKIPDIPVQLWSSSILTDLYQALGEKGNEMENEA  549 (629)
T ss_pred             HHhhcch-hhHHHHHHHHHHHHHHHHHHhcchHHHHhccchHHHHHhcCCCchHHHHHHHHHHHHHHHhCcchhhHHHHH
Confidence            9999986 445599999999999999999999999999999999999999999999999999999999999  4555666


Q ss_pred             HHHHHHHHHHHhHHHHHhhhchhhHHHHhhhcchhhccchhhHHhhhhcccccccccCCcccCCCCCCCCcccccccccC
Q 004943          634 DEYRRKKLDELQKRLADAYSSIHHIELISKVKLEVQQFHELDIKRAMANQSMSVNLDIPESIGLSTPLPVQSSSRLIDLD  713 (722)
Q Consensus       634 ~~~~~~~~~~l~~~~~~a~~~~~h~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  713 (722)
                      +..+...++     ...|..+++|.++.-..++.++++.+-+.  ...+|+|+.|||||| +||.+|.|+|||+|+|.+|
T Consensus       550 ~~~~ql~Sr-----~lla~~~i~~~~~~~pa~~ll~wfdgdPp--v~s~p~~~~~l~~pe-t~l~~~~p~~~ss~~~~~~  621 (629)
T KOG2300|consen  550 FRKHQLQSR-----LLLADGSIHHIELVAPAHILLYWFDGDPP--VASAPSMQGNLDIPE-TSLEGPSPAPSSSRLVGLD  621 (629)
T ss_pred             HHHHHHHHH-----HHHhccCcchHhhcccHHhhhhhccCCCc--cccCCccCCccCCCc-ccccCCCCCccccccccCc
Confidence            665444444     45555555555544444444444433332  457899999999999 9999999999999999999


Q ss_pred             C-CCcccc
Q 004943          714 G-GRRGKR  720 (722)
Q Consensus       714 ~-~~~~~~  720 (722)
                      + +|||||
T Consensus       622 ~g~~~~~~  629 (629)
T KOG2300|consen  622 TGKRWGKR  629 (629)
T ss_pred             ccccccCC
Confidence            9 788886

>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query722
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 1e-09
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 9e-05
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 8e-09
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 3e-06
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 1e-04
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 1e-08
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 2e-08
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 4e-08
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 8e-08
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 1e-04
3q15_A378 PSP28, response regulator aspartate phosphatase H; 2e-07
3q15_A378 PSP28, response regulator aspartate phosphatase H; 5e-07
3q15_A378 PSP28, response regulator aspartate phosphatase H; 2e-04
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 2e-07
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 1e-06
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 4e-05
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 1e-06
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 1e-06
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 2e-05
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 7e-05
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 2e-05
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 2e-04
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 4e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 68.7 bits (167), Expect = 5e-12
 Identities = 78/525 (14%), Positives = 156/525 (29%), Gaps = 170/525 (32%)

Query: 238 HHVDNLDAAMKADKQKMQEIQQLSSELDALNQSLSRPDLPSRERSALAGRQAKLQQRLRS 297
           HH  ++D      + + ++I  LS   DA   +    D+    +S L             
Sbjct: 2   HHHHHMDFETGEHQYQYKDI--LSVFEDAFVDNFDCKDVQDMPKSIL------------- 46

Query: 298 LEDSSLTGKEFLEPSYFGNARQAWGDKLVLAPSPMDGE----WL----PKSAVYALVD-- 347
                 + +E               D ++++   + G     W      +  V   V+  
Sbjct: 47  ------SKEEI--------------DHIIMSKDAVSGTLRLFWTLLSKQEEMVQKFVEEV 86

Query: 348 -------LMVVILGRPKG------LFKECMQRIQSGMQ--------------TIQDALLK 380
                  LM  I    +       ++ E   R+ +  Q               ++ ALL+
Sbjct: 87  LRINYKFLMSPIKTEQRQPSMMTRMYIEQRDRLYNDNQVFAKYNVSRLQPYLKLRQALLE 146

Query: 381 LGITDGVREVDLQHSAIWMAGVYLMLLMQFLENK--VAVELTRSGFVEAQEALVQMKN-- 436
           L     V    L      + G            K  VA+++  S  V+ +     M    
Sbjct: 147 LRPAKNV----LIDG---VLGS----------GKTWVALDVCLSYKVQCK-----MDFKI 184

Query: 437 -WFIRFPTILQACESMIEMLRGQYAHSVGCYSEAAFHY------VEAAKITESKSMQAMC 489
            W +         E+++EML+         ++  + H       + + +    + +++  
Sbjct: 185 FW-LNLKNCNSP-ETVLEMLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSKP 242

Query: 490 HAYA-----------AVSYFCIG--------DAESSSQAIDLIGPVYQMKDTINGVREEA 530
           +              A + F +           + +            +      +  + 
Sbjct: 243 YENCLLVLLNVQNAKAWNAFNLSCKILLTTRFKQVTDFLSAATTTHISLDHHSMTLTPDE 302

Query: 531 SLHFAYGLLL----MRQQDF-QEAR--NRLAKGLQIAHNHMGNLQLVSQYLTILGNLALA 583
                  LLL     R QD  +E    N     + IA       + +   L    N    
Sbjct: 303 VK----SLLLKYLDCRPQDLPREVLTTNPRRLSI-IA-------ESIRDGLATWDNWKHV 350

Query: 584 LHDTVQAREILRSSL-----TLAKKLY----------DIPTQIWALSVLTALYQQLGDRG 628
             D +    I+ SSL        +K++           IPT      +L+ ++  +    
Sbjct: 351 NCDKLT--TIIESSLNVLEPAEYRKMFDRLSVFPPSAHIPTI-----LLSLIWFDVIKSD 403

Query: 629 NEMENDEYRRKKLDELQKRLADAYSSIHHIELISKVKLE-VQQFH 672
             +  ++  +  L  ++K+  ++  SI  I L  KVKLE     H
Sbjct: 404 VMVVVNKLHKYSL--VEKQPKESTISIPSIYLELKVKLENEYALH 446
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query722
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.88
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.88
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.87
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.87
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.87
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.85
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.84
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.83
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.77
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.74
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.71
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.7
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.69
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.69
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.69
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.68
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.67
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.67
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.67
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.67
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.67
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.66
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.66
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.64
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.62
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.61
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.61
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.59
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.57
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.57
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.56
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.54
3u4t_A272 TPR repeat-containing protein; structural genomics 99.54
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.53
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.52
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.51
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.5
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.49
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 99.49
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.49
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.47
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.47
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.46
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.46
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.45
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.44
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.44
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.43
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.43
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.42
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.4
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.39
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.39
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.39
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 99.36
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.34
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.34
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.32
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.31
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.31
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.31
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.3
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.3
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.3
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.28
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.28
3u4t_A272 TPR repeat-containing protein; structural genomics 99.27
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.27
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.26
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.25
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.24
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.24
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.24
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.23
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.21
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.21
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.2
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.12
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.11
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.1
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.08
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.03
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.02
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 99.0
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 98.99
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 98.99
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.97
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 98.95
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.88
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 98.87
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.86
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.82
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 98.79
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.78
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.77
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.77
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.76
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.75
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.73
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.68
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.68
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.65
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.64
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.64
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.62
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 98.61
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.6
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.6
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.59
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.57
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.57
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.57
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.56
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.55
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.53
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.45
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 98.44
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.44
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.42
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.4
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.38
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.37
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.36
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.34
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.32
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.32
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.31
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.31
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.3
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.28
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 98.28
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.21
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.19
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.19
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.19
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.18
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.16
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.13
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.13
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.13
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.12
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.1
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.1
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.1
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.09
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.09
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.07
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.07
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.07
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.06
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.04
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.04
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.03
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.03
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.02
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.02
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.0
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.0
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 97.99
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.97
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.97
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 97.95
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.95
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 97.95
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.94
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 97.93
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 97.9
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.9
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.87
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 97.84
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.82
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.82
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 97.79
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.78
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 97.77
3k9i_A117 BH0479 protein; putative protein binding protein, 97.77
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.76
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.75
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.75
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.74
3k9i_A117 BH0479 protein; putative protein binding protein, 97.74
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 97.66
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.65
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 97.63
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 97.52
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.5
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.47
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.38
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 97.38
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 97.35
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.27
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.22
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 97.21
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 97.19
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.02
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 96.62
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.56
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 96.53
1klx_A138 Cysteine rich protein B; structural genomics, heli 96.53
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 96.49
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 96.43
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 96.43
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 96.3
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 96.27
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 96.22
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.19
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.18
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 96.03
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 95.69
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 95.67
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 95.58
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 95.46
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 94.59
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 94.23
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 93.6
1pc2_A152 Mitochondria fission protein; unknown function; NM 93.34
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 93.18
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 93.11
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 92.35
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 91.91
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 91.65
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 91.62
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 90.04
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 89.85
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 88.25
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 88.21
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 87.01
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 86.35
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 86.26
4b4t_S523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 85.95
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 85.45
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 84.8
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 83.82
1pc2_A152 Mitochondria fission protein; unknown function; NM 81.23
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
Probab=99.88  E-value=2.1e-19  Score=193.92  Aligned_cols=268  Identities=9%  Similarity=0.011  Sum_probs=230.5

Q ss_pred             HHHHHHHHHHhhccCCChHHHHHHHHHHHHHHHHHHHhcCCCCCcccchhhhhHHHHHHHHHHHHHHHHHhhHHHHHhhC
Q 004943          343 YALVDLMVVILGRPKGLFKECMQRIQSGMQTIQDALLKLGITDGVREVDLQHSAIWMAGVYLMLLMQFLENKVAVELTRS  422 (722)
Q Consensus       343 ~aLvylls~~~~~~kg~~~kA~k~~~~AL~~i~~~~~~lg~~~g~~e~~l~~~~~w~~~~y~~l~a~lLe~Lg~~~l~~g  422 (722)
                      -...|++.+.++...|++++|.+++++|++.    +.+.++..+                    .+.++.++|.++...|
T Consensus       102 ~~~~~~~~g~~~~~~g~~~~A~~~~~~al~~----~~~~~~~~~--------------------~a~~~~~lg~~~~~~~  157 (383)
T 3ulq_A          102 EYYFNFFRGMYELDQREYLSAIKFFKKAESK----LIFVKDRIE--------------------KAEFFFKMSESYYYMK  157 (383)
T ss_dssp             HHHHHHHHHHHHHHTTCHHHHHHHHHHHHTT----GGGCCCHHH--------------------HHHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHHHHhcCHHHHHHHHHHHHHH----HhhCCCHHH--------------------HHHHHHHHHHHHHHcC
Confidence            3457788899999999999999999999999    666665443                    5666788999999999


Q ss_pred             CHHHHHHHHHHHHHHHHhCCc-hhhhhHHHHHHHHHHHHHHhCCHHHHHHHHHHHHHhhcc---hhHHHHHHHHHHHHHH
Q 004943          423 GFVEAQEALVQMKNWFIRFPT-ILQACESMIEMLRGQYAHSVGCYSEAAFHYVEAAKITES---KSMQAMCHAYAAVSYF  498 (722)
Q Consensus       423 ~~~eA~~~l~~Al~l~~~~~d-~~~~~~a~i~~llG~~~~alG~~~~Al~~f~~AL~l~~~---~~~~A~allnla~v~l  498 (722)
                      ++++|++.+.+|++++...++ .  ...+.+++++|.++..+|++++|+.+|.+|+.+...   ....+.++.|+|.+|.
T Consensus       158 ~~~~A~~~~~~al~~~~~~~~~~--~~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~lg~~y~  235 (383)
T 3ulq_A          158 QTYFSMDYARQAYEIYKEHEAYN--IRLLQCHSLFATNFLDLKQYEDAISHFQKAYSMAEAEKQPQLMGRTLYNIGLCKN  235 (383)
T ss_dssp             CHHHHHHHHHHHHHHHHTCSTTH--HHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHHHHhCccch--HHHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHHHHHcCChHHHHHHHHHHHHHHH
Confidence            999999999999999999987 3  356789999999999999999999999999987653   4478889999999999


Q ss_pred             hcCChhHHHHHHHHhcchhcccccccChHHHHHHHHHHHHHHHhcCCHHHHHHHHHHHHHHHHHhcCChHHHHHHHHHHH
Q 004943          499 CIGDAESSSQAIDLIGPVYQMKDTINGVREEASLHFAYGLLLMRQQDFQEARNRLAKGLQIAHNHMGNLQLVSQYLTILG  578 (722)
Q Consensus       499 ~~G~~e~a~~aL~l~~~l~r~~~~~~~~~~~A~al~~lG~~~~~~G~~~eAk~~L~qAL~la~~~~gd~~l~a~~L~~LG  578 (722)
                      ..|+++.+...++.+..++...++   ....+.+++.+|.++..+|++++|..++++|++++. ..+++...+. +..||
T Consensus       236 ~~g~~~~A~~~~~~al~~~~~~~~---~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~~-~~~~~~~~~~-~~~l~  310 (383)
T 3ulq_A          236 SQSQYEDAIPYFKRAIAVFEESNI---LPSLPQAYFLITQIHYKLGKIDKAHEYHSKGMAYSQ-KAGDVIYLSE-FEFLK  310 (383)
T ss_dssp             HTTCHHHHHHHHHHHHHHHHHTTC---GGGHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHH-HHTCHHHHHH-HHHHH
T ss_pred             HCCCHHHHHHHHHHHHHHHHhhcc---chhHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHH-HcCCHHHHHH-HHHHH
Confidence            999998866665555554443332   113578999999999999999999999999999986 6899777776 78899


Q ss_pred             HHHHhCCChHHHHHHHHHHHHHHHHcCChhHHHHHHHHHHHHHHHcCCchhHhHHHHHHHHHHHHHh
Q 004943          579 NLALALHDTVQAREILRSSLTLAKKLYDIPTQIWALSVLTALYQQLGDRGNEMENDEYRRKKLDELQ  645 (722)
Q Consensus       579 ~~~~a~g~~~qA~~~l~~Al~lAkki~D~~~q~~al~~L~~l~~~~Gd~~~A~e~~~~~~~~~~~l~  645 (722)
                      .++...|+.    +.+..|+..+++.++.+....+...|+.+|...|++++|.++++.+....+++.
T Consensus       311 ~~~~~~~~~----~~~~~al~~~~~~~~~~~~~~~~~~la~~y~~~g~~~~A~~~~~~al~~~~~i~  373 (383)
T 3ulq_A          311 SLYLSGPDE----EAIQGFFDFLESKMLYADLEDFAIDVAKYYHERKNFQKASAYFLKVEQVRQLIQ  373 (383)
T ss_dssp             HHHTSSCCH----HHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHTSCS
T ss_pred             HHHhCCCcH----HHHHHHHHHHHHCcCHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHhh
Confidence            999999997    788899999999999999999999999999999999999999999988877654
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 722
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 0.003
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 38.1 bits (87), Expect = 0.003
 Identities = 22/182 (12%), Positives = 52/182 (28%), Gaps = 25/182 (13%)

Query: 445 LQACESMIEMLRGQYAHSVGCYSEAAFHYVEAAKITESKSMQAMCHAYAAVSYFCIGDAE 504
           L    +++        +  G    A   Y  A ++   +      +   A +    G   
Sbjct: 232 LSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIEL---QPHFPDAYCNLANALKEKGSVA 288

Query: 505 SSSQAIDLIGPVYQMKDTINGVREEASLHFAYGLLLMRQQDFQEARNRLAKGLQIAHNHM 564
              +A D           +      A        +   Q + +EA     K L++     
Sbjct: 289 ---EAED------CYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEF- 338

Query: 565 GNLQLVSQYLTILGNLALALHDTVQAREILRSSLTLAKKLYDIPTQIWALSVLTALYQQL 624
                 +   + L ++        +A    + ++ ++      PT   A S +    +++
Sbjct: 339 ------AAAHSNLASVLQQQGKLQEALMHYKEAIRIS------PTFADAYSNMGNTLKEM 386

Query: 625 GD 626
            D
Sbjct: 387 QD 388

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query722
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.72
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.66
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.6
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.43
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.42
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.28
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.23
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.15
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.93
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.9
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.83
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.64
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.63
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.62
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.52
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.42
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.3
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.3
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.17
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.05
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.01
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.0
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.0
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 97.98
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.97
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 97.95
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.94
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.94
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.94
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.93
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.89
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.85
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.85
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.83
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.83
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.82
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.82
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.79
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.76
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.7
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 97.63
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 97.6
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.51
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.31
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.26
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.15
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.12
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 96.88
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 96.59
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 95.99
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 95.92
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 95.43
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 93.47
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 92.3
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 89.24
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 83.07
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Transcription factor MalT domain III
domain: Transcription factor MalT domain III
species: Escherichia coli [TaxId: 562]

Probab=99.72  E-value=1.5e-15  Score=154.25  Aligned_cols=273  Identities=12%  Similarity=0.027  Sum_probs=223.0

Q ss_pred             HHHHHHHHHHhhccCCChHHHHHHHHHHHHHHHHHHHhcCCCCCcccchhhhhHHHHHHHHHHHHHHHHHhhHHHHHhhC
Q 004943          343 YALVDLMVVILGRPKGLFKECMQRIQSGMQTIQDALLKLGITDGVREVDLQHSAIWMAGVYLMLLMQFLENKVAVELTRS  422 (722)
Q Consensus       343 ~aLvylls~~~~~~kg~~~kA~k~~~~AL~~i~~~~~~lg~~~g~~e~~l~~~~~w~~~~y~~l~a~lLe~Lg~~~l~~g  422 (722)
                      .+.++..-+.++...|++++|.++++++++.    ..+.++...                    .+..+.+++.++...|
T Consensus        50 ~~~a~~~lg~~~~~~g~~~~A~~~~~~a~~~----~~~~~~~~~--------------------~~~~~~~~~~~~~~~~  105 (366)
T d1hz4a_          50 RIVATSVLGEVLHCKGELTRSLALMQQTEQM----ARQHDVWHY--------------------ALWSLIQQSEILFAQG  105 (366)
T ss_dssp             HHHHHHHHHHHHHHHTCHHHHHHHHHHHHHH----HHHTTCHHH--------------------HHHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHHHHCCCHHHHHHHHHHHHHH----HHhhcchHH--------------------HHHHHHHHHHHHHHHH
Confidence            3455666688888999999999999999999    555554332                    4455567899999999


Q ss_pred             CHHHHHHHHHHHHHHHHhCCchhhhhHHHHHHHHHHHHHHhCCHHHHHHHHHHHHHhhcchh--HHHHHHHHHHHHHHhc
Q 004943          423 GFVEAQEALVQMKNWFIRFPTILQACESMIEMLRGQYAHSVGCYSEAAFHYVEAAKITESKS--MQAMCHAYAAVSYFCI  500 (722)
Q Consensus       423 ~~~eA~~~l~~Al~l~~~~~d~~~~~~a~i~~llG~~~~alG~~~~Al~~f~~AL~l~~~~~--~~A~allnla~v~l~~  500 (722)
                      ++.+|.+.+.+++.+....+.......+.++..+|.++...|+++.|...|..++......+  ....+..+.+.++...
T Consensus       106 ~~~~a~~~~~~al~~~~~~~~~~~~~~~~~~~~la~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  185 (366)
T d1hz4a_         106 FLQTAWETQEKAFQLINEQHLEQLPMHEFLVRIRAQLLWAWARLDEAEASARSGIEVLSSYQPQQQLQCLAMLIQCSLAR  185 (366)
T ss_dssp             CHHHHHHHHHHHHHHHHHTTCTTSTHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHTTTSCGGGGHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHhHhcccchhhHHHHHHHHHHHHHHHhcchhhhHHHHHHHHHHhhhhhhhhHHHHHHHHHHHHHhh
Confidence            99999999999999999876644455678889999999999999999999999988765443  4566778888899998


Q ss_pred             CChhHHHHHHHHhcchhcccccccChHHHHHHHHHHHHHHHhcCCHHHHHHHHHHHHHHHHHhcCChHHHHHHHHHHHHH
Q 004943          501 GDAESSSQAIDLIGPVYQMKDTINGVREEASLHFAYGLLLMRQQDFQEARNRLAKGLQIAHNHMGNLQLVSQYLTILGNL  580 (722)
Q Consensus       501 G~~e~a~~aL~l~~~l~r~~~~~~~~~~~A~al~~lG~~~~~~G~~~eAk~~L~qAL~la~~~~gd~~l~a~~L~~LG~~  580 (722)
                      |++..+.................  ....+.++...|.++...|++.+|...+++++++.   .++..........+|.+
T Consensus       186 ~~~~~a~~~~~~a~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~---~~~~~~~~~~~~~la~~  260 (366)
T d1hz4a_         186 GDLDNARSQLNRLENLLGNGKYH--SDWISNANKVRVIYWQMTGDKAAAANWLRHTAKPE---FANNHFLQGQWRNIARA  260 (366)
T ss_dssp             TCHHHHHHHHHHHHHHHTTSCCC--HHHHHHHHHHHHHHHHHTTCHHHHHHHHHHSCCCC---CTTCGGGHHHHHHHHHH
T ss_pred             hhHHHHHHHHHHHHHHHHHhccc--CchHHHHHHHHHHHHHhcccHHHHHHHHHHHHHhc---cccchHHHHHHHHHHHH
Confidence            99876444444443333333221  22356678889999999999999999999998873   34556667788899999


Q ss_pred             HHhCCChHHHHHHHHHHHHHHHHcCChhHHHHHHHHHHHHHHHcCCchhHhHHHHHHHHHHHHH
Q 004943          581 ALALHDTVQAREILRSSLTLAKKLYDIPTQIWALSVLTALYQQLGDRGNEMENDEYRRKKLDEL  644 (722)
Q Consensus       581 ~~a~g~~~qA~~~l~~Al~lAkki~D~~~q~~al~~L~~l~~~~Gd~~~A~e~~~~~~~~~~~l  644 (722)
                      +...|++++|...++.++..+++.++.+....++..++.+|...|++++|.+.++.+.+.....
T Consensus       261 ~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~l~~Al~l~~~~  324 (366)
T d1hz4a_         261 QILLGEFEPAEIVLEELNENARSLRLMSDLNRNLLLLNQLYWQAGRKSDAQRVLLDALKLANRT  324 (366)
T ss_dssp             HHHTTCHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHHHHH
T ss_pred             HHHcCCHHHHHHHHHHHHHHHhhcccChHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHhhhc
Confidence            9999999999999999999999999999999999999999999999999999999988876653
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure