Citrus Sinensis ID: 004984


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-
MRTFFPSDSCKESQLNGFNPQSWLQVERGKLSKLSSHNSSSSSIESFIKVPEPRILPNYKPVDYVEVLAQIHEELELCPLQERSSLYLLQFQVFKGLGEAKLMRRSLRKAWQKASTVHEKLVFGAWLKYEKQGEELIADLLINCDKCLQEFGPIDIASHLQTDINVAGSHETVSMSGDQVLRNVVFRIHEEKIECDRQKFAALSAPFSAMLNGSFMESLCEDIDLSENNISPSGLRIISDFSVTGSLNGVTPNLLLEILIFANKFCCERLKDACDRKLASLVASREDAVELMGYAIEENSPVLAVSCLQVFLRELPDCLNDERVVEIFSHANRQHRSIMVGLASFSLYCLLSEVAMNLDPRSDKTVCFLERLLESAETDRQRLLAFHQLGCVRLLRKEYDEAEHLFEAAVNAGHIYSIAGLARLGYIKGHKLWAYEKLNSVISSVTPLGWMYQERSLYCEGDKRWEDLDKATALDPTLSYPYMYRASSLMTKQNVEAALAEINRILGFKLALECLELRFCFFLALEDYQAALCDVQAILTLSPDYRMFEGRVAASQLHMLVREHIDNWTIADCWLQLYDRWSSVDDIGSLSVIYQMLESDAPKGVLYFRQSLLLLRLNCPEAAMRSLQLARQHAASDHERLVYEGWILYDTSHCEEGLRKAEESIQMKRSFEAFFLKAYALADSSQDSSCSSTVVSLLEDALKCPSDRLRKGTEQSRKCLC
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHcccccccccccccccccccccccccccccccccccccccccccccccEEEEEccEEEEcHHHHHHHccHHHHHHHccccccccccccccccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHcHHccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccccccHHHHHccccHHHHHHHHccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHcccccHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHcccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccccccccHHHHHHHccc
cccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccHHccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccEEEEHEHHHHccHHHHHHHccccHHHcHcccccccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHccHcHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccccHHHHHHHHHcccEEEEcHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHccccccccccHEEEHHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHcccccccEEcccccHHHHHHHHHHHHHHccHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHEEEEcEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccccccccHHHHHHcc
mrtffpsdsckesqlngfnpqswLQVERGKLsklsshnsssssiesfikvpeprilpnykpvdYVEVLAQIHEELelcplqersslYLLQFQVFKGLGEAKLMRRSLRKAWQKASTVHEKLVFGAWLKYEKQGEELIADLLINCDKClqefgpidiaSHLQTDINVAGSHETVSMSGDQVLRNVVFRIHEEKIECDRQKfaalsapfsamlnGSFMESLCedidlsennispsglriisdfsvtgslngvtpNLLLEILIFANKFCCERLKDACDRKLASLVASREDAVELMGYAIEENSPVLAVSCLQVFLRELPDCLNDERVVEIFSHANRQHRSIMVGLASFSLYCLLSEvamnldprsdkTVCFLERLLESAETDRQRLLAFHQLGCVRLLRKEYDEAEHLFEAAVNAGHIYSIAGLARLGYIKGHKLWAYEKLNSVISSVtplgwmyqerslycegdkrwedldkataldptlsypymyraSSLMTKQNVEAALAEINRILGFKLALECLELRFCFFLALEDYQAALCDVQAIltlspdyrmfeGRVAASQLHMLVREHIDNWTIADCWLQLYDrwssvddiGSLSVIYQMLESDAPKGVLYFRQSLLLLRLNCPEAAMRSLQLARQHAASDHERLVYEGWILYDTSHCEEGLRKAEESIQMKRSFEAFFLKAYAladssqdsscsSTVVSLLEDAlkcpsdrlrkgteqsrkclc
mrtffpsdsckesqlngfnpqsWLQVERGKLSKLsshnsssssiesfikvpeprilPNYKPVDYVEVLAQIHEELELCPLQERSSLYLLQFQVFKGLGEAKLMRRSLRKAWQKASTVHEKLVFGAWLKYEKQGEELIADLLINCDKCLQEFGPIDIASHLQTDINVAGSHETVSMSGDQVLRNVVFRIHEEKIECDRQKFAALSAPFSAMLNGSFMESLCEDIDLSENNISPSGLRIISDFSVTGSLNGVTPNLLLEILIFANKFCCERLKDACDRKLASLVASREDAVELMGYAIEENSPVLAVSCLQVFLRELPDCLNDERVVEIFSHANRQHRSIMVGLASFSLYCLLSEVAMNLDPRSDKTVCFLERLLESAETDRQRLLAFHQLGCVRLLRKEYDEAEHLFEAAVNAGHIYSIAGLARLGYIKGHKLWAYEKLNSVISSVTPLGWMYQERSLYCEGDKRWEDLDKATALDPTLSYPYMYRASSLMTKQNVEAALAEINRILGFKLALECLELRFCFFLALEDYQAALCDVQAILTLSPDYRMFEGRVAASQLHMLVREHIDNWTIADCWLQLYDRWSSVDDIGSLSVIYQMLESDAPKGVLYFRQSLLLLRLNCPEAAMRSLQLARQHAASDHERLVYEGWILYDTSHCEEGLRKAEESIQMKRSFEAFFLKAYALADSSQDSSCSSTVVSLLEdalkcpsdrlrkgteqsrkclc
MRTFFPSDSCKESQLNGFNPQSWLQVERGKLsklsshnsssssiesFIKVPEPRILPNYKPVDYVEVLAQIHEELELCPLQERSSLYLLQFQVFKGLGEAKLMRRSLRKAWQKASTVHEKLVFGAWLKYEKQGEELIADLLINCDKCLQEFGPIDIASHLQTDINVAGSHETVSMSGDQVLRNVVFRIHEEKIECDRQKFAALSAPFSAMLNGSFMESLCEDIDLSENNISPSGLRIISDFSVTGSLNGVTPNLLLEILIFANKFCCERLKDACDRKLASLVASREDAVELMGYAIEENSPVLAVSCLQVFLRELPDCLNDERVVEIFSHANRQHRSIMVGLASFSLYCLLSEVAMNLDPRSDKTVCFLERLLESAETDRQRLLAFHQLGCVRLLRKEYDEAEHLFEAAVNAGHIYSIAGLARLGYIKGHKLWAYEKLNSVISSVTPLGWMYQERSLYCEGDKRWEDLDKATALDPTLSYPYMYRASSLMTKQNVEAALAEINRILGFKlaleclelrfcfflaleDYQAALCDVQAILTLSPDYRMFEGRVAASQLHMLVREHIDNWTIADCWLQLYDRWSSVDDIGSLSVIYQMLESDAPKGVLYFRQSllllrlNCPEAAMRSLQLARQHAASDHERLVYEGWILYDTSHCEEGLRKAEESIQMKRSFEAFFLKAYALAdssqdsscsstvvsLLEDALKCPSDRLRKGTEQSRKCLC
***********************************************IKVPEPRILPNYKPVDYVEVLAQIHEELELCPLQERSSLYLLQFQVFKGLGEAKLMRRSLRKAWQKASTVHEKLVFGAWLKYEKQGEELIADLLINCDKCLQEFGPIDIASHLQTDINVAGSHETVSMSGDQVLRNVVFRIHEEKIECDRQKFAALSAPFSAMLNGSFMESLCEDIDLSENNISPSGLRIISDFSVTGSLNGVTPNLLLEILIFANKFCCERLKDACDRKLASLVASREDAVELMGYAIEENSPVLAVSCLQVFLRELPDCLNDERVVEIFSHANRQHRSIMVGLASFSLYCLLSEVAMNLDPRSDKTVCFLERLLESAETDRQRLLAFHQLGCVRLLRKEYDEAEHLFEAAVNAGHIYSIAGLARLGYIKGHKLWAYEKLNSVISSVTPLGWMYQERSLYCEGDKRWEDLDKATALDPTLSYPYMYRASSLMTKQNVEAALAEINRILGFKLALECLELRFCFFLALEDYQAALCDVQAILTLSPDYRMFEGRVAASQLHMLVREHIDNWTIADCWLQLYDRWSSVDDIGSLSVIYQMLESDAPKGVLYFRQSLLLLRLNCPEAAMRSLQLARQHAASDHERLVYEGWILYDTSHCEEGLRKAEESIQMKRSFEAFFLKAYALA***************************************
**T*****SCKESQLN*********************************VPEPRILPNYKPVDYVEVLAQIHEELEL*PLQERSSLYLLQFQVFKGLGEAKLMRRSLRKAWQKASTVHEKLVFGAWLKYEKQGEELIADLLINCDKCLQEFGPIDIASHL***************SGDQVLRNVVFRIHEEKIECDRQKFAALSAPFSAMLNGSFMESLCEDIDLSENNISPSGLRIISDFSVTGSLNGVTPNLLLEILIFANKFCCERLKDACDRKLASLVASREDAVELMGYAIEENSPVLAVSCLQVFLRELPDCLNDERVVEIFSHANRQHRSIMVGLASFSLYCLLSEVAMNLDPRSDKTVCFLERLLESAETDRQRLLAFHQLGCVRLLRKEYDEAEHLFEAAVNAGHIYSIAGLARLGYIKGHKLWAYEKLNSVISSVTPLGWMYQERSLYCEGDKRWEDLDKATALDPTLSYPYMYRASSLMTKQNVEAALAEINRILGFKLALECLELRFCFFLALEDYQAALCDVQAILTLSPDYRMFEGRVAASQLHMLVREHIDNWTIADCWLQLYDRWSSVDDIGSLSVIYQMLESDAPKGVLYFRQSLLLLRLNCPEAAMRSLQLARQHAASDHERLVYEGWILYDTSHCEEGLRKAEESIQMKRSFEAFFLKAYALADSSQDSSCSSTVVSLLEDALKC*************KCLC
************SQLNGFNPQSWLQVERG*****************FIKVPEPRILPNYKPVDYVEVLAQIHEELELCPLQERSSLYLLQFQVFKGLGEAKLMRRSLRKAWQKASTVHEKLVFGAWLKYEKQGEELIADLLINCDKCLQEFGPIDIASHLQTDINVAGSHETVSMSGDQVLRNVVFRIHEEKIECDRQKFAALSAPFSAMLNGSFMESLCEDIDLSENNISPSGLRIISDFSVTGSLNGVTPNLLLEILIFANKFCCERLKDACDRKLASLVASREDAVELMGYAIEENSPVLAVSCLQVFLRELPDCLNDERVVEIFSHANRQHRSIMVGLASFSLYCLLSEVAMNLDPRSDKTVCFLERLLESAETDRQRLLAFHQLGCVRLLRKEYDEAEHLFEAAVNAGHIYSIAGLARLGYIKGHKLWAYEKLNSVISSVTPLGWMYQERSLYCEGDKRWEDLDKATALDPTLSYPYMYRASSLMTKQNVEAALAEINRILGFKLALECLELRFCFFLALEDYQAALCDVQAILTLSPDYRMFEGRVAASQLHMLVREHIDNWTIADCWLQLYDRWSSVDDIGSLSVIYQMLESDAPKGVLYFRQSLLLLRLNCPEAAMRSL*********DHERLVYEGWILYDTSHCEEGLRKAEESIQMKRSFEAFFLKAYALA*************SLLEDALKCPSDR*************
******************************************SIESFIKVPEPRILPNYKPVDYVEVLAQIHEELELCPLQERSSLYLLQFQVFKGLGEAKLMRRSLRKAWQKASTVHEKLVFGAWLKYEKQGEELIADLLINCDKCLQEFGPIDIASHLQTDINV************QVLRNVVFRIHEEKIECDRQKFAALSAPFSAMLNGSFMESLCEDIDLSENNISPSGLRIISDFSVTGSLNGVTPNLLLEILIFANKFCCERLKDACDRKLASLVASREDAVELMGYAIEENSPVLAVSCLQVFLRELPDCLNDERVVEIFSHANRQHRSIMVGLASFSLYCLLSEVAMNLDPRSDKTVCFLERLLESAETDRQRLLAFHQLGCVRLLRKEYDEAEHLFEAAVNAGHIYSIAGLARLGYIKGHKLWAYEKLNSVISSVTPLGWMYQERSLYCEGDKRWEDLDKATALDPTLSYPYMYRASSLMTKQNVEAALAEINRILGFKLALECLELRFCFFLALEDYQAALCDVQAILTLSPDYRMFEGRVAASQLHMLVREHIDNWTIADCWLQLYDRWSSVDDIGSLSVIYQMLESDAPKGVLYFRQSLLLLRLNCPEAAMRSLQLARQHAASDHERLVYEGWILYDTSHCEEGLRKAEESIQMKRSFEAFFLKAYALADSSQDSSCSSTVVSLLEDALKCPSDRLR**T*QSR*CLC
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRTFFPSDSCKESQLNGFNPQSWLQVERGKLSKLSSHNSSSSSIESFIKVPEPRILPNYKPVDYVEVLAQIHEELELCPLQERSSLYLLQFQVFKGLGEAKLMRRSLRKAWQKASTVHEKLVFGAWLKYEKQGEELIADLLINCDKCLQEFGPIDIASHLQTDINVAGSHETVSMSGDQVLRNVVFRIHEEKIECDRQKFAALSAPFSAMLNGSFMESLCEDIDLSENNISPSGLRIISDFSVTGSLNGVTPNLLLEILIFANKFCCERLKDACDRKLASLVASREDAVELMGYAIEENSPVLAVSCLQVFLRELPDCLNDERVVEIFSHANRQHRSIMVGLASFSLYCLLSEVAMNLDPRSDKTVCFLERLLESAETDRQRLLAFHQLGCVRLLRKEYDEAEHLFEAAVNAGHIYSIAGLARLGYIKGHKLWAYEKLNSVISSVTPLGWMYQERSLYCEGDKRWEDLDKATALDPTLSYPYMYRASSLMTKQNVEAALAEINRILGFKLALECLELRFCFFLALEDYQAALCDVQAILTLSPDYRMFEGRVAASQLHMLVREHIDNWTIADCWLQLYDRWSSVDDIGSLSVIYQMLESDAPKGVLYFRQSLLLLRLNCPEAAMRSLQLARQHAASDHERLVYEGWILYDTSHCEEGLRKAEESIQMKRSFEAFFLKAYALADSSQDSSCSSTVVSLLEDALKCPSDRLRKGTEQSRKCLC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query721 2.2.26 [Sep-21-2011]
Q9ZQX6 888 ETO1-like protein 1 OS=Ar yes no 0.983 0.798 0.717 0.0
O65020 951 Ethylene-overproduction p no no 0.916 0.695 0.483 1e-178
Q9LV01 925 ETO1-like protein 2 OS=Ar no no 0.916 0.714 0.425 1e-145
>sp|Q9ZQX6|ETOL1_ARATH ETO1-like protein 1 OS=Arabidopsis thaliana GN=EOL1 PE=1 SV=1 Back     alignment and function desciption
 Score = 1018 bits (2632), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/714 (71%), Positives = 607/714 (85%), Gaps = 5/714 (0%)

Query: 1   MRTFFPSDSCKESQLNGFNPQSWLQVERGKLSKLSSHNSSSSSIESFIKVPEPRILPNYK 60
           MRTF+PSDSCKESQL+  NPQSWLQVERGKLS  +S ++     ESFIKVPEP+ILP+YK
Sbjct: 1   MRTFYPSDSCKESQLDSLNPQSWLQVERGKLSSSASSSAPLCR-ESFIKVPEPQILPHYK 59

Query: 61  PVDYVEVLAQIHEELELCPLQERSSLYLLQFQVFKGLGEAKLMRRSLRKAWQKASTVHEK 120
           P+DYVEVLAQIHEEL+ CPLQERS LYLLQ+QVF+GLGE KL RRSL+ AWQ+A+TVHEK
Sbjct: 60  PLDYVEVLAQIHEELDTCPLQERSILYLLQYQVFRGLGETKLRRRSLQSAWQEATTVHEK 119

Query: 121 LVFGAWLKYEKQGEELIADLLINCDKCLQEFGPIDIASHLQTDINVAGSHETVSMSGDQ- 179
           +VFG+WL+YEKQGEE+I DLL +C K  +EF P+DIAS+       A S E  S+  ++ 
Sbjct: 120 VVFGSWLRYEKQGEEVITDLLSSCGKYSEEFVPLDIASYFPA--TTASSPEAASVKTNRS 177

Query: 180 VLRNVVFRIHEEKIECDRQKFAALSAPFSAMLNGSFMESLCEDIDLSENNISPSGLRIIS 239
           V +NVVF+I EEKI C R+K A+LSAPF AML G+F ESL ++ID+SEN++S S +R++ 
Sbjct: 178 VSKNVVFKIGEEKIACQRRKIASLSAPFHAMLYGNFTESLLDEIDMSENHVSSSAMRVVR 237

Query: 240 DFSVTGSLNGVTPNLLLEILIFANKFCCERLKDACDRKLASLVASREDAVELMGYAIEEN 299
           DFSV G L GV+ NLLLE+L+FANKFCCERLKDACDR+LASL++S E A+ELM +A+EEN
Sbjct: 238 DFSVVGVLIGVSKNLLLEVLVFANKFCCERLKDACDRELASLISSMECAIELMDFALEEN 297

Query: 300 SPVLAVSCLQVFLRELPDCLNDERVVEIFSHANRQHRSIMVGLASFSLYCLLSEVAMNLD 359
           SP+LA SCLQVFL E+PD LNDERVVE+ +  NR   S M G A FSLY  LSEV+M +D
Sbjct: 298 SPILASSCLQVFLYEMPDSLNDERVVEVLTRVNRSQVSTMAGKAPFSLYSCLSEVSMCID 357

Query: 360 PRSDKTVCFLERLLESAETDRQRLLAFHQLGCVRLLRKEYDEAEHLFEAAVNAGHIYSIA 419
           PRSD+T+ FLE+L++ AE DRQ++L FH+LGC+RLLRKEY EAE  FE A N GH+YS  
Sbjct: 358 PRSDRTLGFLEKLVDFAENDRQQVLGFHRLGCMRLLRKEYREAEEAFETAFNLGHVYSAT 417

Query: 420 GLARLGYIKGHKLWAYEKLNSVISSVTP-LGWMYQERSLYCEGDKRWEDLDKATALDPTL 478
           GLARLGYI+GH+LWAYEKL+SVISSV+P LGWMYQERS YCEGDK+ EDL+KAT LDPTL
Sbjct: 418 GLARLGYIQGHRLWAYEKLSSVISSVSPPLGWMYQERSFYCEGDKKLEDLEKATELDPTL 477

Query: 479 SYPYMYRASSLMTKQNVEAALAEINRILGFKLALECLELRFCFFLALEDYQAALCDVQAI 538
           +YPYMYRA + M+KQN +AAL EINRILGFKLALECLE+RFC +L ++DY+AAL D+QA 
Sbjct: 478 TYPYMYRAVTRMSKQNAKAALEEINRILGFKLALECLEIRFCLYLGMDDYEAALRDIQAA 537

Query: 539 LTLSPDYRMFEGRVAASQLHMLVREHIDNWTIADCWLQLYDRWSSVDDIGSLSVIYQMLE 598
           LTL PDYRMF+G+VA  QL  LV EH++NWT ADCW+QLY++WS+VDDIGSLSVIYQMLE
Sbjct: 538 LTLCPDYRMFDGKVAGRQLQTLVYEHVENWTTADCWMQLYEKWSNVDDIGSLSVIYQMLE 597

Query: 599 SDAPKGVLYFRQSLLLLRLNCPEAAMRSLQLARQHAASDHERLVYEGWILYDTSHCEEGL 658
           SDA KGVLYFRQSLLLLRLNCPEAAMRSLQLAR+HA+SDHERLVYEGWILYDT HCEEGL
Sbjct: 598 SDACKGVLYFRQSLLLLRLNCPEAAMRSLQLAREHASSDHERLVYEGWILYDTGHCEEGL 657

Query: 659 RKAEESIQMKRSFEAFFLKAYALADSSQDSSCSSTVVSLLEDALKCPSDRLRKG 712
           +KA+ESI +KRSFEA+FL+AYALA+SS D S SSTVVSLLEDALKCPSDRLRKG
Sbjct: 658 QKAKESIGIKRSFEAYFLQAYALAESSLDPSSSSTVVSLLEDALKCPSDRLRKG 711




Possible regulator of the ethylene pathway, which acts by regulating the stability of 1-aminocyclopropane-1-carboxylate synthase (ACS) enzymes. May act as a substrate-specific adapter that connects ACS enzymes, such as ACS5, to ubiquitin ligase complexes, leading to proteasomal degradation of ACS enzymes.
Arabidopsis thaliana (taxid: 3702)
>sp|O65020|ETO1_ARATH Ethylene-overproduction protein 1 OS=Arabidopsis thaliana GN=ETO1 PE=1 SV=2 Back     alignment and function description
>sp|Q9LV01|ETOL2_ARATH ETO1-like protein 2 OS=Arabidopsis thaliana GN=EOL2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query721
359495432 886 PREDICTED: ETO1-like protein 1-like [Vit 0.983 0.800 0.828 0.0
255559841 851 conserved hypothetical protein [Ricinus 0.986 0.835 0.812 0.0
449455250 890 PREDICTED: ETO1-like protein 1-like [Cuc 0.986 0.798 0.771 0.0
449526563 890 PREDICTED: ETO1-like protein 1-like [Cuc 0.986 0.798 0.770 0.0
70780055 886 ethylene overproducer-like 1 [Solanum ly 0.983 0.800 0.761 0.0
350539533 886 ethylene-overproducer1-like protein [Sol 0.983 0.800 0.758 0.0
356572224 886 PREDICTED: ETO1-like protein 1-like [Gly 0.983 0.800 0.742 0.0
356504961 888 PREDICTED: ETO1-like protein 1-like [Gly 0.984 0.799 0.748 0.0
224082686787 predicted protein [Populus trichocarpa] 0.844 0.773 0.811 0.0
356500164 886 PREDICTED: ETO1-like protein 1-like [Gly 0.983 0.800 0.733 0.0
>gi|359495432|ref|XP_002280519.2| PREDICTED: ETO1-like protein 1-like [Vitis vinifera] gi|296084480|emb|CBI25039.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1198 bits (3099), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 590/712 (82%), Positives = 643/712 (90%), Gaps = 3/712 (0%)

Query: 1   MRTFFPSDSCKESQLNGFNPQSWLQVERGKLSKLSSHNSSSSSIESFIKVPEPRILPNYK 60
           M+  FPS+SCKE+QLN FNPQSWLQVERGKLSK SS   SSSSIES IKVPEP ILP +K
Sbjct: 1   MKNLFPSESCKETQLNAFNPQSWLQVERGKLSKFSS--QSSSSIESLIKVPEPPILPFFK 58

Query: 61  PVDYVEVLAQIHEELELCPLQERSSLYLLQFQVFKGLGEAKLMRRSLRKAWQKASTVHEK 120
           PVDYVEVLAQIHEELE CP QERS+LYLLQFQVF+GLGE KLMRRSLR AWQ+ASTV EK
Sbjct: 59  PVDYVEVLAQIHEELESCPPQERSNLYLLQFQVFRGLGEVKLMRRSLRSAWQRASTVQEK 118

Query: 121 LVFGAWLKYEKQGEELIADLLINCDKCLQEFGPIDIASHLQTDINVAGSHETVSMSGDQV 180
           L+FGAWLKYEKQGEELIADLL +C KC QEFGPIDIAS L  D N + S+E V M+G+++
Sbjct: 119 LIFGAWLKYEKQGEELIADLLASCGKCAQEFGPIDIASQLPADSNTS-SNEAVVMNGNEI 177

Query: 181 LRNVVFRIHEEKIECDRQKFAALSAPFSAMLNGSFMESLCEDIDLSENNISPSGLRIISD 240
           L+ V+FRI +EKI CDRQK A LSAPF AMLNG F ESL EDIDLSENNISPSG+R I +
Sbjct: 178 LKTVIFRIGDEKIVCDRQKIAGLSAPFHAMLNGCFTESLQEDIDLSENNISPSGMRAIHE 237

Query: 241 FSVTGSLNGVTPNLLLEILIFANKFCCERLKDACDRKLASLVASREDAVELMGYAIEENS 300
           F +TGSL  V P+LLLEILIF NKFCCERLKDAC RKLASLV+SR+DAVEL+ YA+EENS
Sbjct: 238 FCMTGSLGEVPPDLLLEILIFGNKFCCERLKDACGRKLASLVSSRDDAVELIDYALEENS 297

Query: 301 PVLAVSCLQVFLRELPDCLNDERVVEIFSHANRQHRSIMVGLASFSLYCLLSEVAMNLDP 360
           PVLA SCLQVFL ELPDCLND RV+EI S ANRQ RSIMVG ASFSLYC LSEVAM LDP
Sbjct: 298 PVLAASCLQVFLHELPDCLNDNRVLEILSDANRQQRSIMVGPASFSLYCFLSEVAMALDP 357

Query: 361 RSDKTVCFLERLLESAETDRQRLLAFHQLGCVRLLRKEYDEAEHLFEAAVNAGHIYSIAG 420
           RSD T CFLERL+ESAE+ RQRLLA HQLGCVRLLRKEYDEAE LFEAA+NAGH+YS+AG
Sbjct: 358 RSDTTACFLERLVESAESSRQRLLACHQLGCVRLLRKEYDEAEQLFEAALNAGHVYSVAG 417

Query: 421 LARLGYIKGHKLWAYEKLNSVISSVTPLGWMYQERSLYCEGDKRWEDLDKATALDPTLSY 480
           L RLGY+KGHKLW+Y+KL+SVISS TPLGWMYQERSLYCEGDKRWEDL+KAT LDPTL+Y
Sbjct: 418 LVRLGYLKGHKLWSYDKLSSVISSFTPLGWMYQERSLYCEGDKRWEDLEKATELDPTLTY 477

Query: 481 PYMYRASSLMTKQNVEAALAEINRILGFKLALECLELRFCFFLALEDYQAALCDVQAILT 540
           PYMYRA+SLM KQNV+AALAEIN++LGFKLALECLELRFCF+LA+E+Y+AA CDVQAILT
Sbjct: 478 PYMYRAASLMRKQNVQAALAEINQVLGFKLALECLELRFCFYLAVENYEAAFCDVQAILT 537

Query: 541 LSPDYRMFEGRVAASQLHMLVREHIDNWTIADCWLQLYDRWSSVDDIGSLSVIYQMLESD 600
           LSPDYRMFEGRVAASQL MLVREH+++WT ADCWLQLYDRWSSVDDIGSLSVIYQMLESD
Sbjct: 538 LSPDYRMFEGRVAASQLRMLVREHVESWTTADCWLQLYDRWSSVDDIGSLSVIYQMLESD 597

Query: 601 APKGVLYFRQSLLLLRLNCPEAAMRSLQLARQHAASDHERLVYEGWILYDTSHCEEGLRK 660
           A KGVLYFRQSLLLLRLNCPEAAMRSLQLARQHA+++HERLVYEGWILYDT HCEEGLRK
Sbjct: 598 AAKGVLYFRQSLLLLRLNCPEAAMRSLQLARQHASNEHERLVYEGWILYDTGHCEEGLRK 657

Query: 661 AEESIQMKRSFEAFFLKAYALADSSQDSSCSSTVVSLLEDALKCPSDRLRKG 712
           AEESI +KRSFEAFFLKAYALADSSQD SCSSTVVSLLEDALKCPSDRLRKG
Sbjct: 658 AEESIGLKRSFEAFFLKAYALADSSQDPSCSSTVVSLLEDALKCPSDRLRKG 709




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255559841|ref|XP_002520939.1| conserved hypothetical protein [Ricinus communis] gi|223539776|gb|EEF41356.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|449455250|ref|XP_004145366.1| PREDICTED: ETO1-like protein 1-like [Cucumis sativus] gi|449473087|ref|XP_004153780.1| PREDICTED: ETO1-like protein 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449526563|ref|XP_004170283.1| PREDICTED: ETO1-like protein 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|70780055|gb|AAZ08351.1| ethylene overproducer-like 1 [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|350539533|ref|NP_001234175.1| ethylene-overproducer1-like protein [Solanum lycopersicum] gi|78707376|gb|ABB46489.1| ethylene-overproducer1-like protein [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|356572224|ref|XP_003554270.1| PREDICTED: ETO1-like protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|356504961|ref|XP_003521261.1| PREDICTED: ETO1-like protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|224082686|ref|XP_002306795.1| predicted protein [Populus trichocarpa] gi|222856244|gb|EEE93791.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356500164|ref|XP_003518903.1| PREDICTED: ETO1-like protein 1-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query721
TAIR|locus:2132402 888 EOL1 "ETO1-like 1" [Arabidopsi 0.983 0.798 0.673 1.8e-259
TAIR|locus:2074343 959 ETO1 "ETHYLENE OVERPRODUCER 1" 0.916 0.689 0.459 2.4e-153
TAIR|locus:2132402 EOL1 "ETO1-like 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2497 (884.0 bits), Expect = 1.8e-259, P = 1.8e-259
 Identities = 481/714 (67%), Positives = 568/714 (79%)

Query:     1 MRTFFPSDSCKESQLNGFNPQSWLQVERGKLXXXXXXXXXXXXXXXFIKVPEPRILPNYK 60
             MRTF+PSDSCKESQL+  NPQSWLQVERGKL               FIKVPEP+ILP+YK
Sbjct:     1 MRTFYPSDSCKESQLDSLNPQSWLQVERGKLSSSASSSAPLCRES-FIKVPEPQILPHYK 59

Query:    61 PVDYVEVLAQIHEELELCPLQERSSLYLLQFQVFKGLGEAKLMRRSLRKAWQKASTVHEK 120
             P+DYVEVLAQIHEEL+ CPLQERS LYLLQ+QVF+GLGE KL RRSL+ AWQ+A+TVHEK
Sbjct:    60 PLDYVEVLAQIHEELDTCPLQERSILYLLQYQVFRGLGETKLRRRSLQSAWQEATTVHEK 119

Query:   121 LVFGAWLKYEKQGEELIADLLINCDKCLQEFGPIDIASHLQTDINVAGSHETVSMSGDQ- 179
             +VFG+WL+YEKQGEE+I DLL +C K  +EF P+DIAS+       A S E  S+  ++ 
Sbjct:   120 VVFGSWLRYEKQGEEVITDLLSSCGKYSEEFVPLDIASYFPA--TTASSPEAASVKTNRS 177

Query:   180 VLRNVVFRIHEEKIECDRQKFAALSAPFSAMLNGSFMESLCEDIDLSENNISPSGLRIIS 239
             V +NVVF+I EEKI C R+K A+LSAPF AML G+F ESL ++ID+SEN++S S +R++ 
Sbjct:   178 VSKNVVFKIGEEKIACQRRKIASLSAPFHAMLYGNFTESLLDEIDMSENHVSSSAMRVVR 237

Query:   240 DFSVTGSLNGVTPNLLLEILIFANKFCCERLKDACDRKLASLVASREDAVELMGYAIEEN 299
             DFSV G L GV+ NLLLE+L+FANKFCCERLKDACDR+LASL++S E A+ELM +A+EEN
Sbjct:   238 DFSVVGVLIGVSKNLLLEVLVFANKFCCERLKDACDRELASLISSMECAIELMDFALEEN 297

Query:   300 SPVLAVSCLQVFLRELPDCLNDERVVEIFSHANRQHRSIMVGLASFSLYCLLSEVAMNLD 359
             SP+LA SCLQVFL E+PD LNDERVVE+ +  NR   S M G A FSLY  LSEV+M +D
Sbjct:   298 SPILASSCLQVFLYEMPDSLNDERVVEVLTRVNRSQVSTMAGKAPFSLYSCLSEVSMCID 357

Query:   360 PRSDKTVCFLERLLESAETDRQRLLAFHQLGCVRLLRKEYDEAEHLFEAAVNAGHIYSIA 419
             PRSD+T+ FLE+L++ AE DRQ++L FH+LGC+RLLRKEY EAE  FE A N GH+YS  
Sbjct:   358 PRSDRTLGFLEKLVDFAENDRQQVLGFHRLGCMRLLRKEYREAEEAFETAFNLGHVYSAT 417

Query:   420 GLARLGYIKGHKLWAYEKLNSVISSVTP-LGWMYQERSLYCEGDKRWEDLDKATALDPTL 478
             GLARLGYI+GH+LWAYEKL+SVISSV+P LGWMYQERS YCEGDK+ EDL+KAT LDPTL
Sbjct:   418 GLARLGYIQGHRLWAYEKLSSVISSVSPPLGWMYQERSFYCEGDKKLEDLEKATELDPTL 477

Query:   479 SYPYMYRASSLMTKQNVEAALAEINRILGFKXXXXXXXXXXXXXXXXXDYQAALCDVQAI 538
             +YPYMYRA + M+KQN +AAL EINRILGFK                 DY+AAL D+QA 
Sbjct:   478 TYPYMYRAVTRMSKQNAKAALEEINRILGFKLALECLEIRFCLYLGMDDYEAALRDIQAA 537

Query:   539 LTLSPDYRMFEGRVAASQLHMLVREHIDNWTIADCWLQLYDRWSSVDDIGSLSVIYQMLE 598
             LTL PDYRMF+G+VA  QL  LV EH++NWT ADCW+QLY++WS+VDDIGSLSVIYQMLE
Sbjct:   538 LTLCPDYRMFDGKVAGRQLQTLVYEHVENWTTADCWMQLYEKWSNVDDIGSLSVIYQMLE 597

Query:   599 SDAPKGVLYFRQSXXXXXXNCPEAAMRSLQLARQHAASDHERLVYEGWILYDTSHCEEGL 658
             SDA KGVLYFRQS      NCPEAAMRSLQLAR+HA+SDHERLVYEGWILYDT HCEEGL
Sbjct:   598 SDACKGVLYFRQSLLLLRLNCPEAAMRSLQLAREHASSDHERLVYEGWILYDTGHCEEGL 657

Query:   659 RKAEESIQMKRSFEAFFLKAYALAXXXXXXXXXXXXXXLLEDALKCPSDRLRKG 712
             +KA+ESI +KRSFEA+FL+AYALA              LLEDALKCPSDRLRKG
Sbjct:   658 QKAKESIGIKRSFEAYFLQAYALAESSLDPSSSSTVVSLLEDALKCPSDRLRKG 711


GO:0005634 "nucleus" evidence=ISM
GO:0010364 "regulation of ethylene biosynthetic process" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0000096 "sulfur amino acid metabolic process" evidence=RCA
GO:0000394 "RNA splicing, via endonucleolytic cleavage and ligation" evidence=RCA
GO:0007267 "cell-cell signaling" evidence=RCA
GO:0008652 "cellular amino acid biosynthetic process" evidence=RCA
GO:0009069 "serine family amino acid metabolic process" evidence=RCA
GO:0009086 "methionine biosynthetic process" evidence=RCA
GO:0009616 "virus induced gene silencing" evidence=RCA
GO:0009855 "determination of bilateral symmetry" evidence=RCA
GO:0010014 "meristem initiation" evidence=RCA
GO:0010050 "vegetative phase change" evidence=RCA
GO:0010073 "meristem maintenance" evidence=RCA
GO:0010267 "production of ta-siRNAs involved in RNA interference" evidence=RCA
GO:0035196 "production of miRNAs involved in gene silencing by miRNA" evidence=RCA
GO:0042545 "cell wall modification" evidence=RCA
TAIR|locus:2074343 ETO1 "ETHYLENE OVERPRODUCER 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9ZQX6ETOL1_ARATHNo assigned EC number0.71700.98330.7984yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00023796001
SubName- Full=Chromosome chr7 scaffold_31, whole genome shotgun sequence; (874 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query721
smart0022597 smart00225, BTB, Broad-Complex, Tramtrack and Bric 1e-06
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 9e-04
>gnl|CDD|197585 smart00225, BTB, Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information
 Score = 46.9 bits (112), Expect = 1e-06
 Identities = 26/99 (26%), Positives = 44/99 (44%), Gaps = 3/99 (3%)

Query: 183 NVVFRIHEEKIECDRQKFAALSAPFSAMLNGSFMESLCEDIDLSENNISPSGLRIISDFS 242
           +V   +  +K    +   AA S  F A+ +  F ES   +I L +  +SP   R + +F 
Sbjct: 1   DVTLVVGGKKFHAHKAVLAAHSPYFKALFSSDFKESDKSEIYLDD--VSPEDFRALLNFL 58

Query: 243 VTGSLNGVTPNLLLEILIFANKFCCERLKDACDRKLASL 281
            TG L+ +    + E+L  A+      L + C+  L  L
Sbjct: 59  YTGKLD-LPEENVEELLELADYLQIPGLVELCEEFLLKL 96


Domain in Broad-Complex, Tramtrack and Bric a brac. Also known as POZ (poxvirus and zinc finger) domain. Known to be a protein-protein interaction motif found at the N-termini of several C2H2-type transcription factors as well as Shaw-type potassium channels. Known structure reveals a tightly intertwined dimer formed via interactions between N-terminal strand and helix structures. However in a subset of BTB/POZ domains, these two secondary structures appear to be missing. Be aware SMART predicts BTB/POZ domains without the beta1- and alpha1-secondary structures. Length = 97

>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 721
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 99.97
PHA02713557 hypothetical protein; Provisional 99.97
PHA02790480 Kelch-like protein; Provisional 99.96
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.96
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.96
PHA03098534 kelch-like protein; Provisional 99.96
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.94
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.93
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.93
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.93
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.92
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.91
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.91
KOG0547606 consensus Translocase of outer mitochondrial membr 99.91
PRK11788389 tetratricopeptide repeat protein; Provisional 99.91
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.89
KOG0547606 consensus Translocase of outer mitochondrial membr 99.89
KOG4350620 consensus Uncharacterized conserved protein, conta 99.88
KOG1126638 consensus DNA-binding cell division cycle control 99.87
PRK11189296 lipoprotein NlpI; Provisional 99.87
PRK11189296 lipoprotein NlpI; Provisional 99.86
PRK11788389 tetratricopeptide repeat protein; Provisional 99.86
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 99.86
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.86
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.85
PLN02789320 farnesyltranstransferase 99.84
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.83
PRK12370553 invasion protein regulator; Provisional 99.81
KOG1126638 consensus DNA-binding cell division cycle control 99.81
PRK12370553 invasion protein regulator; Provisional 99.81
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.78
PLN02789320 farnesyltranstransferase 99.78
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.77
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.77
KOG2075521 consensus Topoisomerase TOP1-interacting protein B 99.77
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.75
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.74
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.74
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.73
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.7
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.7
PF00651111 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB ( 99.7
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.69
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.69
KOG1125579 consensus TPR repeat-containing protein [General f 99.69
KOG2076 895 consensus RNA polymerase III transcription factor 99.68
KOG4591280 consensus Uncharacterized conserved protein, conta 99.68
KOG1129478 consensus TPR repeat-containing protein [General f 99.68
PRK15359144 type III secretion system chaperone protein SscB; 99.67
PRK15359144 type III secretion system chaperone protein SscB; 99.66
PRK14574 822 hmsH outer membrane protein; Provisional 99.65
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.64
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.64
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.63
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.63
smart0022590 BTB Broad-Complex, Tramtrack and Bric a brac. Doma 99.63
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.62
KOG1125579 consensus TPR repeat-containing protein [General f 99.62
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.6
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.58
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.57
PRK14574 822 hmsH outer membrane protein; Provisional 99.57
KOG4682488 consensus Uncharacterized conserved protein, conta 99.56
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.52
KOG2076 895 consensus RNA polymerase III transcription factor 99.52
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.51
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.51
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.49
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 99.48
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.47
KOG1129478 consensus TPR repeat-containing protein [General f 99.46
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.46
PRK10370198 formate-dependent nitrite reductase complex subuni 99.44
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.43
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.42
KOG0553304 consensus TPR repeat-containing protein [General f 99.4
KOG0553304 consensus TPR repeat-containing protein [General f 99.4
PRK10370198 formate-dependent nitrite reductase complex subuni 99.38
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.36
KOG07831267 consensus Uncharacterized conserved protein, conta 99.36
KOG1128777 consensus Uncharacterized conserved protein, conta 99.36
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.35
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 99.33
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.32
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.32
PLN03218 1060 maturation of RBCL 1; Provisional 99.31
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.3
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.29
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.29
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.28
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.28
KOG2003840 consensus TPR repeat-containing protein [General f 99.28
PLN03218 1060 maturation of RBCL 1; Provisional 99.28
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.28
PRK04841903 transcriptional regulator MalT; Provisional 99.26
PLN03077857 Protein ECB2; Provisional 99.25
PLN03077 857 Protein ECB2; Provisional 99.25
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.24
KOG2003840 consensus TPR repeat-containing protein [General f 99.19
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.18
PRK10153517 DNA-binding transcriptional activator CadC; Provis 99.15
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.14
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.11
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.11
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.1
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.09
COG0457291 NrfG FOG: TPR repeat [General function prediction 99.08
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.08
KOG4648 536 consensus Uncharacterized conserved protein, conta 99.08
PRK11906458 transcriptional regulator; Provisional 99.07
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.06
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.05
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.05
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.03
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.0
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.0
PRK04841 903 transcriptional regulator MalT; Provisional 99.0
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.99
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 98.99
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.99
PRK11906458 transcriptional regulator; Provisional 98.99
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.95
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.95
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.94
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.93
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 98.93
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.92
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.92
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.92
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.92
KOG4555175 consensus TPR repeat-containing protein [Function 98.9
KOG4648536 consensus Uncharacterized conserved protein, conta 98.88
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.87
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.87
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.86
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.85
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.83
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.82
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 98.82
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.81
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.79
KOG4234271 consensus TPR repeat-containing protein [General f 98.78
KOG2376 652 consensus Signal recognition particle, subunit Srp 98.77
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.77
KOG1128777 consensus Uncharacterized conserved protein, conta 98.77
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.75
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.74
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 98.74
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.72
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.7
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.69
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.69
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.68
KOG4234271 consensus TPR repeat-containing protein [General f 98.65
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.65
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.62
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.61
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.58
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.57
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.56
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.54
PRK10803263 tol-pal system protein YbgF; Provisional 98.51
PF12688120 TPR_5: Tetratrico peptide repeat 98.5
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.47
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.47
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.45
PF1337173 TPR_9: Tetratricopeptide repeat 98.45
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.44
PRK10803263 tol-pal system protein YbgF; Provisional 98.44
PF1337173 TPR_9: Tetratricopeptide repeat 98.43
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.41
PF12688120 TPR_5: Tetratrico peptide repeat 98.41
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.38
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.35
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.34
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.34
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 98.33
KOG2376 652 consensus Signal recognition particle, subunit Srp 98.31
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 98.3
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.26
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.25
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.25
KOG4555175 consensus TPR repeat-containing protein [Function 98.23
KOG1941 518 consensus Acetylcholine receptor-associated protei 98.2
KOG2047 835 consensus mRNA splicing factor [RNA processing and 98.17
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 98.17
PRK15331165 chaperone protein SicA; Provisional 98.16
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.16
KOG1915677 consensus Cell cycle control protein (crooked neck 98.13
COG4700251 Uncharacterized protein conserved in bacteria cont 98.11
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.11
PRK15331165 chaperone protein SicA; Provisional 98.11
KOG0511516 consensus Ankyrin repeat protein [General function 98.1
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.09
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.09
PF07707103 BACK: BTB And C-terminal Kelch; InterPro: IPR01170 98.09
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.07
KOG3785 557 consensus Uncharacterized conserved protein [Funct 98.07
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.06
PF1343134 TPR_17: Tetratricopeptide repeat 98.02
PF1343134 TPR_17: Tetratricopeptide repeat 98.02
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.01
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 97.98
COG4700251 Uncharacterized protein conserved in bacteria cont 97.89
PF13512142 TPR_18: Tetratricopeptide repeat 97.89
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 97.86
COG4105254 ComL DNA uptake lipoprotein [General function pred 97.83
PF13512142 TPR_18: Tetratricopeptide repeat 97.82
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 97.8
KOG4340 459 consensus Uncharacterized conserved protein [Funct 97.8
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.79
KOG0530318 consensus Protein farnesyltransferase, alpha subun 97.77
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.72
KOG1915 677 consensus Cell cycle control protein (crooked neck 97.63
PF0221494 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassi 97.62
KOG2716230 consensus Polymerase delta-interacting protein PDI 97.61
PF1342844 TPR_14: Tetratricopeptide repeat 97.56
KOG1941518 consensus Acetylcholine receptor-associated protei 97.55
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.55
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.54
smart00875101 BACK BTB And C-terminal Kelch. The BACK domain is 97.52
KOG2047835 consensus mRNA splicing factor [RNA processing and 97.52
KOG1550552 consensus Extracellular protein SEL-1 and related 97.51
COG1729262 Uncharacterized protein conserved in bacteria [Fun 97.49
COG1729262 Uncharacterized protein conserved in bacteria [Fun 97.48
KOG2838401 consensus Uncharacterized conserved protein, conta 97.48
KOG3473112 consensus RNA polymerase II transcription elongati 97.47
KOG2471696 consensus TPR repeat-containing protein [General f 97.43
COG4105254 ComL DNA uptake lipoprotein [General function pred 97.41
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.4
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.37
COG3898 531 Uncharacterized membrane-bound protein [Function u 97.37
KOG1550552 consensus Extracellular protein SEL-1 and related 97.33
COG3898531 Uncharacterized membrane-bound protein [Function u 97.33
KOG1586288 consensus Protein required for fusion of vesicles 97.33
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 97.3
KOG1586288 consensus Protein required for fusion of vesicles 97.28
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.24
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.24
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.21
KOG0530318 consensus Protein farnesyltransferase, alpha subun 97.2
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 97.12
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.12
KOG1987297 consensus Speckle-type POZ protein SPOP and relate 97.08
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.07
KOG2610491 consensus Uncharacterized conserved protein [Funct 97.03
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 97.02
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.0
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.98
PF1342844 TPR_14: Tetratricopeptide repeat 96.85
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 96.81
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.74
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.72
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.72
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 96.62
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.58
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.49
KOG2838401 consensus Uncharacterized conserved protein, conta 96.46
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 96.46
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 96.36
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 96.33
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 96.31
KOG1585308 consensus Protein required for fusion of vesicles 96.29
KOG3616 1636 consensus Selective LIM binding factor [Transcript 96.25
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 96.22
KOG2610 491 consensus Uncharacterized conserved protein [Funct 96.18
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.18
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 96.14
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 96.08
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 95.98
smart00512104 Skp1 Found in Skp1 protein family. Family of Skp1 95.94
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 95.92
PRK10941269 hypothetical protein; Provisional 95.88
PF11822317 DUF3342: Domain of unknown function (DUF3342); Int 95.86
PRK10941269 hypothetical protein; Provisional 95.85
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 95.83
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 95.82
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 95.8
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.78
KOG0529 421 consensus Protein geranylgeranyltransferase type I 95.57
KOG2300629 consensus Uncharacterized conserved protein [Funct 95.56
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 95.51
COG2976207 Uncharacterized protein conserved in bacteria [Fun 95.47
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 95.36
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 95.35
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 95.34
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 95.3
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 95.27
COG4941415 Predicted RNA polymerase sigma factor containing a 95.25
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.24
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 95.11
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.1
KOG1665302 consensus AFH1-interacting protein FIP2, contains 95.04
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 95.02
KOG2714465 consensus SETA binding protein SB1 and related pro 94.86
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 94.83
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 94.81
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 94.8
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 94.77
KOG1310 758 consensus WD40 repeat protein [General function pr 94.66
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 94.45
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 94.43
KOG1310 758 consensus WD40 repeat protein [General function pr 94.4
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 94.29
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 94.23
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 93.95
KOG2471 696 consensus TPR repeat-containing protein [General f 93.93
KOG1724162 consensus SCF ubiquitin ligase, Skp1 component [Po 93.8
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 93.76
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 93.7
KOG1585308 consensus Protein required for fusion of vesicles 93.65
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 93.59
COG4976 287 Predicted methyltransferase (contains TPR repeat) 93.12
KOG4507886 consensus Uncharacterized conserved protein, conta 93.12
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 92.94
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 92.71
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 92.59
KOG4507 886 consensus Uncharacterized conserved protein, conta 92.46
COG4976287 Predicted methyltransferase (contains TPR repeat) 92.45
COG2912269 Uncharacterized conserved protein [Function unknow 92.32
COG4941415 Predicted RNA polymerase sigma factor containing a 92.07
PF0393162 Skp1_POZ: Skp1 family, tetramerisation domain; Int 92.04
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 91.58
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 91.42
KOG3824472 consensus Huntingtin interacting protein HYPE [Gen 91.38
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 90.73
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 90.5
PF1286294 Apc5: Anaphase-promoting complex subunit 5 90.29
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 89.94
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 89.35
KOG0529 421 consensus Protein geranylgeranyltransferase type I 89.19
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 89.08
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 88.97
COG2912269 Uncharacterized conserved protein [Function unknow 88.88
KOG2300629 consensus Uncharacterized conserved protein [Funct 88.41
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 87.93
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 87.86
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 87.81
KOG3616 1636 consensus Selective LIM binding factor [Transcript 87.72
KOG0511516 consensus Ankyrin repeat protein [General function 87.59
PF0146678 Skp1: Skp1 family, dimerisation domain; InterPro: 87.53
COG3629280 DnrI DNA-binding transcriptional activator of the 87.36
KOG2396 568 consensus HAT (Half-A-TPR) repeat-containing prote 87.32
COG5201158 SKP1 SCF ubiquitin ligase, SKP1 component [Posttra 87.31
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 87.02
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 86.87
PF09986214 DUF2225: Uncharacterized protein conserved in bact 86.71
KOG3364149 consensus Membrane protein involved in organellar 86.65
PF09986214 DUF2225: Uncharacterized protein conserved in bact 86.61
PF10255404 Paf67: RNA polymerase I-associated factor PAF67; I 85.19
KOG0546372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 84.81
KOG0546372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 84.44
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 84.24
COG4649221 Uncharacterized protein conserved in bacteria [Fun 83.56
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 83.43
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 83.36
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 83.28
PF10373278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 82.89
COG4649221 Uncharacterized protein conserved in bacteria [Fun 82.86
PF10373 278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 82.74
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 82.71
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 82.67
COG1747 711 Uncharacterized N-terminal domain of the transcrip 82.23
KOG3840438 consensus Uncharaterized conserved protein, contai 81.98
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 81.9
KOG2041 1189 consensus WD40 repeat protein [General function pr 81.51
PF15015569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 81.28
KOG3783546 consensus Uncharacterized conserved protein [Funct 80.74
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 80.72
PF00244236 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 80.53
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=4.2e-36  Score=327.88  Aligned_cols=296  Identities=17%  Similarity=0.085  Sum_probs=262.4

Q ss_pred             HHHHHHHHHHHHhccchHHHHHHHHHHHhcc--chhhHhhHHHHHHHhCCHHHHHHHHHHHHhcCCCcHHHHHHHhhc--
Q 004984          383 LLAFHQLGCVRLLRKEYDEAEHLFEAAVNAG--HIYSIAGLARLGYIKGHKLWAYEKLNSVISSVTPLGWMYQERSLY--  458 (721)
Q Consensus       383 ~la~~~lG~~~~~~g~y~eA~~~f~~AL~~~--~~~A~~~lg~~~~~~G~~~~A~~~~~~aI~~~~~~~~ay~~rg~~--  458 (721)
                      +++|-++|++...+|+.-+|+..|++|++++  ..+||+++|+||-..+.++.|+..|.+|+...|+.+.+|-|.+-+  
T Consensus       218 AiawsnLg~~f~~~Gei~~aiq~y~eAvkldP~f~dAYiNLGnV~ke~~~~d~Avs~Y~rAl~lrpn~A~a~gNla~iYy  297 (966)
T KOG4626|consen  218 AIAWSNLGCVFNAQGEIWLAIQHYEEAVKLDPNFLDAYINLGNVYKEARIFDRAVSCYLRALNLRPNHAVAHGNLACIYY  297 (966)
T ss_pred             eeeehhcchHHhhcchHHHHHHHHHHhhcCCCcchHHHhhHHHHHHHHhcchHHHHHHHHHHhcCCcchhhccceEEEEe
Confidence            6889999999999999999999999999995  567899999999999999999999999999999766665444321  


Q ss_pred             --CChhHHHHHHHHHHhcCCCChHHHHHHHHHHHhcCCHHHHHHHHHHHHhcCCC-HHHHHHHHHHHHhcCCHHHHHHHH
Q 004984          459 --CEGDKRWEDLDKATALDPTLSYPYMYRASSLMTKQNVEAALAEINRILGFKLA-LECLELRFCFFLALEDYQAALCDV  535 (721)
Q Consensus       459 --~~~~eAl~d~~kAieLdP~~~~ay~~rg~~l~~lg~~~eAl~~~~kAL~l~P~-~~~~~~R~~~~~~lgd~eeAl~d~  535 (721)
                        |..+-||..|++||+++|++++||+|+|+++-+.|+..||...|++||.+.|+ ++..+++|.++.++|.+++|++-|
T Consensus       298 eqG~ldlAI~~Ykral~~~P~F~~Ay~NlanALkd~G~V~ea~~cYnkaL~l~p~hadam~NLgni~~E~~~~e~A~~ly  377 (966)
T KOG4626|consen  298 EQGLLDLAIDTYKRALELQPNFPDAYNNLANALKDKGSVTEAVDCYNKALRLCPNHADAMNNLGNIYREQGKIEEATRLY  377 (966)
T ss_pred             ccccHHHHHHHHHHHHhcCCCchHHHhHHHHHHHhccchHHHHHHHHHHHHhCCccHHHHHHHHHHHHHhccchHHHHHH
Confidence              23399999999999999999999999999999999999999999999999998 899999999999999999999999


Q ss_pred             HHHHhhCCCchhhhhhHHHHHHHHHHHHhhhhhhHHHHHHhhhhccccccccchHHHHHHHHHhCCCChhHHHHHHHHHH
Q 004984          536 QAILTLSPDYRMFEGRVAASQLHMLVREHIDNWTIADCWLQLYDRWSSVDDIGSLSVIYQMLESDAPKGVLYFRQSLLLL  615 (721)
Q Consensus       536 ~kal~L~P~~~~~~~~~~a~~~~~~l~~~~~~~~~A~~~~~l~~~~~~~dd~~al~~~~qaL~l~P~~~~~~~~~g~~L~  615 (721)
                      .++++..|.+.      ++.+.++.+...+...++|                  +.+|..||.++|..++++.|+|+++-
T Consensus       378 ~~al~v~p~~a------aa~nNLa~i~kqqgnl~~A------------------i~~YkealrI~P~fAda~~NmGnt~k  433 (966)
T KOG4626|consen  378 LKALEVFPEFA------AAHNNLASIYKQQGNLDDA------------------IMCYKEALRIKPTFADALSNMGNTYK  433 (966)
T ss_pred             HHHHhhChhhh------hhhhhHHHHHHhcccHHHH------------------HHHHHHHHhcCchHHHHHHhcchHHH
Confidence            99999999984      4555555555555555555                  89999999999999999999999999


Q ss_pred             HcCChHHHHHHHHHHHHhCCCChhHHHHHHHHHHhcCCHHHHHHHHHHHHhcCCCHH-HHHHHHHHhhcc--CCC-CCch
Q 004984          616 RLNCPEAAMRSLQLARQHAASDHERLVYEGWILYDTSHCEEGLRKAEESIQMKRSFE-AFFLKAYALADS--SQD-SSCS  691 (721)
Q Consensus       616 ~lg~~eeAl~~~~~Al~l~P~~~ea~~~~G~~Ly~~G~~deAl~~ye~Ai~i~~~~~-a~~~~~~~~~~~--~~~-~~~~  691 (721)
                      .+|+..+|+.+|.+|+..+|..+||+.|+|.++-+.|+..+|++.|++|+.|+|+|. ||-|++-++-=-  ..| ..--
T Consensus       434 e~g~v~~A~q~y~rAI~~nPt~AeAhsNLasi~kDsGni~~AI~sY~~aLklkPDfpdA~cNllh~lq~vcdw~D~d~~~  513 (966)
T KOG4626|consen  434 EMGDVSAAIQCYTRAIQINPTFAEAHSNLASIYKDSGNIPEAIQSYRTALKLKPDFPDAYCNLLHCLQIVCDWTDYDKRM  513 (966)
T ss_pred             HhhhHHHHHHHHHHHHhcCcHHHHHHhhHHHHhhccCCcHHHHHHHHHHHccCCCCchhhhHHHHHHHHHhcccchHHHH
Confidence            999999999999999999999999999999999999999999999999999999999 999999876321  122 1223


Q ss_pred             hhHHHHHHHhh
Q 004984          692 STVVSLLEDAL  702 (721)
Q Consensus       692 ~~~~~~~~~~~  702 (721)
                      .++++..+|-+
T Consensus       514 ~kl~sivrdql  524 (966)
T KOG4626|consen  514 KKLVSIVRDQL  524 (966)
T ss_pred             HHHHHHHHHHH
Confidence            56677766655



>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4350 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2075 consensus Topoisomerase TOP1-interacting protein BTBD1 [Function unknown] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00651 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB (for BR-C, ttk and bab) [] or POZ (for Pox virus and Zinc finger) [] domain is present near the N terminus of a fraction of zinc finger (IPR007087 from INTERPRO) proteins and in proteins that contain the IPR006652 from INTERPRO motif such as Kelch and a family of pox virus proteins Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG4591 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00225 BTB Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG4682 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF07707 BACK: BTB And C-terminal Kelch; InterPro: IPR011705 This domain is found associated with (IPR000210 from INTERPRO) and (IPR006652 from INTERPRO) Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF02214 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassium channels are the most diverse group of the ion channel family [, ] Back     alignment and domain information
>KOG2716 consensus Polymerase delta-interacting protein PDIP1 and related proteins, contain BTB/POZ domain [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00875 BACK BTB And C-terminal Kelch Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2838 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>KOG3473 consensus RNA polymerase II transcription elongation factor Elongin/SIII, subunit elongin C [Transcription] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG1987 consensus Speckle-type POZ protein SPOP and related proteins with TRAF, MATH and BTB/POZ domains [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG2838 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>smart00512 Skp1 Found in Skp1 protein family Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF11822 DUF3342: Domain of unknown function (DUF3342); InterPro: IPR021777 This family of proteins are functionally uncharacterised Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG1665 consensus AFH1-interacting protein FIP2, contains BTB/POZ domain and pentapeptide repeats [General function prediction only] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG2714 consensus SETA binding protein SB1 and related proteins, contain BTB/POZ domain [General function prediction only] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1724 consensus SCF ubiquitin ligase, Skp1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription] Back     alignment and domain information
>PF03931 Skp1_POZ: Skp1 family, tetramerisation domain; InterPro: IPR016073 SKP1 (together with SKP2) was identified as an essential component of the cyclin A-CDK2 S phase kinase complex [] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF01466 Skp1: Skp1 family, dimerisation domain; InterPro: IPR016072 SKP1 (together with SKP2) was identified as an essential component of the cyclin A-CDK2 S phase kinase complex [] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG5201 SKP1 SCF ubiquitin ligase, SKP1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>KOG3840 consensus Uncharaterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query721
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 4e-10
3hqi_A312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 5e-10
4eoz_A145 Speckle-type POZ protein; E3 ubiquitin ligase, nuc 2e-09
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-07
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-04
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 7e-07
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-05
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 7e-05
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 1e-04
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 5e-04
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 4e-04
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 6e-04
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 5e-04
2if5_A120 Zinc finger and BTB domain-containing protein 7A; 5e-04
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Length = 172 Back     alignment and structure
 Score = 58.4 bits (142), Expect = 4e-10
 Identities = 33/165 (20%), Positives = 62/165 (37%), Gaps = 16/165 (9%)

Query: 153 PIDIASHLQTDINVAGSHETVSMSGDQVLRNVVFRIHEEKIECDRQKFAALSAPFSAMLN 212
              +A  L              +  +    +    +  ++ +  +   AA S  FSAM  
Sbjct: 18  ECRLADELG------------GLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFE 65

Query: 213 GSFMESLCEDIDLSENNISPSGLRIISDFSVTGSLNGVTPNLLLEILIFANKFCCERLKD 272
               ES    +++  N++ P   + +  F  TG        +  ++L  A+K+  ERLK 
Sbjct: 66  HEMEESKKNRVEI--NDVEPEVFKEMMCFIYTGKAP-NLDKMADDLLAAADKYALERLKV 122

Query: 273 ACDRKLASLVASREDAVELMGYAIEENSPVLAVSCLQVFLRELPD 317
            C+  L S + S E+A E++  A   ++  L    +        D
Sbjct: 123 MCEDALCSNL-SVENAAEILILADLHSADQLKTQAVDFINYHATD 166


>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Length = 312 Back     alignment and structure
>4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Length = 145 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Length = 109 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Length = 127 Back     alignment and structure
>2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Length = 120 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query721
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
3hve_A256 Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis 99.97
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.97
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.97
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.97
3i3n_A279 Kelch-like protein 11; structural genomics, BTB, K 99.97
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.97
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.96
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.96
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.96
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.96
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.96
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.95
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.95
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.95
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.95
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.95
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.95
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.95
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.95
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.95
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.94
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.94
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.94
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.93
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 99.93
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.93
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.93
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.92
3u4t_A272 TPR repeat-containing protein; structural genomics 99.92
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.92
3u4t_A272 TPR repeat-containing protein; structural genomics 99.92
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.92
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.92
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.91
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.91
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.91
3hqi_A312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 99.9
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.9
4eoz_A145 Speckle-type POZ protein; E3 ubiquitin ligase, nuc 99.9
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.89
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.89
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.89
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 99.88
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.88
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.88
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.88
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.87
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.87
2if5_A120 Zinc finger and BTB domain-containing protein 7A; 99.87
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.87
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.87
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.87
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 99.87
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.86
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.86
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.86
2z8h_A138 Transcription regulator protein BACH1; BTB, POZ, d 99.86
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.85
2ppi_A144 Gigaxonin; BTB domain, protein degradation, struct 99.85
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.85
3b84_A119 Zinc finger and BTB domain-containing protein 48; 99.85
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.85
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.85
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.85
1buo_A121 POZ domain, protein (promyelocytic leukemia zinc f 99.84
2vpk_A116 Myoneurin; transcription regulation, transcription 99.84
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.84
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.84
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.84
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.84
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.84
2yy9_A135 Zinc finger and BTB domain-containing protein 48; 99.84
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.83
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.83
2ihc_A124 Transcription regulator protein BACH1; BRIC-A-BRAC 99.83
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.83
3ohu_A125 Transcription regulator protein BACH2; BTB/POZ dom 99.83
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.82
2q81_A119 MIZ-1 protein; BTB/POZ domain, transcription; HET: 99.82
3ga1_A129 Nucleus accumbens-associated protein 1; BTB/POZ do 99.82
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.82
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.81
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.81
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.81
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.8
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.8
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.8
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.8
3m5b_A119 Zinc finger and BTB domain-containing protein 32; 99.8
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.8
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.8
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.79
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.79
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.79
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.79
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.79
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.78
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.78
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.78
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.78
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.78
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.78
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.77
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.77
3fkc_A116 Transcriptional regulator kaiso; zinc finger and B 99.76
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.76
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.76
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.75
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.74
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.74
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.73
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.73
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.73
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.73
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.72
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.72
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.72
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.71
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.7
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.69
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.69
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.68
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.67
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.67
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.65
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.64
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.64
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.64
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.63
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.63
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.63
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.62
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.62
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.61
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.61
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.6
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.6
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.6
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.59
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.59
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.58
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.57
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.57
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.56
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.56
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.55
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.54
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.54
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.53
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.52
2ast_A159 S-phase kinase-associated protein 1A; SCF-substrat 99.5
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.5
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.5
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.5
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.5
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.49
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.49
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.49
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.48
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.48
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.48
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.47
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.47
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.46
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.45
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.45
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.44
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.44
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.44
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.43
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.43
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.43
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.42
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.41
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.41
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.41
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.41
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.41
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.4
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.38
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.38
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.34
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.33
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.33
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.32
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.32
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.32
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.32
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.31
3k9i_A117 BH0479 protein; putative protein binding protein, 99.31
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.3
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.3
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.3
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.29
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.29
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.28
3k9i_A117 BH0479 protein; putative protein binding protein, 99.28
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.27
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.27
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.27
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.26
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.25
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 99.24
4ajy_C97 Transcription elongation factor B polypeptide 1; E 99.21
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.19
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.19
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.17
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.14
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 99.12
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 99.06
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 99.05
1fs1_B141 SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, le 99.05
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.05
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.03
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.02
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.99
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.97
2p1m_A160 SKP1-like protein 1A; F-BOX, leucine rich repeat, 98.95
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.87
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.86
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.85
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.85
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.79
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 98.76
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 98.73
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.67
2eqx_A105 Kelch repeat and BTB domain-containing protein 4; 98.61
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.6
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.6
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.55
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.44
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.44
1hv2_A99 Elongin C, ELC1; protein-peptide complex, signalin 98.41
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.41
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.4
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.37
3v7d_A169 Suppressor of kinetochore protein 1; WD 40 domain, 98.33
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.31
2fnj_C96 Transcription elongation factor B polypeptide 1; b 98.3
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.29
3drz_A107 BTB/POZ domain-containing protein KCTD5; potassium 98.12
2uy1_A 493 Cleavage stimulation factor 77; RNA-binding protei 98.1
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.97
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.95
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 97.88
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.83
1vcb_B112 Protein (elongin C); tumor suppressor, cancer, ubi 97.8
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.73
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.69
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.42
3drx_A202 BTB/POZ domain-containing protein KCTD5; golgi, gr 97.11
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 96.62
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 96.53
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 96.53
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 96.27
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 95.87
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 95.82
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 95.72
1s1g_A124 Potassium voltage-gated channel subfamily D membe; 95.6
3kvt_A115 Potassium channel protein SHAW; tetramerization do 95.53
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 95.15
1nn7_A105 Potassium channel KV4.2; teteramerization domain, 95.08
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 94.85
2nz0_B140 Potassium voltage-gated channel subfamily D membe; 94.77
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 94.77
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 94.61
1t1d_A100 Protein (potassium channel KV1.1); potassium chann 94.32
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 93.94
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 93.86
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 93.62
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 93.59
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 93.35
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 92.17
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 91.53
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 91.49
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 91.16
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 88.95
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 84.88
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 84.61
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 81.48
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 81.29
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
Probab=100.00  E-value=1.3e-32  Score=296.72  Aligned_cols=320  Identities=14%  Similarity=0.088  Sum_probs=223.8

Q ss_pred             CchhHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHhccchHHHHHHHHHHHhccc--hhhHhhHHHHHHHhCCHHHHHHHH
Q 004984          361 RSDKTVCFLERLLESAETDRQRLLAFHQLGCVRLLRKEYDEAEHLFEAAVNAGH--IYSIAGLARLGYIKGHKLWAYEKL  438 (721)
Q Consensus       361 rs~~~~~LLe~Lv~~a~~~lq~~la~~~lG~~~~~~g~y~eA~~~f~~AL~~~~--~~A~~~lg~~~~~~G~~~~A~~~~  438 (721)
                      +.+....+++.+++..+.   ...+++.+|.++...|++++|+..|++|++++|  ..++.++|.++...|++++|+..|
T Consensus        48 ~~~~a~~~~~~a~~~~p~---~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~  124 (388)
T 1w3b_A           48 RLDRSAHFSTLAIKQNPL---LAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAY  124 (388)
T ss_dssp             CHHHHHHHHHHHHHHCTT---CHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHSCSSHHHHHH
T ss_pred             CHHHHHHHHHHHHhcCCC---chHHHHHHHHHHHHCCCHHHHHHHHHHHHHcCcchHHHHHHHHHHHHHcCCHHHHHHHH
Confidence            444555666665554332   255677888888888888888888888887744  345777888888888888888888


Q ss_pred             HHHHhcCCCcHHHHHHHhh----cCChhHHHHHHHHHHhcCCCChHHHHHHHHHHHhcCCHHHHHHHHHHHHhcCCC-HH
Q 004984          439 NSVISSVTPLGWMYQERSL----YCEGDKRWEDLDKATALDPTLSYPYMYRASSLMTKQNVEAALAEINRILGFKLA-LE  513 (721)
Q Consensus       439 ~~aI~~~~~~~~ay~~rg~----~~~~~eAl~d~~kAieLdP~~~~ay~~rg~~l~~lg~~~eAl~~~~kAL~l~P~-~~  513 (721)
                      .++++.+|+...++..+|.    .++.++|+..|+++++++|+++.+|.++|.++...|++++|+..|+++++++|+ ..
T Consensus       125 ~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~  204 (388)
T 1w3b_A          125 VSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLD  204 (388)
T ss_dssp             HHHHHHCTTCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHCTTCHH
T ss_pred             HHHHHhCCCcHHHHHHHHHHHHHccCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCcHH
Confidence            8888888887777776654    256688888888888888888888888888888888888888888888888886 67


Q ss_pred             HHHHHHHHHHhcCCHHHHHHHHHHHHhhCCCchhhh-hhHHHHHHHHHHHHhhhhhhH--------HHHHHhhhhccccc
Q 004984          514 CLELRFCFFLALEDYQAALCDVQAILTLSPDYRMFE-GRVAASQLHMLVREHIDNWTI--------ADCWLQLYDRWSSV  584 (721)
Q Consensus       514 ~~~~R~~~~~~lgd~eeAl~d~~kal~L~P~~~~~~-~~~~a~~~~~~l~~~~~~~~~--------A~~~~~l~~~~~~~  584 (721)
                      .+..+|.++...|++++|+..|+++++++|++.... ..+.+....+..+...+.+++        .++|..+...+...
T Consensus       205 ~~~~lg~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~  284 (388)
T 1w3b_A          205 AYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEK  284 (388)
T ss_dssp             HHHHHHHHHHTTTCTTHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTCSSCHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHcCCHHHHHHHHHHHHhhCcCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhCCCCHHHHHHHHHHHHHc
Confidence            777788888888888888888888888888774322 122222222222222222221        22334444444444


Q ss_pred             cccc-hHHHHHHHHHhCCCChhHHHHHHHHHHHcCChHHHHHHHHHHHHhCCCChhHHHHHHHHHHhcCCHHHHHHHHHH
Q 004984          585 DDIG-SLSVIYQMLESDAPKGVLYFRQSLLLLRLNCPEAAMRSLQLARQHAASDHERLVYEGWILYDTSHCEEGLRKAEE  663 (721)
Q Consensus       585 dd~~-al~~~~qaL~l~P~~~~~~~~~g~~L~~lg~~eeAl~~~~~Al~l~P~~~ea~~~~G~~Ly~~G~~deAl~~ye~  663 (721)
                      +++. |+..++++++++|.++.+++++|.++..+|++++|+..++++++++|+++.+++++|+++..+|++++|+..|++
T Consensus       285 g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~  364 (388)
T 1w3b_A          285 GSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKE  364 (388)
T ss_dssp             SCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHhhCcccHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCcHHHHHHHHHHHHHcCCHHHHHHHHHH
Confidence            4444 566777777777777777777777777777777777777777777777777777777777777777777777777


Q ss_pred             HHhcCCCHH-HHHHHHHHhhc
Q 004984          664 SIQMKRSFE-AFFLKAYALAD  683 (721)
Q Consensus       664 Ai~i~~~~~-a~~~~~~~~~~  683 (721)
                      +++++|++. +|++.|.++..
T Consensus       365 a~~~~p~~~~a~~~lg~~~~~  385 (388)
T 1w3b_A          365 AIRISPTFADAYSNMGNTLKE  385 (388)
T ss_dssp             HHTTCTTCHHHHHHHHHHHHH
T ss_pred             HHhhCCCCHHHHHhHHHHHHH
Confidence            777777776 77777776643



>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} PDB: 4ap2_A* 4apf_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Back     alignment and structure
>2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} SCOP: d.42.1.0 PDB: 3ohv_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Back     alignment and structure
>3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} SCOP: d.42.1.0 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4ajy_C Transcription elongation factor B polypeptide 1; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 2izv_C 3dcg_B 3zrc_B* 3zrf_B 3ztc_B* 3ztd_B* 3zun_B* 2c9w_C 4awj_B* 4b95_B* 4b9k_B* 2fnj_C 1lqb_B 1lm8_C 2jz3_C 2xai_B 4b9k_E* Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1fs1_B SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.157.1.1 d.42.1.1 PDB: 1fs2_B 1ldk_D Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2p1m_A SKP1-like protein 1A; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_A* 2p1o_A* 2p1p_A* 2p1q_A* 3c6n_A* 3c6o_A* 3c6p_A* 3ogk_A* 3ogl_A* 3ogm_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2eqx_A Kelch repeat and BTB domain-containing protein 4; BACK domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1hv2_A Elongin C, ELC1; protein-peptide complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: d.42.1.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3v7d_A Suppressor of kinetochore protein 1; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_A* 3mks_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2fnj_C Transcription elongation factor B polypeptide 1; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.42.1.1 PDB: 1lqb_B 1lm8_C 2jz3_C 2xai_B 2c9w_C 2izv_C 3dcg_B 3zrc_B* 3zrf_B Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3drz_A BTB/POZ domain-containing protein KCTD5; potassium channel domain T1, pentamer, unkno function; 1.90A {Homo sapiens} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1vcb_B Protein (elongin C); tumor suppressor, cancer, ubiquitin, beta sandwich, transcription, transcriptional elongation; 2.70A {Homo sapiens} SCOP: d.42.1.1 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3drx_A BTB/POZ domain-containing protein KCTD5; golgi, grAsp55, potassium channel domain T1, pentameric assembly, HOST-virus interaction, nucleus; 3.11A {Homo sapiens} PDB: 3dry_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1s1g_A Potassium voltage-gated channel subfamily D membe; K+ channels, tetramerization domain, T1 domain, transport PR; 2.60A {Homo sapiens} SCOP: d.42.1.2 Back     alignment and structure
>3kvt_A Potassium channel protein SHAW; tetramerization domain, molecular recogni zinc-binding; 2.00A {Aplysia californica} SCOP: d.42.1.2 Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1nn7_A Potassium channel KV4.2; teteramerization domain, voltage gated potassium channel SHAL, membrane protein; 2.10A {Rattus norvegicus} SCOP: d.42.1.2 Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>2nz0_B Potassium voltage-gated channel subfamily D membe; KV4.3, kchip1, membrane protein; 3.20A {Homo sapiens} PDB: 2i2r_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1t1d_A Protein (potassium channel KV1.1); potassium channels, tetramerization domain, aplysia KV1.1, proton transport, membrane protein; 1.51A {Aplysia californica} SCOP: d.42.1.2 PDB: 1eod_A 1eof_A 1eoe_A 1a68_A 1qdv_A 1exb_E* 1qdw_A 1dsx_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 721
d1r29a_122 d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB 5e-05
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 6e-05
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 0.001
d1buoa_121 d.42.1.1 (A:) Promyelocytic leukaemia zinc finger 5e-04
>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: POZ domain
superfamily: POZ domain
family: BTB/POZ domain
domain: B-cell lymphoma 6 (Bcl6) protein BTB domain
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 41.3 bits (96), Expect = 5e-05
 Identities = 21/103 (20%), Positives = 40/103 (38%), Gaps = 3/103 (2%)

Query: 178 DQVLRNVVFRIHEEKIECDRQKFAALSAPFSAMLNGSFMESLCEDIDLSENNISPSGLRI 237
             +L +VV  +  E+    +    A S  F ++       +L          I+P G  I
Sbjct: 22  RDILTDVVIVVSREQFRAHKTVLMACSGLFYSIFTDQLKRNLSVINLD--PEINPEGFNI 79

Query: 238 ISDFSVTGSLNGVTPNLLLEILIFANKFCCERLKDACDRKLAS 280
           + DF  T  LN +    ++ ++  A     E + D C + + +
Sbjct: 80  LLDFMYTSRLN-LREGNIMAVMATAMYLQMEHVVDTCRKFIKA 121


>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 121 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query721
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.97
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.94
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.93
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.92
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.91
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.89
d1r29a_122 B-cell lymphoma 6 (Bcl6) protein BTB domain {Human 99.86
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.86
d1buoa_121 Promyelocytic leukaemia zinc finger (PLZF) protein 99.85
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.84
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.8
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.8
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.69
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.68
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.68
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.66
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.62
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.61
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.59
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.58
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.58
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.57
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.53
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.52
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.52
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.46
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.42
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.42
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.41
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.38
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.38
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.38
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.37
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.37
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.36
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.36
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.34
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.32
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.32
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.31
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.31
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.3
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.29
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.26
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.16
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.12
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 99.11
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.1
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.04
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.96
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.83
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.71
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.64
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.04
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.92
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.89
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.67
d2c9wc196 Elongin C {Human (Homo sapiens) [TaxId: 9606]} 97.67
d1hv2a_99 Elongin C {Baker's yeast (Saccharomyces cerevisiae 97.33
d1nn7a_105 Potassium channel kv4.2 {Rat (Rattus norvegicus) [ 96.87
d3kvta_103 akv3.1 voltage-gated potassium channel {California 96.83
d1t1da_100 Shaker potassium channel {California sea hare (Apl 96.23
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 93.81
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 92.55
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 90.29
d1fs1b155 Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sa 89.19
d1fs1b261 Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sa 87.49
d1nexa170 Centromere DNA-binding protein complex Cbf3 subuni 87.11
d1nexa272 Centromere DNA-binding protein complex Cbf3 subuni 86.41
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=1e-30  Score=272.89  Aligned_cols=296  Identities=14%  Similarity=0.070  Sum_probs=251.5

Q ss_pred             CchhHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHhccchHHHHHHHHHHHhccc--hhhHhhHHHHHHHhCCHHHHHHHH
Q 004984          361 RSDKTVCFLERLLESAETDRQRLLAFHQLGCVRLLRKEYDEAEHLFEAAVNAGH--IYSIAGLARLGYIKGHKLWAYEKL  438 (721)
Q Consensus       361 rs~~~~~LLe~Lv~~a~~~lq~~la~~~lG~~~~~~g~y~eA~~~f~~AL~~~~--~~A~~~lg~~~~~~G~~~~A~~~~  438 (721)
                      +.+.+...++++++..++   +..+++.+|.++...|++++|+..|++||+++|  ..++..+|.++..+|++++|+..+
T Consensus        14 ~~~~A~~~~~~~l~~~p~---~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~a~~~l~~~~~~~g~~~~A~~~~   90 (388)
T d1w3ba_          14 DFEAAERHCMQLWRQEPD---NTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHY   90 (388)
T ss_dssp             CHHHHHHHHHHHHHHCTT---CHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHhCCC---CHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHhhhhcccccccccc
Confidence            345666777776654442   356788999999999999999999999999854  557888999999999999999888


Q ss_pred             HHHHhcCC--------------------------------------------------------------------CcHH
Q 004984          439 NSVISSVT--------------------------------------------------------------------PLGW  450 (721)
Q Consensus       439 ~~aI~~~~--------------------------------------------------------------------~~~~  450 (721)
                      .+++...|                                                                    +.+.
T Consensus        91 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  170 (388)
T d1w3ba_          91 RHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAV  170 (388)
T ss_dssp             HHHHHHCTTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHHHHHTTSCHHHHHHHHHHHHHHCTTCHH
T ss_pred             ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccchhhhhHHHHHHhhccCcchhH
Confidence            76666444                                                                    3444


Q ss_pred             HHHHHhh----cCChhHHHHHHHHHHhcCCCChHHHHHHHHHHHhcCCHHHHHHHHHHHHhcCCC-HHHHHHHHHHHHhc
Q 004984          451 MYQERSL----YCEGDKRWEDLDKATALDPTLSYPYMYRASSLMTKQNVEAALAEINRILGFKLA-LECLELRFCFFLAL  525 (721)
Q Consensus       451 ay~~rg~----~~~~~eAl~d~~kAieLdP~~~~ay~~rg~~l~~lg~~~eAl~~~~kAL~l~P~-~~~~~~R~~~~~~l  525 (721)
                      ++..+|.    .+..++|+..+++|++++|+++.+|..+|.++...|++++|+..|++++.++|. +..+..+|.++...
T Consensus       171 ~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~  250 (388)
T d1w3ba_         171 AWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQ  250 (388)
T ss_dssp             HHHHHHHHHHTTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTTCHHHHHHHHHHHHHT
T ss_pred             HHHhhcccccccCcHHHHHHHHHHHHHhCcccHHHHHHHhhhhhccccHHHHHHHHHHhHHHhhhHHHHHHHHHHHHHHC
Confidence            5555443    255589999999999999999999999999999999999999999999999986 77778899999999


Q ss_pred             CCHHHHHHHHHHHHhhCCCchhhhhhHHHHHHHHHHHHhhhhhhHHHHHHhhhhccccccccchHHHHHHHHHhCCCChh
Q 004984          526 EDYQAALCDVQAILTLSPDYRMFEGRVAASQLHMLVREHIDNWTIADCWLQLYDRWSSVDDIGSLSVIYQMLESDAPKGV  605 (721)
Q Consensus       526 gd~eeAl~d~~kal~L~P~~~~~~~~~~a~~~~~~l~~~~~~~~~A~~~~~l~~~~~~~dd~~al~~~~qaL~l~P~~~~  605 (721)
                      |++++|+..|+++++++|++..      +...++.+.....++++|                  +..+++++...|.++.
T Consensus       251 ~~~~~A~~~~~~al~~~p~~~~------~~~~l~~~~~~~~~~~~A------------------~~~~~~~~~~~~~~~~  306 (388)
T d1w3ba_         251 GLIDLAIDTYRRAIELQPHFPD------AYCNLANALKEKGSVAEA------------------EDCYNTALRLCPTHAD  306 (388)
T ss_dssp             TCHHHHHHHHHHHHHTCSSCHH------HHHHHHHHHHHHSCHHHH------------------HHHHHHHHHHCTTCHH
T ss_pred             CCHHHHHHHHHHHHHhCCCCHH------HHHHHHHHHHHcCCHHHH------------------HHHHHhhhccCCccch
Confidence            9999999999999999999843      344444444455555555                  8889999999999999


Q ss_pred             HHHHHHHHHHHcCChHHHHHHHHHHHHhCCCChhHHHHHHHHHHhcCCHHHHHHHHHHHHhcCCCHH-HHHHHHHHhhc
Q 004984          606 LYFRQSLLLLRLNCPEAAMRSLQLARQHAASDHERLVYEGWILYDTSHCEEGLRKAEESIQMKRSFE-AFFLKAYALAD  683 (721)
Q Consensus       606 ~~~~~g~~L~~lg~~eeAl~~~~~Al~l~P~~~ea~~~~G~~Ly~~G~~deAl~~ye~Ai~i~~~~~-a~~~~~~~~~~  683 (721)
                      .++.+|.++..+|++++|+..|++|++++|+++++++++|.++..+|++++|+..|++|++++|++. +|++.|.+|.+
T Consensus       307 ~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l~P~~~~a~~~lg~~~~~  385 (388)
T d1w3ba_         307 SLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKE  385 (388)
T ss_dssp             HHHHHHHHHHTTTCHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTCTTCHHHHHHHHHHHHH
T ss_pred             hhhHHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHH
Confidence            9999999999999999999999999999999999999999999999999999999999999999988 99999998753



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c9wc1 d.42.1.1 (C:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv2a_ d.42.1.1 (A:) Elongin C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nn7a_ d.42.1.2 (A:) Potassium channel kv4.2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3kvta_ d.42.1.2 (A:) akv3.1 voltage-gated potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} Back     information, alignment and structure
>d1t1da_ d.42.1.2 (A:) Shaker potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fs1b1 a.157.1.1 (B:86-140) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fs1b2 d.42.1.1 (B:2-68) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexa1 a.157.1.1 (A:116-185) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexa2 d.42.1.1 (A:4-103) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure