Citrus Sinensis ID: 004992


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720
MDPQRRQGPSVPERKGQKRKLDEETVIGDEQQQMQQREISSSSAGTSSSDARQALLSEVSAQVNVLNTTFSWLEADRAAAKRATHVLAELAKNEEVVNWIVEGGAVPALVKHLQAPPTSEADRNLKPFEHEVEKGSAFALGLLAVKPEHQQLIVDNGALSHLVNLLKRHMDSNCSRAVNSVIRRAADAITNLAHENSSIKTRVRMEGGIPPLVELLEFTDTKVQRAAAGALRTLAFKNDENKNQIVECNALPTLILMLRSEDSAIHYEAVGVIGNLVHSSPNIKKEVLAAGALQPVIGLLSSCCSESQREAALLLGQFAATDSDCKVHIVQRGAVRPLIEMLQSPDVQLREMSAFALGRLAQVITDMHNQAGIAHNGGLVPLLKLLDSKNGSLQHNAAFALYGLADNEDNVADFIRVGGVQKLQDGEFIVQATKDCVAKTLKRLEEKIHGRVLNHLLYLMRVAEKGVQRRVALALAHLCSPDDQRTIFIDGGGLELLLGLLGSTNPKQQLDGAVALFKLANKATTLSSVDAAPPSPTPQVYLGDQFVNNATLSDVTFLVEGRRFYAHRICLLASSDAFRAMFDGGYREKDARDIEIPNIRWEVFELMMRFIYTGSVDVTLDIAQDLLRAADQYLLEGLKRLCEYTIAQDISLENVSSMYELSEAFHAISLRHTCILYIMEHFDKLSTRPGHSNLIQRIIPEIHNYFAKALTKPNPHNSRL
ccccccccccHHHHHHHHHHcHHHHHccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHccccccccccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHccccccHHHHHHcccHHHHHHHcccccHHHHHHHHHHHHHcccccHHHHHHHHHcccHHHHHHccccccHHHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHcccccHHHHHHHHHHHHHHHcccccHHHHHHHHHccccHHHHHccccccHHHHHHHHHHHHHHccccHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHcccccccccHHHHHHHHHHHcccccccccccccccccccccccHHHHcccccccEEEEEcccEEcHHHHHHHcccHHHHHHHcccccccccccEEcccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccccccc
ccHHHccccccccccHHHHHccHHHHcccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHHcccccHHHccccccccHHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccHHHHHHHHccccHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHccHHHHHHHHcccccHHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHHcccccHHHHHHHHHccccHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHHcccccccHHccccccccccHHHHHHHccccccccEEEEEcccEEEEHHHHHHHcHHHHHHHHccccccccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccccccc
mdpqrrqgpsvperkgqkrkldeetvIGDEQQQMQQreissssagtsssDARQALLSEVSAQVNVLNTTFSWLEADRAAAKRATHVLAELAKNEEVVNWIVEGGAVPALVkhlqapptseadrnlkpfeheveKGSAFALGLlavkpehqqlivdNGALSHLVNLLKRHMDSNCSRAVNSVIRRAADAITNlahenssiktrvrmeggipplvelLEFTDTKVQRAAAGALRTLafkndenknqivecnALPTLILMLRSEDSAIHYEAVGVIGnlvhsspnikKEVLAAGALQPVIGLLSSCCSESQREAALLLGQfaatdsdckvhivqrgavrpliemlqspdvqLREMSAFALGRLAQVITDMHNqagiahngglvPLLKlldskngslqhNAAFALygladnednvADFIRVggvqklqdgEFIVQATKDCVAKTLKRLEEKIHGRVLNHLLYLMRVAEKGVQRRVALALAHlcspddqrtifiDGGGLELLLGLlgstnpkqqLDGAVALFKLANkattlssvdaappsptpqvylgdqfvnnatlsdvtfLVEGRRFYAHRICLLASSDAFRAMFdggyrekdardieipnIRWEVFELMMRFIYTGSVDVTLDIAQDLLRAADQYLLEGLKRLCEYTIAQDISLENVSSMYELSEAFHAISLRHTCILYIMEHfdklstrpghsnlIQRIIPEIHNYFAKaltkpnphnsrl
mdpqrrqgpsvperkgqkrkldeetvigdeqqqmqqreissssagtSSSDARQALLSEVSAQVNVLNTTFSWLEADRAAAKRATHVLAELAKNEEVVNWIVEGGAVPALVKHLQAPPTSEADRNLKPFEHEVEKGSAFALGLLAVKPEHQQLIVDNGALSHLVNLLKRHMDSNCSRAVNSVIRRAADAitnlahenssiktrvrmEGGIPPLVELLEFTDTKVQRAAAGALRtlafkndenknqiVECNALPTLILMLRSEDSAIHYEAVGVIGNLVHSSPNIKKEVLAAGALQPVIGLLSSCCSESQREAALLLGQFAATDSDCKVHIVQRGAVRPLIEMLQSPDVQLREMSAFALGRLAQVITDMHNQAGIAHNGGLVPLLKLLDSKNGSLQHNAAFALYGLADNEDNVADFIRVGGVQKLQDGEFIVQATKDCVAKTLKRLEEKIHGRVLNHLLYLMRVAEKGVQRRVALALAHLCSPDDQRTIFIDGGGLELLLGLLGSTNPKQQLDGAVALFKLANKATTLSSVDAAPPSPTPQVYLGDQFVNNATLSDVTFLVEGRRFYAHRICLLASSDAFRAMFDGgyrekdardieiPNIRWEVFELMMRFIYTGSVDVTLDIAQDLLRAADQYLLEGLKRLCEYTIAQDISLENVSSMYELSEAFHAISLRHTCILYIMEHFDKLSTRPGHSNLIQRIIPEIHNYFAKaltkpnphnsrl
MDPQRRQGPSVPERKGQKRKLDEETVIGDEQQQMQQREIssssagtsssDARQALLSEVSAQVNVLNTTFSWLEADRAAAKRATHVLAELAKNEEVVNWIVEGGAVPALVKHLQAPPTSEADRNLKPFEHEVEKGSAFALGLLAVKPEHQQLIVDNGALSHLVNLLKRHMDSNCSRAVNSVIRRAADAITNLAHENSSIKTRVRMEGGIPPLVELLEFTDTKVQRAAAGALRTLAFKNDENKNQIVECNALPTLILMLRSEDSAIHYEAVGVIGNLVHSSPNIKKEVLAAGALQPVIGLLSSCCSESQREAALLLGQFAATDSDCKVHIVQRGAVRPLIEMLQSPDVQLREMSAFALGRLAQVITDMHNQAGIAHNGGLVPLLKLLDSKNGSLQHNAAFALYGLADNEDNVADFIRVGGVQKLQDGEFIVQATKDCVAKTLKRLEEKIHGRVLNHLLYLMRVAEKGVQRRVALALAHLCSPDDQRTIFIDggglelllgllgSTNPKQQLDGAVALFKLANKATTLSSVDAAPPSPTPQVYLGDQFVNNATLSDVTFLVEGRRFYAHRICLLASSDAFRAMFDGGYREKDARDIEIPNIRWEVFELMMRFIYTGSVDVTLDIAQDLLRAADQYLLEGLKRLCEYTIAQDISLENVSSMYELSEAFHAISLRHTCILYIMEHFDKLSTRPGHSNLIQRIIPEIHNYFAKALTKPNPHNSRL
**********************************************************VSAQVNVLNTTFSWLEADRAAAKRATHVLAELAKNEEVVNWIVEGGAVPALVKHL*********************GSAFALGLLAVKPEHQQLIVDNGALSHLVNLLKRHMDSNCSRAVNSVIRRAADAITNLAHENSSIKTRVRMEGGIPPLVELLEFTDTKVQRAAAGALRTLAFKNDENKNQIVECNALPTLILMLRSEDSAIHYEAVGVIGNLVHSSPNIKKEVLAAGALQPVIGLLSSCCSESQREAALLLGQFAATDSDCKVHIVQRGAVRPLIEMLQSPDVQLREMSAFALGRLAQVITDMHNQAGIAHNGGLVPLLKLLDSKNGSLQHNAAFALYGLADNEDNVADFIRVGGVQKLQDGEFIVQATKDCVAKTLKRLEEKIHGRVLNHLLYLMRVAEKGVQRRVALALAHLCSPDDQRTIFIDGGGLELLLGLLGSTNPKQQLDGAVALFKLANKAT**************QVYLGDQFVNNATLSDVTFLVEGRRFYAHRICLLASSDAFRAMFDGGYREKDARDIEIPNIRWEVFELMMRFIYTGSVDVTLDIAQDLLRAADQYLLEGLKRLCEYTIAQDISLENVSSMYELSEAFHAISLRHTCILYIMEHFDKLSTRPGHSNLIQRIIPEIHNYFAKAL**********
*********************************************************EVSAQVNVLNTTFSWLEADRAAAKRATHVLAELAKNEEVVNWIVEGGAVPALVKHLQAPPTSEADRNLKPFEHEVEKGSAFALGLLAVKPEHQQLIVDNGALSHLVNLLKRHMDSNCSRAVNSVIRRAADAITNLAHENSSIKTRVRMEGGIPPLVELLEFTDTKVQRAAAGALRTLAFKNDENKNQIVECNALPTLILMLRSEDSAIHYEAVGVIGNLVHSSPNIKKEVLAAGALQPVIGLLSSCCSESQREAALLLGQFAATDSDCKVHIVQRGAVRPLIEMLQSPDVQLREMSAFALGRLAQVITDMHNQAGIAHNGGLVPLLKLLDSKNGSLQHNAAFALYGLADNEDNVADFIRVGGVQKLQDGEFIVQATKDCVAKTLKRLEEKIHGRVLNHLLYLMRVAEKGVQRRVALALAHLCSPDDQRTIFIDGGGLELLLGLLGSTNPKQQLDGAVALFKLANKATTLSSVDAAPPSPTPQVYLGDQFVNNATLSDVTFLVEGRRFYAHRICLLASSDAFRAMFDGGYREKDARDIEIPNIRWEVFELMMRFIYTGSVDVTLDIAQDLLRAADQYLLEGLKRLCEYTIAQDISLENVSSMYELSEAFHAISLRHTCILYIMEHFDKLSTRPGHSNLIQRIIPEIHNYFAK************
***********************ETVIG************************QALLSEVSAQVNVLNTTFSWLEADRAAAKRATHVLAELAKNEEVVNWIVEGGAVPALVKHLQAPPTSEADRNLKPFEHEVEKGSAFALGLLAVKPEHQQLIVDNGALSHLVNLLKRHMDSNCSRAVNSVIRRAADAITNLAHENSSIKTRVRMEGGIPPLVELLEFTDTKVQRAAAGALRTLAFKNDENKNQIVECNALPTLILMLRSEDSAIHYEAVGVIGNLVHSSPNIKKEVLAAGALQPVIGLLSSCCSESQREAALLLGQFAATDSDCKVHIVQRGAVRPLIEMLQSPDVQLREMSAFALGRLAQVITDMHNQAGIAHNGGLVPLLKLLDSKNGSLQHNAAFALYGLADNEDNVADFIRVGGVQKLQDGEFIVQATKDCVAKTLKRLEEKIHGRVLNHLLYLMRVAEKGVQRRVALALAHLCSPDDQRTIFIDGGGLELLLGLLGSTNPKQQLDGAVALFKLANKATTLSSVDAAPPSPTPQVYLGDQFVNNATLSDVTFLVEGRRFYAHRICLLASSDAFRAMFDGGYREKDARDIEIPNIRWEVFELMMRFIYTGSVDVTLDIAQDLLRAADQYLLEGLKRLCEYTIAQDISLENVSSMYELSEAFHAISLRHTCILYIMEHFDKLSTRPGHSNLIQRIIPEIHNYFAKALTKPNPHNSRL
************************TVIGDEQQQMQQREISSSSAGTSSSDARQALLSEVSAQVNVLNTTFSWLEADRAAAKRATHVLAELAKNEEVVNWIVEGGAVPALVKHLQAPPTS****NLKPFEHEVEKGSAFALGLLAVKPEHQQLIVDNGALSHLVNLLKRHMDSNCSRAVNSVIRRAADAITNLAHENSSIKTRVRMEGGIPPLVELLEFTDTKVQRAAAGALRTLAFKNDENKNQIVECNALPTLILMLRSEDSAIHYEAVGVIGNLVHSSPNIKKEVLAAGALQPVIGLLSSCCSESQREAALLLGQFAATDSDCKVHIVQRGAVRPLIEMLQSPDVQLREMSAFALGRLAQVITDMHNQAGIAHNGGLVPLLKLLDSKNGSLQHNAAFALYGLADNEDNVADFIRVGGVQKLQDGEFIVQATKDCVAKTLKRLEEKIHGRVLNHLLYLMRVAEKGVQRRVALALAHLCSPDDQRTIFIDGGGLELLLGLLGSTNPKQQLDGAVALFKLANKATTLSSVDAAPPSPTPQVYLGDQFVNNATLSDVTFLVEGRRFYAHRICLLASSDAFRAMFDGGYREKDARDIEIPNIRWEVFELMMRFIYTGSVDVTLDIAQDLLRAADQYLLEGLKRLCEYTIAQDISLENVSSMYELSEAFHAISLRHTCILYIMEHFDKLSTRPGHSNLIQRIIPEIHNYFAKALTK********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDPQRRQGPSVPERKGQKRKLDEETVIGDEQQQMQQREISSSSAGTSSSDARQALLSEVSAQVNVLNTTFSWLEADRAAAKRATHVLAELAKNEEVVNWIVEGGAVPALVKHLQAPPTSEADRNLKPFEHEVEKGSAFALGLLAVKPEHQQLIVDNGALSHLVNLLKRHMDSNCSRAVNSVIRRAADAITNLAHENSSIKTRVRMEGGIPPLVELLEFTDTKVQRAAAGALRTLAFKNDENKNQIVECNALPTLILMLRSEDSAIHYEAVGVIGNLVHSSPNIKKEVLAAGALQPVIGLLSSCCSESQREAALLLGQFAATDSDCKVHIVQRGAVRPLIEMLQSPDVQLREMSAFALGRLAQVITDMHNQAGIAHNGGLVPLLKLLDSKNGSLQHNAAFALYGLADNEDNVADFIRVGGVQKLQDGEFIVQATKDCVAKTLKRLEEKIHGRVLNHLLYLMRVAEKGVQRRVALALAHLCSPDDQRTIFIDGGGLELLLGLLGSTNPKQQLDGAVALFKLANKATTLSSVDAAPPSPTPQVYLGDQFVNNATLSDVTFLVEGRRFYAHRICLLASSDAFRAMFDGGYREKDARDIEIPNIRWEVFELMMRFIYTGSVDVTLDIAQDLLRAADQYLLEGLKRLCEYTIAQDISLENVSSMYELSEAFHAISLRHTCILYIMEHFDKLSTRPGHSNLIQRIIPEIHNYFAKALTKPNPHNSRL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query720 2.2.26 [Sep-21-2011]
B9DHT4710 ARM REPEAT PROTEIN INTERA yes no 0.966 0.980 0.816 0.0
B7U179737 ARMADILLO BTB ARABIDOPSIS no no 0.909 0.888 0.625 0.0
P0CM60630 Vacuolar protein 8 OS=Cry yes no 0.487 0.557 0.287 2e-24
P0CM61630 Vacuolar protein 8 OS=Cry N/A no 0.487 0.557 0.287 2e-24
Q4WVW4578 Vacuolar protein 8 OS=Neo yes no 0.397 0.494 0.324 2e-22
Q4I1B1559 Vacuolar protein 8 OS=Gib yes no 0.491 0.633 0.309 3e-22
Q2U5T5578 Vacuolar protein 8 OS=Asp yes no 0.513 0.640 0.300 3e-22
Q6FJV1582 Vacuolar protein 8 OS=Can yes no 0.395 0.489 0.297 5e-20
O087641009 Ankyrin repeat and BTB/PO yes no 0.263 0.188 0.291 1e-19
Q7TQI71024 Ankyrin repeat and BTB/PO yes no 0.276 0.194 0.295 2e-19
>sp|B9DHT4|ARIA_ARATH ARM REPEAT PROTEIN INTERACTING WITH ABF2 OS=Arabidopsis thaliana GN=ARIA PE=1 SV=2 Back     alignment and function desciption
 Score = 1144 bits (2960), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 580/710 (81%), Positives = 641/710 (90%), Gaps = 14/710 (1%)

Query: 3   PQRRQGPSVPERKGQKRKLDEETVIGDEQQQMQQREISSSSAGTSSSDARQALLSEVSAQ 62
           P+RR+G S PERKGQKRKL+E          ++ REIS+ S     +D  QALLSEV+AQ
Sbjct: 5   PERREGRSFPERKGQKRKLEEGAA------AVEDREISAVS-----TDGGQALLSEVAAQ 53

Query: 63  VNVLNTTFSWLEADRAAAKRATHVLAELAKNEEVVNWIVEGGAVPALVKHLQAPPTSEAD 122
           V+VLN+ FSW E+DRAAAKRAT VLAELAKNE++VN IV+GGAVPAL+ HLQAPP ++ D
Sbjct: 54  VSVLNSAFSWQESDRAAAKRATQVLAELAKNEDLVNVIVDGGAVPALMTHLQAPPYNDGD 113

Query: 123 RNLKPFEHEVEKGSAFALGLLAVKPEHQQLIVDNGALSHLVNLLKRHMDSNCSRAVNSVI 182
              KP+EHEVEKGSAFALGLLA+KPE+Q+LIVD GAL HLVNLLKR+ D + SRAVNSVI
Sbjct: 114 LAEKPYEHEVEKGSAFALGLLAIKPEYQKLIVDKGALPHLVNLLKRNKDGSSSRAVNSVI 173

Query: 183 RRAADAITNLAHENSSIKTRVRMEGGIPPLVELLEFTDTKVQRAAAGALRTLAFKNDENK 242
           RRAADAITNLAHENSSIKTRVR+EGGIPPLVELLEF+D+KVQRAAAGALRTLAFKND+NK
Sbjct: 174 RRAADAITNLAHENSSIKTRVRVEGGIPPLVELLEFSDSKVQRAAAGALRTLAFKNDDNK 233

Query: 243 NQIVECNALPTLILMLRSEDSAIHYEAVGVIGNLVHSSPNIKKEVLAAGALQPVIGLLSS 302
           NQIVECNALPTLILML SED+AIHYEAVGVIGNLVHSSP+IKKEVL AGALQPVIGLLSS
Sbjct: 234 NQIVECNALPTLILMLGSEDAAIHYEAVGVIGNLVHSSPHIKKEVLTAGALQPVIGLLSS 293

Query: 303 CCSESQREAALLLGQFAATDSDCKVHIVQRGAVRPLIEMLQSPDVQLREMSAFALGRLAQ 362
           CC ESQREAALLLGQFA+TDSDCKVHIVQRGAVRPLIEMLQSPDVQL+EMSAFALGRLAQ
Sbjct: 294 CCPESQREAALLLGQFASTDSDCKVHIVQRGAVRPLIEMLQSPDVQLKEMSAFALGRLAQ 353

Query: 363 VITDMHNQAGIAHNGGLVPLLKLLDSKNGSLQHNAAFALYGLADNEDNVADFIRVGGVQK 422
              D HNQAGIAH+GGL PLLKLLDS+NGSLQHNAAFALYGLADNEDNV+DFIRVGG+QK
Sbjct: 354 ---DAHNQAGIAHSGGLGPLLKLLDSRNGSLQHNAAFALYGLADNEDNVSDFIRVGGIQK 410

Query: 423 LQDGEFIVQATKDCVAKTLKRLEEKIHGRVLNHLLYLMRVAEKGVQRRVALALAHLCSPD 482
           LQDGEFIVQATKDCV+KTLKRLEEKIHGRVL HLLYLMR++EK +QRRVALALAHLCSP+
Sbjct: 411 LQDGEFIVQATKDCVSKTLKRLEEKIHGRVLRHLLYLMRISEKSIQRRVALALAHLCSPE 470

Query: 483 DQRTIFIDGGGLELLLGLLGSTNPKQQLDGAVALFKLANKATTLSSVDAAPPSPTPQVYL 542
           DQRTIFID  GLELLLGLLGS N KQQLDGA AL+KLANK+  LS VDAAPPSPT +VYL
Sbjct: 471 DQRTIFIDDNGLELLLGLLGSLNTKQQLDGAAALYKLANKSMALSPVDAAPPSPTQRVYL 530

Query: 543 GDQFVNNATLSDVTFLVEGRRFYAHRICLLASSDAFRAMFDGGYREKDARDIEIPNIRWE 602
           G+Q+VNNATLSDVTFLVEGR FYAHRICLLASSDAFRAMFDGGYREKDARDIEIPNI+WE
Sbjct: 531 GEQYVNNATLSDVTFLVEGRTFYAHRICLLASSDAFRAMFDGGYREKDARDIEIPNIKWE 590

Query: 603 VFELMMRFIYTGSVDVTLDIAQDLLRAADQYLLEGLKRLCEYTIAQDISLENVSSMYELS 662
           VFELMMRFIYTGSVD+T +I++DLLRAADQYLLEGLKRLCEYTIAQDI+LE++  MYELS
Sbjct: 591 VFELMMRFIYTGSVDITNEISKDLLRAADQYLLEGLKRLCEYTIAQDITLESIGDMYELS 650

Query: 663 EAFHAISLRHTCILYIMEHFDKLSTRPGHSNLIQRIIPEIHNYFAKALTK 712
           EAFHA+SLR  CI++I+EHFDKLS+ P  + L+QR IPEI  YF +ALTK
Sbjct: 651 EAFHAMSLRQACIMFILEHFDKLSSMPWQNELVQRTIPEIREYFCRALTK 700




May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity). Acts as a positive regulator of ABA response via the modulation of the transcriptional activity of ABF2, a transcription factor which controls ABA-dependent gene expression via the G-box-type ABA-responsive elements. Negative regulator of seed germination and young seedling growth.
Arabidopsis thaliana (taxid: 3702)
>sp|B7U179|ABAP1_ARATH ARMADILLO BTB ARABIDOPSIS PROTEIN 1 OS=Arabidopsis thaliana GN=ABAP1 PE=1 SV=1 Back     alignment and function description
>sp|P0CM60|VAC8_CRYNJ Vacuolar protein 8 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=VAC8 PE=3 SV=1 Back     alignment and function description
>sp|P0CM61|VAC8_CRYNB Vacuolar protein 8 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=VAC8 PE=3 SV=1 Back     alignment and function description
>sp|Q4WVW4|VAC8_ASPFU Vacuolar protein 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=vac8 PE=3 SV=1 Back     alignment and function description
>sp|Q4I1B1|VAC8_GIBZE Vacuolar protein 8 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=VAC8 PE=3 SV=4 Back     alignment and function description
>sp|Q2U5T5|VAC8_ASPOR Vacuolar protein 8 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=vac8 PE=3 SV=1 Back     alignment and function description
>sp|Q6FJV1|VAC8_CANGA Vacuolar protein 8 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=VAC8 PE=3 SV=3 Back     alignment and function description
>sp|O08764|ABTB2_RAT Ankyrin repeat and BTB/POZ domain-containing protein 2 OS=Rattus norvegicus GN=Abtb2 PE=2 SV=1 Back     alignment and function description
>sp|Q7TQI7|ABTB2_MOUSE Ankyrin repeat and BTB/POZ domain-containing protein 2 OS=Mus musculus GN=Abtb2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query720
255552325719 protein binding protein, putative [Ricin 0.993 0.994 0.886 0.0
225432592705 PREDICTED: ARM REPEAT PROTEIN INTERACTIN 0.979 1.0 0.877 0.0
225432594711 PREDICTED: ARM REPEAT PROTEIN INTERACTIN 0.983 0.995 0.874 0.0
449432712703 PREDICTED: ARM REPEAT PROTEIN INTERACTIN 0.976 1.0 0.866 0.0
224102035720 predicted protein [Populus trichocarpa] 0.986 0.986 0.852 0.0
356536027707 PREDICTED: ARM REPEAT PROTEIN INTERACTIN 0.981 1.0 0.840 0.0
356497472706 PREDICTED: ARM REPEAT PROTEIN INTERACTIN 0.970 0.990 0.844 0.0
356575815707 PREDICTED: ARM REPEAT PROTEIN INTERACTIN 0.981 1.0 0.834 0.0
356541384708 PREDICTED: ARM REPEAT PROTEIN INTERACTIN 0.970 0.987 0.846 0.0
357444309704 Speckle-type POZ protein-like protein [M 0.975 0.997 0.831 0.0
>gi|255552325|ref|XP_002517207.1| protein binding protein, putative [Ricinus communis] gi|223543842|gb|EEF45370.1| protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1259 bits (3257), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 642/724 (88%), Positives = 673/724 (92%), Gaps = 9/724 (1%)

Query: 1   MDPQRRQGPSV--PERKGQKRKLDEETVIGDEQQQMQQREISSSSAGTSSSDARQALLSE 58
           M+PQR Q      PERKGQKRKL+EE     EQQ++     ++++A     DARQALL E
Sbjct: 1   MEPQRSQSKDQGRPERKGQKRKLEEEIED--EQQEISASATAAAAAAVPFGDARQALLYE 58

Query: 59  VSAQVNVLNTTFSWLEADRAAAKRATHVLAELAKNEEVVNWIVEGGAVPALVKHLQAPPT 118
           V++QVN+LN+TFSW EADRAAAKRA HVLAE AKNEE+VN IVEGGAVPALVKHLQAPP+
Sbjct: 59  VASQVNILNSTFSWNEADRAAAKRAIHVLAEFAKNEELVNVIVEGGAVPALVKHLQAPPS 118

Query: 119 S--EADRNLKPFEHEVEKGSAFALGLLAVKPEHQQLIVDNGALSHLVNLLKRHMDSNCSR 176
           S  E DR+ KPFEHEVEKGSAFALGLLAVKPEHQQLIVD GALSHLV LLKRH D + SR
Sbjct: 119 SSSEVDRSTKPFEHEVEKGSAFALGLLAVKPEHQQLIVDIGALSHLVELLKRHKDGSVSR 178

Query: 177 AVNSVIRRAADAITNLAHENSSIKTRVRMEGGIPPLVELLEFTDTKVQRAAAGALRTLAF 236
           AVNSVIRRAADAITNLAHENSSIKTRVR+EGGIPPLVELLEF DTKVQRAAAGALRTLAF
Sbjct: 179 AVNSVIRRAADAITNLAHENSSIKTRVRVEGGIPPLVELLEFVDTKVQRAAAGALRTLAF 238

Query: 237 KNDENKNQIVECNALPTLILMLRSEDSAIHYEAVGVIGNLVHSSPNIKKEVLAAGALQPV 296
           KNDENK QIVECNALPTLILMLRSED+AIHYEAVGVIGNLVHSSPNIKKEVLAAGALQPV
Sbjct: 239 KNDENKKQIVECNALPTLILMLRSEDAAIHYEAVGVIGNLVHSSPNIKKEVLAAGALQPV 298

Query: 297 IGLLSSCCSESQREAALLLGQFAATDSDCKVHIVQRGAVRPLIEMLQSPDVQLREMSAFA 356
           IGLLSSCCSESQREAALLLGQFAATDSDCKVHIVQRGAV+PLIEMLQSPDVQLREMSAFA
Sbjct: 299 IGLLSSCCSESQREAALLLGQFAATDSDCKVHIVQRGAVQPLIEMLQSPDVQLREMSAFA 358

Query: 357 LGRLAQVITDMHNQAGIAHNGGLVPLLKLLDSKNGSLQHNAAFALYGLADNEDNVADFIR 416
           LGRLAQ   D+HNQAGIAHNGGLVPLLKLLDSKNGSLQHNAAFALYGLADNEDNV+DFIR
Sbjct: 359 LGRLAQ---DLHNQAGIAHNGGLVPLLKLLDSKNGSLQHNAAFALYGLADNEDNVSDFIR 415

Query: 417 VGGVQKLQDGEFIVQATKDCVAKTLKRLEEKIHGRVLNHLLYLMRVAEKGVQRRVALALA 476
           VGGVQKLQDGEFIVQATKDCVAKTLKRLEEKIHGRVL+HLLYLMRV EK VQRRVALALA
Sbjct: 416 VGGVQKLQDGEFIVQATKDCVAKTLKRLEEKIHGRVLHHLLYLMRVTEKAVQRRVALALA 475

Query: 477 HLCSPDDQRTIFIDGGGLELLLGLLGSTNPKQQLDGAVALFKLANKATTLSSVDAAPPSP 536
           HLCSPDDQRTIFID  GLELLLGLLGST+PKQQLDGAVAL+KLANKA TLS VDAAPPSP
Sbjct: 476 HLCSPDDQRTIFIDNNGLELLLGLLGSTSPKQQLDGAVALYKLANKAATLSPVDAAPPSP 535

Query: 537 TPQVYLGDQFVNNATLSDVTFLVEGRRFYAHRICLLASSDAFRAMFDGGYREKDARDIEI 596
           TPQVYLG+QFVNNATLSDVTFLVEGRRFYAHRICLLASSDAFRAMFDGGYREKDARDIEI
Sbjct: 536 TPQVYLGEQFVNNATLSDVTFLVEGRRFYAHRICLLASSDAFRAMFDGGYREKDARDIEI 595

Query: 597 PNIRWEVFELMMRFIYTGSVDVTLDIAQDLLRAADQYLLEGLKRLCEYTIAQDISLENVS 656
           PNIRWEVFELMMRFIYTGSVDV+LDIAQDLLRAADQYLLEGLKRLCEYTIAQDISLENV+
Sbjct: 596 PNIRWEVFELMMRFIYTGSVDVSLDIAQDLLRAADQYLLEGLKRLCEYTIAQDISLENVA 655

Query: 657 SMYELSEAFHAISLRHTCILYIMEHFDKLSTRPGHSNLIQRIIPEIHNYFAKALTKPNPH 716
           SMYELSEAFHAISLRHTCIL+I+E FDKL+ +P HSNLIQRIIPEI NYFAKALTKPNPH
Sbjct: 656 SMYELSEAFHAISLRHTCILFILEQFDKLNAKPRHSNLIQRIIPEIRNYFAKALTKPNPH 715

Query: 717 NSRL 720
           NSRL
Sbjct: 716 NSRL 719




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225432592|ref|XP_002281388.1| PREDICTED: ARM REPEAT PROTEIN INTERACTING WITH ABF2 isoform 1 [Vitis vinifera] gi|297737016|emb|CBI26217.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225432594|ref|XP_002281401.1| PREDICTED: ARM REPEAT PROTEIN INTERACTING WITH ABF2 isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449432712|ref|XP_004134143.1| PREDICTED: ARM REPEAT PROTEIN INTERACTING WITH ABF2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224102035|ref|XP_002312519.1| predicted protein [Populus trichocarpa] gi|222852339|gb|EEE89886.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356536027|ref|XP_003536542.1| PREDICTED: ARM REPEAT PROTEIN INTERACTING WITH ABF2-like [Glycine max] Back     alignment and taxonomy information
>gi|356497472|ref|XP_003517584.1| PREDICTED: ARM REPEAT PROTEIN INTERACTING WITH ABF2-like [Glycine max] Back     alignment and taxonomy information
>gi|356575815|ref|XP_003556032.1| PREDICTED: ARM REPEAT PROTEIN INTERACTING WITH ABF2-like [Glycine max] Back     alignment and taxonomy information
>gi|356541384|ref|XP_003539157.1| PREDICTED: ARM REPEAT PROTEIN INTERACTING WITH ABF2-like [Glycine max] Back     alignment and taxonomy information
>gi|357444309|ref|XP_003592432.1| Speckle-type POZ protein-like protein [Medicago truncatula] gi|355481480|gb|AES62683.1| Speckle-type POZ protein-like protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query720
TAIR|locus:2150295710 ARIA "ARM repeat protein inter 0.966 0.980 0.8 1.7e-297
TAIR|locus:2179842737 ABAP1 "ARMADILLO BTB protein 1 0.909 0.888 0.616 1.3e-210
ASPGD|ASPL0000008980579 AN12408 [Emericella nidulans ( 0.486 0.604 0.305 3.8e-25
SGD|S000000739578 VAC8 "Phosphorylated and palmi 0.487 0.607 0.283 1.4e-23
CGD|CAL0001835585 VAC8 [Candida albicans (taxid: 0.475 0.584 0.297 4e-22
UNIPROTKB|Q59MN0585 VAC8 "Vacuolar protein 8" [Can 0.475 0.584 0.297 4e-22
POMBASE|SPBC354.14c550 vac8 "vacuolar protein Vac8 (p 0.479 0.627 0.284 7.1e-21
UNIPROTKB|E1BWB81025 E1BWB8 "Uncharacterized protei 0.211 0.148 0.354 1.1e-17
UNIPROTKB|F1SGS81025 ABTB2 "Uncharacterized protein 0.212 0.149 0.356 1.5e-17
MGI|MGI:21393651024 Abtb2 "ankyrin repeat and BTB 0.212 0.149 0.343 5.2e-17
TAIR|locus:2150295 ARIA "ARM repeat protein interacting with ABF2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2856 (1010.4 bits), Expect = 1.7e-297, P = 1.7e-297
 Identities = 568/710 (80%), Positives = 627/710 (88%)

Query:     3 PQRRQGPSVPERKGQKRKLDEETVIGDEQQQMQQREIXXXXXXXXXXDARQALLSEVSAQ 62
             P+RR+G S PERKGQKRKL+E          ++ REI          D  QALLSEV+AQ
Sbjct:     5 PERREGRSFPERKGQKRKLEEGAAA------VEDREISAVST-----DGGQALLSEVAAQ 53

Query:    63 VNVLNTTFSWLEADRAAAKRATHVLAELAKNEEVVNWIVEGGAVPALVKHLQAPPTSEAD 122
             V+VLN+ FSW E+DRAAAKRAT VLAELAKNE++VN IV+GGAVPAL+ HLQAPP ++ D
Sbjct:    54 VSVLNSAFSWQESDRAAAKRATQVLAELAKNEDLVNVIVDGGAVPALMTHLQAPPYNDGD 113

Query:   123 RNLKPFEHEVEKGSAFALGLLAVKPEHQQLIVDNGALSHLVNLLKRHMDSNCSRAVNSVI 182
                KP+EHEVEKGSAFALGLLA+KPE+Q+LIVD GAL HLVNLLKR+ D + SRAVNSVI
Sbjct:   114 LAEKPYEHEVEKGSAFALGLLAIKPEYQKLIVDKGALPHLVNLLKRNKDGSSSRAVNSVI 173

Query:   183 RRAADAITNLAHENSSIKTRVRMEGGIPPLVELLEFTDTKVQRAAAGALRTLAFKNDENK 242
             RRAADAITNLAHENSSIKTRVR+EGGIPPLVELLEF+D+KVQRAAAGALRTLAFKND+NK
Sbjct:   174 RRAADAITNLAHENSSIKTRVRVEGGIPPLVELLEFSDSKVQRAAAGALRTLAFKNDDNK 233

Query:   243 NQIVECNALPTLILMLRSEDSAIHYEAVGVIGNLVHSSPNIKKEVLAAGALQPVIGLLSS 302
             NQIVECNALPTLILML SED+AIHYEAVGVIGNLVHSSP+IKKEVL AGALQPVIGLLSS
Sbjct:   234 NQIVECNALPTLILMLGSEDAAIHYEAVGVIGNLVHSSPHIKKEVLTAGALQPVIGLLSS 293

Query:   303 CCSESQREAALLLGQFAATDSDCKVHIVQRGAVRPLIEMLQSPDVQLREMSAFALGRLAQ 362
             CC ESQREAALLLGQFA+TDSDCKVHIVQRGAVRPLIEMLQSPDVQL+EMSAFALGRLAQ
Sbjct:   294 CCPESQREAALLLGQFASTDSDCKVHIVQRGAVRPLIEMLQSPDVQLKEMSAFALGRLAQ 353

Query:   363 VITDMHNQAGIAHNGGLVPLLKLLDSKNGSLQHNAAFALYGLADNEDNVADFIRVGGVQK 422
                D HNQAGIAH+GGL PLLKLLDS+NGSLQHNAAFALYGLADNEDNV+DFIRVGG+QK
Sbjct:   354 ---DAHNQAGIAHSGGLGPLLKLLDSRNGSLQHNAAFALYGLADNEDNVSDFIRVGGIQK 410

Query:   423 LQDGEFIVQATKDCVAKTLKRLEEKIHGRVLNHLLYLMRVAEKGVQRRVALALAHLCSPD 482
             LQDGEFIVQATKDCV+KTLKRLEEKIHGRVL HLLYLMR++EK +QRRVALALAHLCSP+
Sbjct:   411 LQDGEFIVQATKDCVSKTLKRLEEKIHGRVLRHLLYLMRISEKSIQRRVALALAHLCSPE 470

Query:   483 DQRTIFIDXXXXXXXXXXXXSTNPKQQLDGAVALFKLANKATTLSSVDAAPPSPTPQVYL 542
             DQRTIFID            S N KQQLDGA AL+KLANK+  LS VDAAPPSPT +VYL
Sbjct:   471 DQRTIFIDDNGLELLLGLLGSLNTKQQLDGAAALYKLANKSMALSPVDAAPPSPTQRVYL 530

Query:   543 GDQFVNNATLSDVTFLVEGRRFYAHRICLLASSDAFRAMFDGGYREKDARDIEIPNIRWE 602
             G+Q+VNNATLSDVTFLVEGR FYAHRICLLASSDAFRAMFDGGYREKDARDIEIPNI+WE
Sbjct:   531 GEQYVNNATLSDVTFLVEGRTFYAHRICLLASSDAFRAMFDGGYREKDARDIEIPNIKWE 590

Query:   603 VFELMMRFIYTGSVDVTLDIAQDLLRAADQYLLEGLKRLCEYTIAQDISLENVSSMYELS 662
             VFELMMRFIYTGSVD+T +I++DLLRAADQYLLEGLKRLCEYTIAQDI+LE++  MYELS
Sbjct:   591 VFELMMRFIYTGSVDITNEISKDLLRAADQYLLEGLKRLCEYTIAQDITLESIGDMYELS 650

Query:   663 EAFHAISLRHTCILYIMEHFDKLSTRPGHSNLIQRIIPEIHNYFAKALTK 712
             EAFHA+SLR  CI++I+EHFDKLS+ P  + L+QR IPEI  YF +ALTK
Sbjct:   651 EAFHAMSLRQACIMFILEHFDKLSSMPWQNELVQRTIPEIREYFCRALTK 700




GO:0005634 "nucleus" evidence=ISM;IDA
GO:0005737 "cytoplasm" evidence=ISM
GO:0005515 "protein binding" evidence=IPI
GO:0005886 "plasma membrane" evidence=IDA
GO:0009651 "response to salt stress" evidence=IEP
GO:0009737 "response to abscisic acid stimulus" evidence=IEP;IMP
GO:0010187 "negative regulation of seed germination" evidence=IMP
GO:0000956 "nuclear-transcribed mRNA catabolic process" evidence=RCA
TAIR|locus:2179842 ABAP1 "ARMADILLO BTB protein 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000008980 AN12408 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
SGD|S000000739 VAC8 "Phosphorylated and palmitoylated vacuolar membrane protein" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
CGD|CAL0001835 VAC8 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q59MN0 VAC8 "Vacuolar protein 8" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
POMBASE|SPBC354.14c vac8 "vacuolar protein Vac8 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
UNIPROTKB|E1BWB8 E1BWB8 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1SGS8 ABTB2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:2139365 Abtb2 "ankyrin repeat and BTB (POZ) domain containing 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
B9DHT4ARIA_ARATHNo assigned EC number0.81690.96660.9802yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
gw1.VIII.810.1
hypothetical protein (656 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query720
pfam00651101 pfam00651, BTB, BTB/POZ domain 1e-25
smart0022597 smart00225, BTB, Broad-Complex, Tramtrack and Bric 4e-24
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 1e-21
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 2e-20
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 3e-15
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 2e-14
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 2e-13
PHA03098 534 PHA03098, PHA03098, kelch-like protein; Provisiona 2e-11
COG5064526 COG5064, SRP1, Karyopherin (importin) alpha [Intra 2e-10
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 4e-10
COG5064526 COG5064, SRP1, Karyopherin (importin) alpha [Intra 8e-09
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 1e-08
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 6e-08
COG5064526 COG5064, SRP1, Karyopherin (importin) alpha [Intra 7e-07
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 8e-07
smart0018541 smart00185, ARM, Armadillo/beta-catenin-like repea 1e-05
pfam0051441 pfam00514, Arm, Armadillo/beta-catenin-like repeat 1e-05
COG1413335 COG1413, COG1413, FOG: HEAT repeat [Energy product 1e-05
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 3e-05
smart0018541 smart00185, ARM, Armadillo/beta-catenin-like repea 3e-05
pfam0051441 pfam00514, Arm, Armadillo/beta-catenin-like repeat 4e-05
pfam01602522 pfam01602, Adaptin_N, Adaptin N terminal region 4e-05
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 5e-05
COG5064526 COG5064, SRP1, Karyopherin (importin) alpha [Intra 7e-05
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 8e-05
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 1e-04
pfam0051441 pfam00514, Arm, Armadillo/beta-catenin-like repeat 0.001
smart0018541 smart00185, ARM, Armadillo/beta-catenin-like repea 0.002
pfam0051441 pfam00514, Arm, Armadillo/beta-catenin-like repeat 0.002
>gnl|CDD|216043 pfam00651, BTB, BTB/POZ domain Back     alignment and domain information
 Score =  100 bits (252), Expect = 1e-25
 Identities = 35/103 (33%), Positives = 54/103 (52%), Gaps = 5/103 (4%)

Query: 542 LGDQFVNNATLSDVTFLVEGRRFYAHRICLLASSDAFRAMFDGGYREKDARDIEIPNIRW 601
           L +    N  L DVT +V  + F+AH+  L A S  F+A+F G    +    I + ++  
Sbjct: 1   LNELR-ENGELCDVTLVVGDKEFHAHKAVLAACSPYFKALFTGNKEVE----ITLEDVSP 55

Query: 602 EVFELMMRFIYTGSVDVTLDIAQDLLRAADQYLLEGLKRLCEY 644
           E FE ++ FIYTG +++T +   DLL  AD+  +  L   CE 
Sbjct: 56  EDFEALLEFIYTGKLEITEENVDDLLALADKLQIPALIDKCEE 98


The BTB (for BR-C, ttk and bab) or POZ (for Pox virus and Zinc finger) domain is present near the N-terminus of a fraction of zinc finger (pfam00096) proteins and in proteins that contain the pfam01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT. The POZ or BTB domain is also known as BR-C/Ttk or ZiN. Length = 101

>gnl|CDD|197585 smart00225, BTB, Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|227396 COG5064, SRP1, Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|227396 COG5064, SRP1, Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|227396 COG5064, SRP1, Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|214547 smart00185, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat Back     alignment and domain information
>gnl|CDD|224331 COG1413, COG1413, FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|214547 smart00185, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat Back     alignment and domain information
>gnl|CDD|216598 pfam01602, Adaptin_N, Adaptin N terminal region Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|227396 COG5064, SRP1, Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat Back     alignment and domain information
>gnl|CDD|214547 smart00185, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 720
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 100.0
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 100.0
KOG0166514 consensus Karyopherin (importin) alpha [Intracellu 100.0
KOG0166514 consensus Karyopherin (importin) alpha [Intracellu 100.0
COG5064526 SRP1 Karyopherin (importin) alpha [Intracellular t 100.0
COG5064526 SRP1 Karyopherin (importin) alpha [Intracellular t 100.0
KOG4224550 consensus Armadillo repeat protein VAC8 required f 100.0
KOG4224550 consensus Armadillo repeat protein VAC8 required f 100.0
PHA02713 557 hypothetical protein; Provisional 99.93
PF05804708 KAP: Kinesin-associated protein (KAP) 99.93
KOG4441 571 consensus Proteins containing BTB/POZ and Kelch do 99.92
PHA02790 480 Kelch-like protein; Provisional 99.92
PHA03098 534 kelch-like protein; Provisional 99.92
PF05804708 KAP: Kinesin-associated protein (KAP) 99.91
KOG4350 620 consensus Uncharacterized conserved protein, conta 99.9
KOG4199461 consensus Uncharacterized conserved protein [Funct 99.87
KOG4500604 consensus Rho/Rac GTPase guanine nucleotide exchan 99.82
KOG4591280 consensus Uncharacterized conserved protein, conta 99.8
KOG2122 2195 consensus Beta-catenin-binding protein APC, contai 99.79
KOG2075 521 consensus Topoisomerase TOP1-interacting protein B 99.76
KOG1048717 consensus Neural adherens junction protein Plakoph 99.76
KOG2122 2195 consensus Beta-catenin-binding protein APC, contai 99.75
KOG1048717 consensus Neural adherens junction protein Plakoph 99.75
PF00651111 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB ( 99.73
KOG4199461 consensus Uncharacterized conserved protein [Funct 99.72
PF10508503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 99.71
KOG0783 1267 consensus Uncharacterized conserved protein, conta 99.71
KOG4682 488 consensus Uncharacterized conserved protein, conta 99.71
PF10508503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 99.69
KOG0211759 consensus Protein phosphatase 2A regulatory subuni 99.68
KOG4500604 consensus Rho/Rac GTPase guanine nucleotide exchan 99.61
smart0022590 BTB Broad-Complex, Tramtrack and Bric a brac. Doma 99.6
KOG1222791 consensus Kinesin associated protein KAP [Intracel 99.57
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 99.57
KOG1222791 consensus Kinesin associated protein KAP [Intracel 99.56
PRK09687280 putative lyase; Provisional 99.54
KOG2171 1075 consensus Karyopherin (importin) beta 3 [Nuclear s 99.54
PRK09687280 putative lyase; Provisional 99.51
KOG1293678 consensus Proteins containing armadillo/beta-caten 99.5
KOG2171 1075 consensus Karyopherin (importin) beta 3 [Nuclear s 99.5
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 99.49
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 99.48
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 99.46
KOG2023 885 consensus Nuclear transport receptor Karyopherin-b 99.39
KOG2023885 consensus Nuclear transport receptor Karyopherin-b 99.37
KOG0168 1051 consensus Putative ubiquitin fusion degradation pr 99.33
cd00256429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 99.32
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 99.32
PF01602526 Adaptin_N: Adaptin N terminal region; InterPro: IP 99.3
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 99.3
PF01602526 Adaptin_N: Adaptin N terminal region; InterPro: IP 99.29
cd00256429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 99.28
KOG2160342 consensus Armadillo/beta-catenin-like repeat-conta 99.22
KOG1241 859 consensus Karyopherin (importin) beta 1 [Nuclear s 99.19
PTZ00429 746 beta-adaptin; Provisional 99.15
KOG1241859 consensus Karyopherin (importin) beta 1 [Nuclear s 99.12
KOG1293678 consensus Proteins containing armadillo/beta-caten 99.12
PTZ00429 746 beta-adaptin; Provisional 99.08
KOG0946 970 consensus ER-Golgi vesicle-tethering protein p115 99.05
KOG0168 1051 consensus Putative ubiquitin fusion degradation pr 99.0
KOG2160342 consensus Armadillo/beta-catenin-like repeat-conta 98.99
KOG3678 832 consensus SARM protein (with sterile alpha and arm 98.99
KOG2759442 consensus Vacuolar H+-ATPase V1 sector, subunit H 98.98
KOG2759442 consensus Vacuolar H+-ATPase V1 sector, subunit H 98.98
KOG0946 970 consensus ER-Golgi vesicle-tethering protein p115 98.96
KOG0511516 consensus Ankyrin repeat protein [General function 98.89
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 98.89
KOG0211759 consensus Protein phosphatase 2A regulatory subuni 98.88
KOG0212675 consensus Uncharacterized conserved protein [Funct 98.87
KOG1062 866 consensus Vesicle coat complex AP-1, gamma subunit 98.86
KOG1517 1387 consensus Guanine nucleotide binding protein MIP1 98.85
COG5215858 KAP95 Karyopherin (importin) beta [Intracellular t 98.84
KOG3678832 consensus SARM protein (with sterile alpha and arm 98.84
KOG0212675 consensus Uncharacterized conserved protein [Funct 98.81
KOG4413524 consensus 26S proteasome regulatory complex, subun 98.8
KOG02131172 consensus Splicing factor 3b, subunit 1 [RNA proce 98.78
KOG1242569 consensus Protein containing adaptin N-terminal re 98.77
KOG18241233 consensus TATA-binding protein-interacting protein 98.76
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 98.73
KOG2973353 consensus Uncharacterized conserved protein [Funct 98.73
COG5215858 KAP95 Karyopherin (importin) beta [Intracellular t 98.71
KOG4413524 consensus 26S proteasome regulatory complex, subun 98.68
KOG1059877 consensus Vesicle coat complex AP-3, delta subunit 98.6
TIGR02270410 conserved hypothetical protein. Members are found 98.59
KOG1242569 consensus Protein containing adaptin N-terminal re 98.53
KOG1517 1387 consensus Guanine nucleotide binding protein MIP1 98.51
KOG02131172 consensus Splicing factor 3b, subunit 1 [RNA proce 98.5
KOG1060 968 consensus Vesicle coat complex AP-3, beta subunit 98.47
PF05536543 Neurochondrin: Neurochondrin 98.45
KOG2973353 consensus Uncharacterized conserved protein [Funct 98.44
PF14664371 RICTOR_N: Rapamycin-insensitive companion of mTOR, 98.43
KOG1824 1233 consensus TATA-binding protein-interacting protein 98.43
KOG1059 877 consensus Vesicle coat complex AP-3, delta subunit 98.42
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 98.41
KOG1062 866 consensus Vesicle coat complex AP-1, gamma subunit 98.4
TIGR02270410 conserved hypothetical protein. Members are found 98.31
KOG1061 734 consensus Vesicle coat complex AP-1/AP-2/AP-4, bet 98.31
COG5181975 HSH155 U2 snRNP spliceosome subunit [RNA processin 98.31
COG5240 898 SEC21 Vesicle coat complex COPI, gamma subunit [In 98.28
KOG4646173 consensus Uncharacterized conserved protein, conta 98.28
COG5369743 Uncharacterized conserved protein [Function unknow 98.25
KOG2838401 consensus Uncharacterized conserved protein, conta 98.22
COG5369743 Uncharacterized conserved protein [Function unknow 98.2
KOG4646173 consensus Uncharacterized conserved protein, conta 98.17
PF05536543 Neurochondrin: Neurochondrin 98.17
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.16
KOG2734536 consensus Uncharacterized conserved protein [Funct 98.14
PF14664371 RICTOR_N: Rapamycin-insensitive companion of mTOR, 98.09
COG5181975 HSH155 U2 snRNP spliceosome subunit [RNA processin 98.08
COG1413335 FOG: HEAT repeat [Energy production and conversion 98.06
KOG1060 968 consensus Vesicle coat complex AP-3, beta subunit 98.06
KOG2259 823 consensus Uncharacterized conserved protein [Funct 98.06
KOG2734536 consensus Uncharacterized conserved protein [Funct 98.05
COG5240 898 SEC21 Vesicle coat complex COPI, gamma subunit [In 98.05
KOG1061734 consensus Vesicle coat complex AP-1/AP-2/AP-4, bet 98.05
COG1413335 FOG: HEAT repeat [Energy production and conversion 98.05
KOG17892235 consensus Endocytosis protein RME-8, contains DnaJ 98.01
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 98.0
KOG17892235 consensus Endocytosis protein RME-8, contains DnaJ 97.96
KOG2259823 consensus Uncharacterized conserved protein [Funct 97.94
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 97.93
KOG0915 1702 consensus Uncharacterized conserved protein [Funct 97.9
PF10165446 Ric8: Guanine nucleotide exchange factor synembryn 97.9
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 97.89
KOG2716230 consensus Polymerase delta-interacting protein PDI 97.89
KOG1077 938 consensus Vesicle coat complex AP-2, alpha subunit 97.88
PF10165446 Ric8: Guanine nucleotide exchange factor synembryn 97.8
COG5231432 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Ene 97.79
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 97.77
KOG1943 1133 consensus Beta-tubulin folding cofactor D [Posttra 97.74
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 97.7
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 97.68
KOG1077 938 consensus Vesicle coat complex AP-2, alpha subunit 97.65
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 97.65
KOG09151702 consensus Uncharacterized conserved protein [Funct 97.65
KOG0567289 consensus HEAT repeat-containing protein [General 97.65
KOG1943 1133 consensus Beta-tubulin folding cofactor D [Posttra 97.63
KOG4535728 consensus HEAT and armadillo repeat-containing pro 97.61
COG5096 757 Vesicle coat complex, various subunits [Intracellu 97.6
PF0221494 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassi 97.58
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 97.52
KOG2838401 consensus Uncharacterized conserved protein, conta 97.49
KOG1987297 consensus Speckle-type POZ protein SPOP and relate 97.46
PF09759102 Atx10homo_assoc: Spinocerebellar ataxia type 10 pr 97.46
COG5231432 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Ene 97.46
PF07707103 BACK: BTB And C-terminal Kelch; InterPro: IPR01170 97.45
KOG1078 865 consensus Vesicle coat complex COPI, gamma subunit 97.41
KOG0567289 consensus HEAT repeat-containing protein [General 97.39
KOG19911010 consensus Nuclear transport receptor RANBP7/RANBP8 97.37
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 97.35
PF09759102 Atx10homo_assoc: Spinocerebellar ataxia type 10 pr 97.35
PF08569335 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like pro 97.25
COG5096 757 Vesicle coat complex, various subunits [Intracellu 97.24
KOG3473112 consensus RNA polymerase II transcription elongati 97.24
PRK14707 2710 hypothetical protein; Provisional 97.22
KOG2032533 consensus Uncharacterized conserved protein [Funct 97.15
PF08569335 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like pro 97.11
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 97.1
KOG3036293 consensus Protein involved in cell differentiation 97.09
KOG1020 1692 consensus Sister chromatid cohesion protein SCC2/N 97.04
KOG1078865 consensus Vesicle coat complex COPI, gamma subunit 97.03
PRK14707 2710 hypothetical protein; Provisional 97.0
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 96.98
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 96.97
KOG4151748 consensus Myosin assembly protein/sexual cycle pro 96.83
KOG1058 948 consensus Vesicle coat complex COPI, beta subunit 96.82
PF07814361 WAPL: Wings apart-like protein regulation of heter 96.82
PF11841160 DUF3361: Domain of unknown function (DUF3361) 96.79
KOG12481176 consensus Uncharacterized conserved protein [Funct 96.79
smart00875101 BACK BTB And C-terminal Kelch. The BACK domain is 96.77
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 96.73
KOG4151748 consensus Myosin assembly protein/sexual cycle pro 96.7
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 96.68
PF11822 317 DUF3342: Domain of unknown function (DUF3342); Int 96.64
smart00512104 Skp1 Found in Skp1 protein family. Family of Skp1 96.62
PF11841160 DUF3361: Domain of unknown function (DUF3361) 96.61
PF13764802 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 96.61
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 96.6
KOG0511 516 consensus Ankyrin repeat protein [General function 96.55
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 96.51
PF04078262 Rcd1: Cell differentiation family, Rcd1-like ; Int 96.46
KOG4535728 consensus HEAT and armadillo repeat-containing pro 96.46
PF04078262 Rcd1: Cell differentiation family, Rcd1-like ; Int 96.45
COG5656970 SXM1 Importin, protein involved in nuclear import 96.4
KOG1724162 consensus SCF ubiquitin ligase, Skp1 component [Po 96.4
KOG19911010 consensus Nuclear transport receptor RANBP7/RANBP8 96.36
PF06025379 DUF913: Domain of Unknown Function (DUF913); Inter 96.32
PF05918556 API5: Apoptosis inhibitory protein 5 (API5); Inter 96.31
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 96.29
KOG2062929 consensus 26S proteasome regulatory complex, subun 96.23
KOG1058 948 consensus Vesicle coat complex COPI, beta subunit 96.22
PF07814361 WAPL: Wings apart-like protein regulation of heter 96.18
PF11698119 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 96.16
KOG1832 1516 consensus HIV-1 Vpr-binding protein [Cell cycle co 96.14
PF06025379 DUF913: Domain of Unknown Function (DUF913); Inter 96.14
KOG2062929 consensus 26S proteasome regulatory complex, subun 96.14
KOG1020 1692 consensus Sister chromatid cohesion protein SCC2/N 96.1
PF05004309 IFRD: Interferon-related developmental regulator ( 96.02
KOG1566342 consensus Conserved protein Mo25 [Function unknown 95.94
KOG3036293 consensus Protein involved in cell differentiation 95.92
KOG12481176 consensus Uncharacterized conserved protein [Funct 95.9
KOG22741005 consensus Predicted importin 9 [Intracellular traf 95.89
PF08045257 CDC14: Cell division control protein 14, SIN compo 95.87
KOG1832 1516 consensus HIV-1 Vpr-binding protein [Cell cycle co 95.8
PF05004309 IFRD: Interferon-related developmental regulator ( 95.76
KOG1665 302 consensus AFH1-interacting protein FIP2, contains 95.72
KOG1243690 consensus Protein kinase [General function predict 95.71
KOG22741005 consensus Predicted importin 9 [Intracellular traf 95.69
PF12719298 Cnd3: Nuclear condensing complex subunits, C-term 95.69
PF11698119 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 95.66
KOG19671030 consensus DNA repair/transcription protein Mms19 [ 95.65
KOG2999713 consensus Regulator of Rac1, required for phagocyt 95.57
KOG19671030 consensus DNA repair/transcription protein Mms19 [ 95.53
PF08045257 CDC14: Cell division control protein 14, SIN compo 95.51
PF13764802 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 95.45
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 95.45
KOG2714 465 consensus SETA binding protein SB1 and related pro 95.44
PF0393162 Skp1_POZ: Skp1 family, tetramerisation domain; Int 95.43
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 95.41
KOG1243690 consensus Protein kinase [General function predict 95.41
KOG2032533 consensus Uncharacterized conserved protein [Funct 95.38
KOG4653982 consensus Uncharacterized conserved protein [Funct 95.35
PF12719298 Cnd3: Nuclear condensing complex subunits, C-term 95.27
PF05918556 API5: Apoptosis inhibitory protein 5 (API5); Inter 95.17
KOG2025 892 consensus Chromosome condensation complex Condensi 95.14
KOG04141251 consensus Chromosome condensation complex Condensi 95.02
KOG4464532 consensus Signaling protein RIC-8/synembryn (regul 94.78
KOG2137700 consensus Protein kinase [Signal transduction mech 94.74
KOG1566342 consensus Conserved protein Mo25 [Function unknown 94.72
COG5218 885 YCG1 Chromosome condensation complex Condensin, su 94.58
KOG4653982 consensus Uncharacterized conserved protein [Funct 94.52
KOG2956516 consensus CLIP-associating protein [General functi 94.5
KOG04141251 consensus Chromosome condensation complex Condensi 94.46
PF11701157 UNC45-central: Myosin-binding striated muscle asse 94.38
PF11701157 UNC45-central: Myosin-binding striated muscle asse 94.33
COG5116926 RPN2 26S proteasome regulatory complex component [ 94.21
KOG1992960 consensus Nuclear export receptor CSE1/CAS (import 94.2
PF1466873 RICTOR_V: Rapamycin-insensitive companion of mTOR, 94.2
KOG2025 892 consensus Chromosome condensation complex Condensi 94.2
KOG1820815 consensus Microtubule-associated protein [Cytoskel 94.14
KOG2956516 consensus CLIP-associating protein [General functi 93.91
KOG2137700 consensus Protein kinase [Signal transduction mech 93.89
KOG1820 815 consensus Microtubule-associated protein [Cytoskel 93.76
KOG2715210 consensus Uncharacterized conserved protein, conta 93.72
PF04063192 DUF383: Domain of unknown function (DUF383); Inter 93.3
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 92.98
KOG2999713 consensus Regulator of Rac1, required for phagocyt 92.83
PF08506370 Cse1: Cse1; InterPro: IPR013713 The exchange of ma 92.61
COG5218 885 YCG1 Chromosome condensation complex Condensin, su 92.45
PF04063192 DUF383: Domain of unknown function (DUF383); Inter 92.18
COG5116926 RPN2 26S proteasome regulatory complex component [ 92.18
KOG1778 319 consensus CREB binding protein/P300 and related TA 92.1
COG5656970 SXM1 Importin, protein involved in nuclear import 91.83
COG50981128 Chromosome condensation complex Condensin, subunit 91.77
COG5201158 SKP1 SCF ubiquitin ligase, SKP1 component [Posttra 91.6
PF12231372 Rif1_N: Rap1-interacting factor 1 N terminal; Inte 91.41
KOG0413 1529 consensus Uncharacterized conserved protein relate 90.91
COG5209315 RCD1 Uncharacterized protein involved in cell diff 90.72
KOG2933334 consensus Uncharacterized conserved protein [Funct 90.57
PF1466873 RICTOR_V: Rapamycin-insensitive companion of mTOR, 89.99
PF12530234 DUF3730: Protein of unknown function (DUF3730) ; I 89.98
KOG4464532 consensus Signaling protein RIC-8/synembryn (regul 89.82
PF14500262 MMS19_N: Dos2-interacting transcription regulator 89.77
PF14500262 MMS19_N: Dos2-interacting transcription regulator 89.71
PF11864464 DUF3384: Domain of unknown function (DUF3384); Int 89.68
KOG1788 2799 consensus Uncharacterized conserved protein [Funct 89.68
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 89.38
PF11707330 Npa1: Ribosome 60S biogenesis N-terminal; InterPro 89.36
PF0146678 Skp1: Skp1 family, dimerisation domain; InterPro: 89.25
PF12231372 Rif1_N: Rap1-interacting factor 1 N terminal; Inte 89.11
KOG1525 1266 consensus Sister chromatid cohesion complex Cohesi 89.06
PF08167165 RIX1: rRNA processing/ribosome biogenesis 88.33
PF06371187 Drf_GBD: Diaphanous GTPase-binding Domain; InterPr 88.31
PF12031257 DUF3518: Domain of unknown function (DUF3518); Int 88.22
COG5209315 RCD1 Uncharacterized protein involved in cell diff 88.22
KOG1949 1005 consensus Uncharacterized conserved protein [Funct 88.18
PRK09169 2316 hypothetical protein; Validated 88.1
PF08506370 Cse1: Cse1; InterPro: IPR013713 The exchange of ma 87.82
PF1036392 DUF2435: Protein of unknown function (DUF2435) 87.65
KOG1949 1005 consensus Uncharacterized conserved protein [Funct 87.53
PF12530234 DUF3730: Protein of unknown function (DUF3730) ; I 87.13
PF1036392 DUF2435: Protein of unknown function (DUF2435) 87.01
smart00638574 LPD_N Lipoprotein N-terminal Domain. 86.83
KOG2611698 consensus Neurochondrin/leucine-rich protein (Neur 86.05
smart00638574 LPD_N Lipoprotein N-terminal Domain. 85.98
PF06371187 Drf_GBD: Diaphanous GTPase-binding Domain; InterPr 85.97
KOG2933334 consensus Uncharacterized conserved protein [Funct 85.45
PF01347618 Vitellogenin_N: Lipoprotein amino terminal region; 84.71
PF13251182 DUF4042: Domain of unknown function (DUF4042) 83.94
PF01347618 Vitellogenin_N: Lipoprotein amino terminal region; 83.77
PF12031257 DUF3518: Domain of unknown function (DUF3518); Int 83.56
PF11865160 DUF3385: Domain of unknown function (DUF3385); Int 82.39
PF11865160 DUF3385: Domain of unknown function (DUF3385); Int 81.68
PF11864464 DUF3384: Domain of unknown function (DUF3384); Int 81.48
PF14225262 MOR2-PAG1_C: Cell morphogenesis C-terminal 81.48
KOG2011 1048 consensus Sister chromatid cohesion complex Cohesi 80.32
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.8e-36  Score=349.49  Aligned_cols=450  Identities=21%  Similarity=0.218  Sum_probs=366.1

Q ss_pred             HHHHHHHHHHhhccccchHHhHHHHHHHHHHHHHHccC-hhhHHHHHhCCChHHHHHhhcCCCCcccccCCCcchHHHHH
Q 004992           56 LSEVSAQVNVLNTTFSWLEADRAAAKRATHVLAELAKN-EEVVNWIVEGGAVPALVKHLQAPPTSEADRNLKPFEHEVEK  134 (720)
Q Consensus        56 ~~~i~~ll~~L~~~l~~~~~d~~~~~~a~~~L~~l~~~-~~~~~~~~~~g~i~~L~~ll~~~~~~~~~~~~~~~~~~v~~  134 (720)
                      .+.+|.+++.|.+.      ++..+..|+++|.+++.+ ++.+..+++.|+||.|+++|++.+.           +.+|+
T Consensus       188 aGaVp~LV~LLsS~------d~~lQ~eAa~aLa~Lass~ee~~~aVIeaGaVP~LV~LL~sg~~-----------~~VRE  250 (2102)
T PLN03200        188 AGGVDILVKLLSSG------NSDAQANAASLLARLMMAFESSISKVLDAGAVKQLLKLLGQGNE-----------VSVRA  250 (2102)
T ss_pred             cCCHHHHHHHHcCC------CHHHHHHHHHHHHHHHcCChHHHHHHHHCCCHHHHHHHHccCCC-----------hHHHH
Confidence            45788888888654      566899999999888875 7889999999999999999976433           18999


Q ss_pred             HHHHHHHHhc-cChhhHHHHHHcCChHHHHHHHhccCCCcc-chhhhHHHHHHHHHHHHhhhcCch-----------h--
Q 004992          135 GSAFALGLLA-VKPEHQQLIVDNGALSHLVNLLKRHMDSNC-SRAVNSVIRRAADAITNLAHENSS-----------I--  199 (720)
Q Consensus       135 ~a~~~L~~L~-~~~~~~~~~~~~~~l~~L~~lL~~~~~~~~-~~~~~~v~~~a~~~L~~l~~~~~~-----------~--  199 (720)
                      .|+|+|.+|+ ++++++..+++.|+++.|+.++..+..... ......+++.|+|+|.|+|.+...           .  
T Consensus       251 ~AA~AL~nLAs~s~e~r~~Iv~aGgIp~LI~lL~sp~~e~~~~~~~~~Lqe~AvwALsNIcgg~~~ll~~L~~ll~s~rd  330 (2102)
T PLN03200        251 EAAGALEALSSQSKEAKQAIADAGGIPALINATVAPSKEFMQGEFAQALQENAMGALANICGGMSALILYLGELSESPRS  330 (2102)
T ss_pred             HHHHHHHHHhcCCHHHHHHHHHCCCHHHHHHHHhCcchhhhccccchHHHHHHHHHHHHHhCCchhhHHHHHHhhcccch
Confidence            9999999999 789999999999999999999985442110 000115688888888888863111           0  


Q ss_pred             ------------------------------------------------------------------hHHHHhcCCcHHHH
Q 004992          200 ------------------------------------------------------------------KTRVRMEGGIPPLV  213 (720)
Q Consensus       200 ------------------------------------------------------------------~~~~~~~~~i~~L~  213 (720)
                                                                                        +..+.+.++++.|+
T Consensus       331 ~~~~ada~gALayll~l~d~~~~~~~~i~~~~v~~~LV~Llr~k~p~~vqe~V~eALasl~gN~~l~~~L~~~daik~LV  410 (2102)
T PLN03200        331 PAPIADTLGALAYALMVFDSSAESTRAFDPTVIEQILVKLLKPRDTKLVQERIIEALASLYGNAYLSRKLNHAEAKKVLV  410 (2102)
T ss_pred             HHHHHHHHhhHHHHHHhcCCchhhhhhccccccHHHHHHHhCCCCCchhHHHHHHHHHHhcCChHHHHHHHhccchhhhh
Confidence                                                                              00112234455556


Q ss_pred             HhhcCCCHHHHHHHHHHHHHhccCChhcHHHHHhCCCHHHHHHhhcCCCHHHHHHHHHHHHHhhcCCcchHHHHHHcCCh
Q 004992          214 ELLEFTDTKVQRAAAGALRTLAFKNDENKNQIVECNALPTLILMLRSEDSAIHYEAVGVIGNLVHSSPNIKKEVLAAGAL  293 (720)
Q Consensus       214 ~ll~~~~~~v~~~a~~~L~~L~~~~~~~~~~i~~~g~l~~L~~ll~~~~~~v~~~a~~~L~nL~~~~~~~~~~~~~~~~l  293 (720)
                      .++...+.+++..++++|++++.++.+.++.+.+.|++|.|+.+|.+++..+++.++++|+|++..++..+..+++.|++
T Consensus       411 ~LL~~~~~evQ~~Av~aL~~L~~~~~e~~~aIi~~ggIp~LV~LL~s~s~~iQ~~A~~~L~nLa~~ndenr~aIieaGaI  490 (2102)
T PLN03200        411 GLITMATADVQEELIRALSSLCCGKGGLWEALGGREGVQLLISLLGLSSEQQQEYAVALLAILTDEVDESKWAITAAGGI  490 (2102)
T ss_pred             hhhccCCHHHHHHHHHHHHHHhCCCHHHHHHHHHcCcHHHHHHHHcCCCHHHHHHHHHHHHHHHcCCHHHHHHHHHCCCH
Confidence            66666677899999999999998888999999999999999999999999999999999999998888888999999999


Q ss_pred             HHHHHhhccCChHHHHHHHHHHHHHhccCcchhhHHHhcCChHHHHHHhcCCCHHHHHHHHHHHHHHhhhhcCcc-----
Q 004992          294 QPVIGLLSSCCSESQREAALLLGQFAATDSDCKVHIVQRGAVRPLIEMLQSPDVQLREMSAFALGRLAQVITDMH-----  368 (720)
Q Consensus       294 ~~L~~ll~~~~~~~~~~a~~~L~~l~~~~~~~~~~~~~~~~~~~L~~ll~~~~~~v~~~a~~~L~~l~~~~~~~~-----  368 (720)
                      |.|+++|.+++..++++|+|+|.|++..+++.+..+.+.|+++.|+++|+++++.+++.|+++|.+++..+ +.+     
T Consensus       491 P~LV~LL~s~~~~iqeeAawAL~NLa~~~~qir~iV~~aGAIppLV~LL~sgd~~~q~~Aa~AL~nLi~~~-d~~~I~~L  569 (2102)
T PLN03200        491 PPLVQLLETGSQKAKEDSATVLWNLCCHSEDIRACVESAGAVPALLWLLKNGGPKGQEIAAKTLTKLVRTA-DAATISQL  569 (2102)
T ss_pred             HHHHHHHcCCCHHHHHHHHHHHHHHhCCcHHHHHHHHHCCCHHHHHHHHhCCCHHHHHHHHHHHHHHHhcc-chhHHHHH
Confidence            99999999999999999999999999755455555667899999999999999999999999999997511 100     


Q ss_pred             ---------------------------h----hhhhhhcCCHHHHHHHhcCCChhHHHHHHHHHHhccc-CCCchhHHHh
Q 004992          369 ---------------------------N----QAGIAHNGGLVPLLKLLDSKNGSLQHNAAFALYGLAD-NEDNVADFIR  416 (720)
Q Consensus       369 ---------------------------~----~~~l~~~~~i~~l~~ll~~~~~~v~~~a~~~L~~l~~-~~~~~~~l~~  416 (720)
                                                 .    .......|+++.|++++.+++..+++.|+++|.+++. +++....++.
T Consensus       570 v~LLlsdd~~~~~~aL~vLgnIlsl~~~~d~~~~g~~~~ggL~~Lv~LL~sgs~~ikk~Aa~iLsnL~a~~~d~~~avv~  649 (2102)
T PLN03200        570 TALLLGDLPESKVHVLDVLGHVLSVASLEDLVREGSAANDALRTLIQLLSSSKEETQEKAASVLADIFSSRQDLCESLAT  649 (2102)
T ss_pred             HHHhcCCChhHHHHHHHHHHHHHhhcchhHHHHHhhhccccHHHHHHHHcCCCHHHHHHHHHHHHHHhcCChHHHHHHHH
Confidence                                       0    0011246899999999999999999999999999976 4556778999


Q ss_pred             hcccccccchhh----hhhhhHHHHHHHHH------HHHHhhhhhhHHHHHHHHHhcchhHHHHHHHHHHhhcCCcccch
Q 004992          417 VGGVQKLQDGEF----IVQATKDCVAKTLK------RLEEKIHGRVLNHLLYLMRVAEKGVQRRVALALAHLCSPDDQRT  486 (720)
Q Consensus       417 ~~~v~~L~~~~~----~~~~~~~~~~~~~~------~l~~~~~~~~~~~L~~ll~~~~~~v~~~a~~~L~~l~~~~~~~~  486 (720)
                      .|++++|.....    .......+...++.      +....+..+.+++|++++++++.+++..|+.+|.+++.+.+...
T Consensus       650 agaIpPLV~LLss~~~~v~keAA~AL~nL~~~~~~~q~~~~v~~GaV~pL~~LL~~~d~~v~e~Al~ALanLl~~~e~~~  729 (2102)
T PLN03200        650 DEIINPCIKLLTNNTEAVATQSARALAALSRSIKENRKVSYAAEDAIKPLIKLAKSSSIEVAEQAVCALANLLSDPEVAA  729 (2102)
T ss_pred             cCCHHHHHHHHhcCChHHHHHHHHHHHHHHhCCCHHHHHHHHHcCCHHHHHHHHhCCChHHHHHHHHHHHHHHcCchHHH
Confidence            999999877333    33333333333332      22334678999999999999999999999999999999999888


Q ss_pred             hhhccCcHHHHHHhhcCCCchhhhhHHHHHHHHHhhc
Q 004992          487 IFIDGGGLELLLGLLGSTNPKQQLDGAVALFKLANKA  523 (720)
Q Consensus       487 ~~~~~~~~~~L~~ll~~~~~~v~~~a~~aL~~L~~~~  523 (720)
                      .+...|+++.|+.++++++++.|+.|+++|.+|+++.
T Consensus       730 ei~~~~~I~~Lv~lLr~G~~~~k~~Aa~AL~~L~~~~  766 (2102)
T PLN03200        730 EALAEDIILPLTRVLREGTLEGKRNAARALAQLLKHF  766 (2102)
T ss_pred             HHHhcCcHHHHHHHHHhCChHHHHHHHHHHHHHHhCC
Confidence            8889999999999999999999999999999999754



>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>KOG4350 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>KOG4199 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms] Back     alignment and domain information
>KOG4591 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG2075 consensus Topoisomerase TOP1-interacting protein BTBD1 [Function unknown] Back     alignment and domain information
>KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>PF00651 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB (for BR-C, ttk and bab) [] or POZ (for Pox virus and Zinc finger) [] domain is present near the N terminus of a fraction of zinc finger (IPR007087 from INTERPRO) proteins and in proteins that contain the IPR006652 from INTERPRO motif such as Kelch and a family of pox virus proteins Back     alignment and domain information
>KOG4199 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG4682 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>KOG0211 consensus Protein phosphatase 2A regulatory subunit A and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms] Back     alignment and domain information
>smart00225 BTB Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information
>KOG1222 consensus Kinesin associated protein KAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>KOG1222 consensus Kinesin associated protein KAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] Back     alignment and domain information
>KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>KOG2023 consensus Nuclear transport receptor Karyopherin-beta2/Transportin (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2023 consensus Nuclear transport receptor Karyopherin-beta2/Transportin (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1241 consensus Karyopherin (importin) beta 1 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>KOG1241 consensus Karyopherin (importin) beta 1 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures] Back     alignment and domain information
>KOG2759 consensus Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>KOG2759 consensus Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG0211 consensus Protein phosphatase 2A regulatory subunit A and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0212 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1062 consensus Vesicle coat complex AP-1, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures] Back     alignment and domain information
>KOG0212 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4413 consensus 26S proteasome regulatory complex, subunit PSMD5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0213 consensus Splicing factor 3b, subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG1242 consensus Protein containing adaptin N-terminal region [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1824 consensus TATA-binding protein-interacting protein [General function prediction only] Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG2973 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4413 consensus 26S proteasome regulatory complex, subunit PSMD5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1059 consensus Vesicle coat complex AP-3, delta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>KOG1242 consensus Protein containing adaptin N-terminal region [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0213 consensus Splicing factor 3b, subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG1060 consensus Vesicle coat complex AP-3, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>KOG2973 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Back     alignment and domain information
>KOG1824 consensus TATA-binding protein-interacting protein [General function prediction only] Back     alignment and domain information
>KOG1059 consensus Vesicle coat complex AP-3, delta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG1062 consensus Vesicle coat complex AP-1, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>KOG1061 consensus Vesicle coat complex AP-1/AP-2/AP-4, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4646 consensus Uncharacterized conserved protein, contains ARM repeats [Function unknown] Back     alignment and domain information
>COG5369 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2838 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>COG5369 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4646 consensus Uncharacterized conserved protein, contains ARM repeats [Function unknown] Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG2734 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>KOG1060 consensus Vesicle coat complex AP-3, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2259 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2734 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1061 consensus Vesicle coat complex AP-1/AP-2/AP-4, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2259 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG0915 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10165 Ric8: Guanine nucleotide exchange factor synembryn; InterPro: IPR019318 Ric8 is involved in the EGL-30 neurotransmitter signalling pathway [] Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>KOG2716 consensus Polymerase delta-interacting protein PDIP1 and related proteins, contain BTB/POZ domain [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1077 consensus Vesicle coat complex AP-2, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10165 Ric8: Guanine nucleotide exchange factor synembryn; InterPro: IPR019318 Ric8 is involved in the EGL-30 neurotransmitter signalling pathway [] Back     alignment and domain information
>COG5231 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>KOG1943 consensus Beta-tubulin folding cofactor D [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>KOG1077 consensus Vesicle coat complex AP-2, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>KOG0915 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0567 consensus HEAT repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1943 consensus Beta-tubulin folding cofactor D [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4535 consensus HEAT and armadillo repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>PF02214 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassium channels are the most diverse group of the ion channel family [, ] Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>KOG2838 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>KOG1987 consensus Speckle-type POZ protein SPOP and related proteins with TRAF, MATH and BTB/POZ domains [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 Back     alignment and domain information
>COG5231 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>PF07707 BACK: BTB And C-terminal Kelch; InterPro: IPR011705 This domain is found associated with (IPR000210 from INTERPRO) and (IPR006652 from INTERPRO) Back     alignment and domain information
>KOG1078 consensus Vesicle coat complex COPI, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0567 consensus HEAT repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1991 consensus Nuclear transport receptor RANBP7/RANBP8 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 Back     alignment and domain information
>PF08569 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like proteins are involved in both polarised growth and cytokinesis Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3473 consensus RNA polymerase II transcription elongation factor Elongin/SIII, subunit elongin C [Transcription] Back     alignment and domain information
>PRK14707 hypothetical protein; Provisional Back     alignment and domain information
>KOG2032 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08569 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like proteins are involved in both polarised growth and cytokinesis Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>KOG3036 consensus Protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>KOG1020 consensus Sister chromatid cohesion protein SCC2/Nipped-B [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>KOG1078 consensus Vesicle coat complex COPI, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK14707 hypothetical protein; Provisional Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1058 consensus Vesicle coat complex COPI, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07814 WAPL: Wings apart-like protein regulation of heterochromatin; InterPro: IPR022771 This entry contains sequences expressed in eukaryotic organisms (metazoa, fungi, plants) bearing high similarity to the WAPL conserved region of D Back     alignment and domain information
>PF11841 DUF3361: Domain of unknown function (DUF3361) Back     alignment and domain information
>KOG1248 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00875 BACK BTB And C-terminal Kelch Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>PF11822 DUF3342: Domain of unknown function (DUF3342); InterPro: IPR021777 This family of proteins are functionally uncharacterised Back     alignment and domain information
>smart00512 Skp1 Found in Skp1 protein family Back     alignment and domain information
>PF11841 DUF3361: Domain of unknown function (DUF3361) Back     alignment and domain information
>PF13764 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>PF04078 Rcd1: Cell differentiation family, Rcd1-like ; InterPro: IPR007216 Rcd1 (Required cell differentiation 1) -like proteins are found among a wide range of organisms [] Back     alignment and domain information
>KOG4535 consensus HEAT and armadillo repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF04078 Rcd1: Cell differentiation family, Rcd1-like ; InterPro: IPR007216 Rcd1 (Required cell differentiation 1) -like proteins are found among a wide range of organisms [] Back     alignment and domain information
>COG5656 SXM1 Importin, protein involved in nuclear import [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1724 consensus SCF ubiquitin ligase, Skp1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1991 consensus Nuclear transport receptor RANBP7/RANBP8 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF06025 DUF913: Domain of Unknown Function (DUF913); InterPro: IPR010314 This is a domain of unknown function found towards the N terminus of a family of E3 ubiquitin protein ligases, including yeast TOM1, many of which appear to play a role in mRNA transcription and processing Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>KOG2062 consensus 26S proteasome regulatory complex, subunit RPN2/PSMD1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1058 consensus Vesicle coat complex COPI, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07814 WAPL: Wings apart-like protein regulation of heterochromatin; InterPro: IPR022771 This entry contains sequences expressed in eukaryotic organisms (metazoa, fungi, plants) bearing high similarity to the WAPL conserved region of D Back     alignment and domain information
>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF06025 DUF913: Domain of Unknown Function (DUF913); InterPro: IPR010314 This is a domain of unknown function found towards the N terminus of a family of E3 ubiquitin protein ligases, including yeast TOM1, many of which appear to play a role in mRNA transcription and processing Back     alignment and domain information
>KOG2062 consensus 26S proteasome regulatory complex, subunit RPN2/PSMD1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1020 consensus Sister chromatid cohesion protein SCC2/Nipped-B [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>KOG1566 consensus Conserved protein Mo25 [Function unknown] Back     alignment and domain information
>KOG3036 consensus Protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>KOG1248 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2274 consensus Predicted importin 9 [Intracellular trafficking, secretion, and vesicular transport; Nuclear structure] Back     alignment and domain information
>PF08045 CDC14: Cell division control protein 14, SIN component; InterPro: IPR012535 Cdc14 is a component of the septation initiation network (SIN) and is required for the localisation and activity of Sid1 Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>KOG1665 consensus AFH1-interacting protein FIP2, contains BTB/POZ domain and pentapeptide repeats [General function prediction only] Back     alignment and domain information
>KOG1243 consensus Protein kinase [General function prediction only] Back     alignment and domain information
>KOG2274 consensus Predicted importin 9 [Intracellular trafficking, secretion, and vesicular transport; Nuclear structure] Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG1967 consensus DNA repair/transcription protein Mms19 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>KOG2999 consensus Regulator of Rac1, required for phagocytosis and cell migration [Signal transduction mechanisms] Back     alignment and domain information
>KOG1967 consensus DNA repair/transcription protein Mms19 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>PF08045 CDC14: Cell division control protein 14, SIN component; InterPro: IPR012535 Cdc14 is a component of the septation initiation network (SIN) and is required for the localisation and activity of Sid1 Back     alignment and domain information
>PF13764 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>KOG2714 consensus SETA binding protein SB1 and related proteins, contain BTB/POZ domain [General function prediction only] Back     alignment and domain information
>PF03931 Skp1_POZ: Skp1 family, tetramerisation domain; InterPro: IPR016073 SKP1 (together with SKP2) was identified as an essential component of the cyclin A-CDK2 S phase kinase complex [] Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>KOG1243 consensus Protein kinase [General function prediction only] Back     alignment and domain information
>KOG2032 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4653 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information
>KOG2025 consensus Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0414 consensus Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4464 consensus Signaling protein RIC-8/synembryn (regulates neurotransmitter secretion) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2137 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1566 consensus Conserved protein Mo25 [Function unknown] Back     alignment and domain information
>COG5218 YCG1 Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG4653 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2956 consensus CLIP-associating protein [General function prediction only] Back     alignment and domain information
>KOG0414 consensus Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle Back     alignment and domain information
>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle Back     alignment and domain information
>COG5116 RPN2 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1992 consensus Nuclear export receptor CSE1/CAS (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14668 RICTOR_V: Rapamycin-insensitive companion of mTOR, domain 5 Back     alignment and domain information
>KOG2025 consensus Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1820 consensus Microtubule-associated protein [Cytoskeleton] Back     alignment and domain information
>KOG2956 consensus CLIP-associating protein [General function prediction only] Back     alignment and domain information
>KOG2137 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1820 consensus Microtubule-associated protein [Cytoskeleton] Back     alignment and domain information
>KOG2715 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>PF04063 DUF383: Domain of unknown function (DUF383); InterPro: IPR007205 This is a protein of unknown function Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2999 consensus Regulator of Rac1, required for phagocytosis and cell migration [Signal transduction mechanisms] Back     alignment and domain information
>PF08506 Cse1: Cse1; InterPro: IPR013713 The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane Back     alignment and domain information
>COG5218 YCG1 Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>PF04063 DUF383: Domain of unknown function (DUF383); InterPro: IPR007205 This is a protein of unknown function Back     alignment and domain information
>COG5116 RPN2 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1778 consensus CREB binding protein/P300 and related TAZ Zn-finger proteins [Transcription] Back     alignment and domain information
>COG5656 SXM1 Importin, protein involved in nuclear import [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5098 Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>COG5201 SKP1 SCF ubiquitin ligase, SKP1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12231 Rif1_N: Rap1-interacting factor 1 N terminal; InterPro: IPR022031 This domain family is found in eukaryotes, and is typically between 135 and 146 amino acids in length Back     alignment and domain information
>KOG0413 consensus Uncharacterized conserved protein related to condensin complex subunit 1 [Function unknown] Back     alignment and domain information
>COG5209 RCD1 Uncharacterized protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>KOG2933 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14668 RICTOR_V: Rapamycin-insensitive companion of mTOR, domain 5 Back     alignment and domain information
>PF12530 DUF3730: Protein of unknown function (DUF3730) ; InterPro: IPR022542 This domain is found in eukaryotes, and is typically between 220 and 262 amino acids in length Back     alignment and domain information
>KOG4464 consensus Signaling protein RIC-8/synembryn (regulates neurotransmitter secretion) [Signal transduction mechanisms] Back     alignment and domain information
>PF14500 MMS19_N: Dos2-interacting transcription regulator of RNA-Pol-II Back     alignment and domain information
>PF14500 MMS19_N: Dos2-interacting transcription regulator of RNA-Pol-II Back     alignment and domain information
>PF11864 DUF3384: Domain of unknown function (DUF3384); InterPro: IPR024584 This entry represents the N-terminal domain of tuberin which is functionally uncharacterised Back     alignment and domain information
>KOG1788 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF11707 Npa1: Ribosome 60S biogenesis N-terminal; InterPro: IPR021714 Npa1p is required for ribosome biogenesis and operates in the same functional environment as Rsa3p and Dbp6p during early maturation of 60S ribosomal subunits [] Back     alignment and domain information
>PF01466 Skp1: Skp1 family, dimerisation domain; InterPro: IPR016072 SKP1 (together with SKP2) was identified as an essential component of the cyclin A-CDK2 S phase kinase complex [] Back     alignment and domain information
>PF12231 Rif1_N: Rap1-interacting factor 1 N terminal; InterPro: IPR022031 This domain family is found in eukaryotes, and is typically between 135 and 146 amino acids in length Back     alignment and domain information
>KOG1525 consensus Sister chromatid cohesion complex Cohesin, subunit PDS5 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF08167 RIX1: rRNA processing/ribosome biogenesis Back     alignment and domain information
>PF06371 Drf_GBD: Diaphanous GTPase-binding Domain; InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division [] Back     alignment and domain information
>PF12031 DUF3518: Domain of unknown function (DUF3518); InterPro: IPR021906 This presumed domain is functionally uncharacterised Back     alignment and domain information
>COG5209 RCD1 Uncharacterized protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>KOG1949 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK09169 hypothetical protein; Validated Back     alignment and domain information
>PF08506 Cse1: Cse1; InterPro: IPR013713 The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane Back     alignment and domain information
>PF10363 DUF2435: Protein of unknown function (DUF2435) Back     alignment and domain information
>KOG1949 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12530 DUF3730: Protein of unknown function (DUF3730) ; InterPro: IPR022542 This domain is found in eukaryotes, and is typically between 220 and 262 amino acids in length Back     alignment and domain information
>PF10363 DUF2435: Protein of unknown function (DUF2435) Back     alignment and domain information
>smart00638 LPD_N Lipoprotein N-terminal Domain Back     alignment and domain information
>KOG2611 consensus Neurochondrin/leucine-rich protein (Neurochondrin) [Function unknown] Back     alignment and domain information
>smart00638 LPD_N Lipoprotein N-terminal Domain Back     alignment and domain information
>PF06371 Drf_GBD: Diaphanous GTPase-binding Domain; InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division [] Back     alignment and domain information
>KOG2933 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF01347 Vitellogenin_N: Lipoprotein amino terminal region; InterPro: IPR001747 This entry represents a conserved region found in several lipid transport proteins, including vitellogenin, microsomal triglyceride transfer protein and apolipoprotein B-100 [] Back     alignment and domain information
>PF13251 DUF4042: Domain of unknown function (DUF4042) Back     alignment and domain information
>PF01347 Vitellogenin_N: Lipoprotein amino terminal region; InterPro: IPR001747 This entry represents a conserved region found in several lipid transport proteins, including vitellogenin, microsomal triglyceride transfer protein and apolipoprotein B-100 [] Back     alignment and domain information
>PF12031 DUF3518: Domain of unknown function (DUF3518); InterPro: IPR021906 This presumed domain is functionally uncharacterised Back     alignment and domain information
>PF11865 DUF3385: Domain of unknown function (DUF3385); InterPro: IPR024585 This uncharacterised domain is is typically between 160 to 172 amino acids in length Back     alignment and domain information
>PF11865 DUF3385: Domain of unknown function (DUF3385); InterPro: IPR024585 This uncharacterised domain is is typically between 160 to 172 amino acids in length Back     alignment and domain information
>PF11864 DUF3384: Domain of unknown function (DUF3384); InterPro: IPR024584 This entry represents the N-terminal domain of tuberin which is functionally uncharacterised Back     alignment and domain information
>PF14225 MOR2-PAG1_C: Cell morphogenesis C-terminal Back     alignment and domain information
>KOG2011 consensus Sister chromatid cohesion complex Cohesin, subunit STAG/IRR1/SCC3 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query720
4hxt_A252 Crystal Structure Of Engineered Protein. Northeast 4e-19
4hxt_A252 Crystal Structure Of Engineered Protein. Northeast 1e-09
3hqi_A312 Structures Of Spop-Substrate Complexes: Insights In 2e-17
4eoz_A145 Crystal Structure Of The Spop Btb Domain Complexed 3e-17
1ial_A453 Importin Alpha, Mouse Length = 453 1e-14
1ial_A453 Importin Alpha, Mouse Length = 453 4e-06
2c1m_A424 Nup50:importin-Alpha Complex Length = 424 2e-14
2c1m_A424 Nup50:importin-Alpha Complex Length = 424 5e-06
4ba3_A496 Mimp_alphadibb_a89nls Length = 496 2e-14
4ba3_A496 Mimp_alphadibb_a89nls Length = 496 4e-06
2ynr_A461 Mimp_alphadibb_b54nls Length = 461 2e-14
2ynr_A461 Mimp_alphadibb_b54nls Length = 461 5e-06
3ukw_B510 Mouse Importin Alpha: Bimax1 Peptide Complex Length 2e-14
3ukw_B510 Mouse Importin Alpha: Bimax1 Peptide Complex Length 4e-06
3tpm_A422 Crystal Structure Of Mal Rpel Domain In Complex Wit 2e-14
3tpm_A422 Crystal Structure Of Mal Rpel Domain In Complex Wit 5e-06
4htv_A509 Mouse Importin Alpha: Bfdv Cap Nls Peptide Complex 2e-14
4htv_A509 Mouse Importin Alpha: Bfdv Cap Nls Peptide Complex 5e-06
1q1s_C466 Mouse Importin Alpha- Phosphorylated Sv40 Cn Peptid 2e-14
1q1s_C466 Mouse Importin Alpha- Phosphorylated Sv40 Cn Peptid 4e-06
1ejl_I460 Mouse Importin Alpha-Sv40 Large T Antigen Nls Pepti 2e-14
1ejl_I460 Mouse Importin Alpha-Sv40 Large T Antigen Nls Pepti 4e-06
3ve6_A426 Crystal Structure Analysis Of Venezuelan Equine Enc 2e-14
3ve6_A426 Crystal Structure Analysis Of Venezuelan Equine Enc 5e-06
3l3q_A427 Mouse Importin Alpha-Peptm Nls Peptide Complex Leng 2e-14
3l3q_A427 Mouse Importin Alpha-Peptm Nls Peptide Complex Leng 5e-06
3tpo_A529 Crystal Structure Of D192aE396A MUTANT OF MOUSE IMP 2e-14
3tpo_A529 Crystal Structure Of D192aE396A MUTANT OF MOUSE IMP 3e-06
3btr_C427 Ar-Nls:importin-Alpha Complex Length = 427 2e-14
3btr_C427 Ar-Nls:importin-Alpha Complex Length = 427 5e-06
3rz9_A510 Mouse Importin Alpha-Ku80 Nls Peptide Complex Lengt 2e-14
3rz9_A510 Mouse Importin Alpha-Ku80 Nls Peptide Complex Lengt 4e-06
1y2a_C428 Structure Of Mammalian Importin Bound To The Non-Cl 2e-14
1y2a_C428 Structure Of Mammalian Importin Bound To The Non-Cl 6e-06
3fex_C467 Crystal Structure Of The Cbc-Importin Alpha Complex 5e-13
3fex_C467 Crystal Structure Of The Cbc-Importin Alpha Complex 8e-07
4db8_A252 Designed Armadillo-Repeat Protein Length = 252 5e-12
4db8_A252 Designed Armadillo-Repeat Protein Length = 252 6e-12
2yns_A490 Rimp_alpha_b54nls Length = 490 5e-11
2yns_A490 Rimp_alpha_b54nls Length = 490 4e-07
4b8j_A528 Rimp_alpha1a Length = 528 7e-11
4b8j_A528 Rimp_alpha1a Length = 528 5e-07
3htm_A172 Structures Of Spop-Substrate Complexes: Insights In 2e-10
4db6_A210 Designed Armadillo Repeat Protein (Yiiim3aii) Lengt 3e-10
4db6_A210 Designed Armadillo Repeat Protein (Yiiim3aii) Lengt 3e-09
4db9_A210 Designed Armadillo Repeat Protein (Yiiim3aiii) Leng 4e-10
4db9_A210 Designed Armadillo Repeat Protein (Yiiim3aiii) Leng 3e-09
4dba_A210 Designed Armadillo Repeat Protein (Yiim3aii) Length 4e-09
4dba_A210 Designed Armadillo Repeat Protein (Yiim3aii) Length 1e-08
3l6x_A584 Crystal Structure Of P120 Catenin In Complex With E 3e-08
2c1t_A454 Structure Of The Kap60p:nup2 Complex Length = 454 1e-07
2c1t_A454 Structure Of The Kap60p:nup2 Complex Length = 454 2e-05
1un0_A443 Crystal Structure Of Yeast Karyopherin (Importin) A 1e-07
1un0_A443 Crystal Structure Of Yeast Karyopherin (Importin) A 2e-05
1ee5_A424 Yeast Karyopherin (Importin) Alpha In A Complex Wit 2e-07
1ee5_A424 Yeast Karyopherin (Importin) Alpha In A Complex Wit 2e-05
1ee4_A423 Crystal Structure Of Yeast Karyopherin (Importin) A 2e-07
1ee4_A423 Crystal Structure Of Yeast Karyopherin (Importin) A 2e-05
3tj3_A447 Structure Of Importin A5 Bound To The N-Terminus Of 2e-07
2jdq_A450 C-Terminal Domain Of Influenza A Virus Polymerase P 2e-07
1xm9_A457 Structure Of The Armadillo Repeat Domain Of Plakoph 2e-07
4ap2_A297 Crystal Structure Of The Human Klhl11-cul3 Complex 1e-06
2nn2_A133 Crystal Structure Of The Btb Domain From The LrfZBT 4e-06
2if5_A120 Structure Of The Poz Domain Of Human Lrf, A Master 4e-06
3i3n_A279 Crystal Structure Of The Btb-Back Domains Of Human 4e-06
1wa5_B530 Crystal Structure Of The Exportin Cse1p Complexed W 6e-06
1bk5_A422 Karyopherin Alpha From Saccharomyces Cerevisiae Len 8e-06
1bk5_A422 Karyopherin Alpha From Saccharomyces Cerevisiae Len 2e-05
1bk6_A422 Karyopherin Alpha (Yeast) + Sv40 T Antigen Nls Leng 9e-06
1bk6_A422 Karyopherin Alpha (Yeast) + Sv40 T Antigen Nls Leng 2e-05
3tt9_A233 Crystal Structure Of The Stable Degradation Fragmen 2e-05
2z6g_A780 Crystal Structure Of A Full-Length Zebrafish Beta-C 5e-05
1cs3_A116 Structure Of BtbPOZ TRANSCRIPTION REPRESSION DOMAIN 3e-04
1buo_A121 Btb Domain From Plzf Length = 121 3e-04
2z6h_A644 Crystal Structure Of Beta-Catenin Armadillo Repeat 4e-04
3m8v_A124 Crystal Structure Of The Btb Domain From KaisoZBTB3 6e-04
2gl7_A550 Crystal Structure Of A Beta-CateninBCL9TCF4 COMPLEX 8e-04
1i7x_A538 Beta-CateninE-Cadherin Complex Length = 538 8e-04
>pdb|4HXT|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or329 Length = 252 Back     alignment and structure

Iteration: 1

Score = 93.6 bits (231), Expect = 4e-19, Method: Compositional matrix adjust. Identities = 70/205 (34%), Positives = 106/205 (51%), Gaps = 3/205 (1%) Query: 197 SSIKTRVRMEGGIPPLVELLEFTDTKVQRAAAGALRTLAFKNDENKNQIVECNALPTLIL 256 S+IK V GG+ LV+LL TD++VQ+ AA AL +A DE IV+ + L+ Sbjct: 35 SAIKAIVDA-GGVEVLVKLLTSTDSEVQKEAARALANIASGPDEAIKAIVDAGGVEVLVK 93 Query: 257 MLRSEDSAIHYEAVGVIGNLVHSSPNIKKEVLAAGALQPVIGLLSSCCSESQREAALLLG 316 +L S DS + EA + N+ K ++ AG ++ ++ LL+S SE Q+EAA L Sbjct: 94 LLTSTDSEVQKEAARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALA 153 Query: 317 QFAATDSDCKVHIVQRGAVRPLIEMLQSPDVQLREMSAFALGRLAQVITDMHNQAGIAHN 376 A+ + IV G V L+++L S D ++++ +A AL +A T I Sbjct: 154 NIASGPDEAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPTSAIK--AIVDA 211 Query: 377 GGLVPLLKLLDSKNGSLQHNAAFAL 401 GG+ L KLL S + +Q A AL Sbjct: 212 GGVEVLQKLLTSTDSEVQKEAQRAL 236
>pdb|4HXT|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or329 Length = 252 Back     alignment and structure
>pdb|3HQI|A Chain A, Structures Of Spop-Substrate Complexes: Insights Into Molecular Architectures Of Btb-Cul3 Ubiquitin Ligases: SpopmathxBTB3-Box-Pucsbc1 Length = 312 Back     alignment and structure
>pdb|4EOZ|A Chain A, Crystal Structure Of The Spop Btb Domain Complexed With The Cul3 N- Terminal Domain Length = 145 Back     alignment and structure
>pdb|1IAL|A Chain A, Importin Alpha, Mouse Length = 453 Back     alignment and structure
>pdb|1IAL|A Chain A, Importin Alpha, Mouse Length = 453 Back     alignment and structure
>pdb|2C1M|A Chain A, Nup50:importin-Alpha Complex Length = 424 Back     alignment and structure
>pdb|2C1M|A Chain A, Nup50:importin-Alpha Complex Length = 424 Back     alignment and structure
>pdb|4BA3|A Chain A, Mimp_alphadibb_a89nls Length = 496 Back     alignment and structure
>pdb|4BA3|A Chain A, Mimp_alphadibb_a89nls Length = 496 Back     alignment and structure
>pdb|2YNR|A Chain A, Mimp_alphadibb_b54nls Length = 461 Back     alignment and structure
>pdb|2YNR|A Chain A, Mimp_alphadibb_b54nls Length = 461 Back     alignment and structure
>pdb|3UKW|B Chain B, Mouse Importin Alpha: Bimax1 Peptide Complex Length = 510 Back     alignment and structure
>pdb|3UKW|B Chain B, Mouse Importin Alpha: Bimax1 Peptide Complex Length = 510 Back     alignment and structure
>pdb|3TPM|A Chain A, Crystal Structure Of Mal Rpel Domain In Complex With Importin-Alpha Length = 422 Back     alignment and structure
>pdb|3TPM|A Chain A, Crystal Structure Of Mal Rpel Domain In Complex With Importin-Alpha Length = 422 Back     alignment and structure
>pdb|4HTV|A Chain A, Mouse Importin Alpha: Bfdv Cap Nls Peptide Complex Length = 509 Back     alignment and structure
>pdb|4HTV|A Chain A, Mouse Importin Alpha: Bfdv Cap Nls Peptide Complex Length = 509 Back     alignment and structure
>pdb|1Q1S|C Chain C, Mouse Importin Alpha- Phosphorylated Sv40 Cn Peptide Complex Length = 466 Back     alignment and structure
>pdb|1Q1S|C Chain C, Mouse Importin Alpha- Phosphorylated Sv40 Cn Peptide Complex Length = 466 Back     alignment and structure
>pdb|1EJL|I Chain I, Mouse Importin Alpha-Sv40 Large T Antigen Nls Peptide Complex Length = 460 Back     alignment and structure
>pdb|1EJL|I Chain I, Mouse Importin Alpha-Sv40 Large T Antigen Nls Peptide Complex Length = 460 Back     alignment and structure
>pdb|3VE6|A Chain A, Crystal Structure Analysis Of Venezuelan Equine Encephalitis Virus Capsid Protein Nls And Importin Alpha Length = 426 Back     alignment and structure
>pdb|3VE6|A Chain A, Crystal Structure Analysis Of Venezuelan Equine Encephalitis Virus Capsid Protein Nls And Importin Alpha Length = 426 Back     alignment and structure
>pdb|3L3Q|A Chain A, Mouse Importin Alpha-Peptm Nls Peptide Complex Length = 427 Back     alignment and structure
>pdb|3L3Q|A Chain A, Mouse Importin Alpha-Peptm Nls Peptide Complex Length = 427 Back     alignment and structure
>pdb|3TPO|A Chain A, Crystal Structure Of D192aE396A MUTANT OF MOUSE IMPORTIN ALPHA2 Length = 529 Back     alignment and structure
>pdb|3TPO|A Chain A, Crystal Structure Of D192aE396A MUTANT OF MOUSE IMPORTIN ALPHA2 Length = 529 Back     alignment and structure
>pdb|3BTR|C Chain C, Ar-Nls:importin-Alpha Complex Length = 427 Back     alignment and structure
>pdb|3BTR|C Chain C, Ar-Nls:importin-Alpha Complex Length = 427 Back     alignment and structure
>pdb|3RZ9|A Chain A, Mouse Importin Alpha-Ku80 Nls Peptide Complex Length = 510 Back     alignment and structure
>pdb|3RZ9|A Chain A, Mouse Importin Alpha-Ku80 Nls Peptide Complex Length = 510 Back     alignment and structure
>pdb|1Y2A|C Chain C, Structure Of Mammalian Importin Bound To The Non-Classical Plscr1-Nls Length = 428 Back     alignment and structure
>pdb|1Y2A|C Chain C, Structure Of Mammalian Importin Bound To The Non-Classical Plscr1-Nls Length = 428 Back     alignment and structure
>pdb|3FEX|C Chain C, Crystal Structure Of The Cbc-Importin Alpha Complex. Length = 467 Back     alignment and structure
>pdb|3FEX|C Chain C, Crystal Structure Of The Cbc-Importin Alpha Complex. Length = 467 Back     alignment and structure
>pdb|4DB8|A Chain A, Designed Armadillo-Repeat Protein Length = 252 Back     alignment and structure
>pdb|4DB8|A Chain A, Designed Armadillo-Repeat Protein Length = 252 Back     alignment and structure
>pdb|2YNS|A Chain A, Rimp_alpha_b54nls Length = 490 Back     alignment and structure
>pdb|2YNS|A Chain A, Rimp_alpha_b54nls Length = 490 Back     alignment and structure
>pdb|4B8J|A Chain A, Rimp_alpha1a Length = 528 Back     alignment and structure
>pdb|4B8J|A Chain A, Rimp_alpha1a Length = 528 Back     alignment and structure
>pdb|3HTM|A Chain A, Structures Of Spop-Substrate Complexes: Insights Into Molecular Architectures Of Btb-Cul3 Ubiquitin Ligases: Spopbtb3-Box Length = 172 Back     alignment and structure
>pdb|4DB6|A Chain A, Designed Armadillo Repeat Protein (Yiiim3aii) Length = 210 Back     alignment and structure
>pdb|4DB6|A Chain A, Designed Armadillo Repeat Protein (Yiiim3aii) Length = 210 Back     alignment and structure
>pdb|4DB9|A Chain A, Designed Armadillo Repeat Protein (Yiiim3aiii) Length = 210 Back     alignment and structure
>pdb|4DB9|A Chain A, Designed Armadillo Repeat Protein (Yiiim3aiii) Length = 210 Back     alignment and structure
>pdb|4DBA|A Chain A, Designed Armadillo Repeat Protein (Yiim3aii) Length = 210 Back     alignment and structure
>pdb|4DBA|A Chain A, Designed Armadillo Repeat Protein (Yiim3aii) Length = 210 Back     alignment and structure
>pdb|3L6X|A Chain A, Crystal Structure Of P120 Catenin In Complex With E-Cadherin Length = 584 Back     alignment and structure
>pdb|2C1T|A Chain A, Structure Of The Kap60p:nup2 Complex Length = 454 Back     alignment and structure
>pdb|2C1T|A Chain A, Structure Of The Kap60p:nup2 Complex Length = 454 Back     alignment and structure
>pdb|1UN0|A Chain A, Crystal Structure Of Yeast Karyopherin (Importin) Alpha In Complex With A Nup2p N-Terminal Fragment Length = 443 Back     alignment and structure
>pdb|1UN0|A Chain A, Crystal Structure Of Yeast Karyopherin (Importin) Alpha In Complex With A Nup2p N-Terminal Fragment Length = 443 Back     alignment and structure
>pdb|1EE5|A Chain A, Yeast Karyopherin (Importin) Alpha In A Complex With A Nucleoplasmin Nls Peptide Length = 424 Back     alignment and structure
>pdb|1EE5|A Chain A, Yeast Karyopherin (Importin) Alpha In A Complex With A Nucleoplasmin Nls Peptide Length = 424 Back     alignment and structure
>pdb|1EE4|A Chain A, Crystal Structure Of Yeast Karyopherin (Importin) Alpha In A Complex With A C-Myc Nls Peptide Length = 423 Back     alignment and structure
>pdb|1EE4|A Chain A, Crystal Structure Of Yeast Karyopherin (Importin) Alpha In A Complex With A C-Myc Nls Peptide Length = 423 Back     alignment and structure
>pdb|3TJ3|A Chain A, Structure Of Importin A5 Bound To The N-Terminus Of Nup50 Length = 447 Back     alignment and structure
>pdb|2JDQ|A Chain A, C-Terminal Domain Of Influenza A Virus Polymerase Pb2 Subunit In Complex With Human Importin Alpha5 Length = 450 Back     alignment and structure
>pdb|1XM9|A Chain A, Structure Of The Armadillo Repeat Domain Of Plakophilin 1 Length = 457 Back     alignment and structure
>pdb|4AP2|A Chain A, Crystal Structure Of The Human Klhl11-cul3 Complex At 2.8a Resolution Length = 297 Back     alignment and structure
>pdb|2NN2|A Chain A, Crystal Structure Of The Btb Domain From The LrfZBTB7 Transcriptional Regulator Length = 133 Back     alignment and structure
>pdb|2IF5|A Chain A, Structure Of The Poz Domain Of Human Lrf, A Master Regulator Of Oncogenesis Length = 120 Back     alignment and structure
>pdb|3I3N|A Chain A, Crystal Structure Of The Btb-Back Domains Of Human Klhl11 Length = 279 Back     alignment and structure
>pdb|1WA5|B Chain B, Crystal Structure Of The Exportin Cse1p Complexed With Its Cargo (Kap60p) And Rangtp Length = 530 Back     alignment and structure
>pdb|1BK5|A Chain A, Karyopherin Alpha From Saccharomyces Cerevisiae Length = 422 Back     alignment and structure
>pdb|1BK5|A Chain A, Karyopherin Alpha From Saccharomyces Cerevisiae Length = 422 Back     alignment and structure
>pdb|1BK6|A Chain A, Karyopherin Alpha (Yeast) + Sv40 T Antigen Nls Length = 422 Back     alignment and structure
>pdb|1BK6|A Chain A, Karyopherin Alpha (Yeast) + Sv40 T Antigen Nls Length = 422 Back     alignment and structure
>pdb|3TT9|A Chain A, Crystal Structure Of The Stable Degradation Fragment Of Human Plakophilin 2 Isoform A (Pkp2a) C752r Variant Length = 233 Back     alignment and structure
>pdb|2Z6G|A Chain A, Crystal Structure Of A Full-Length Zebrafish Beta-Catenin Length = 780 Back     alignment and structure
>pdb|1CS3|A Chain A, Structure Of BtbPOZ TRANSCRIPTION REPRESSION DOMAIN FROM PROMELOCYTIC Leukemia Zinc Finger Oncoprotein Length = 116 Back     alignment and structure
>pdb|1BUO|A Chain A, Btb Domain From Plzf Length = 121 Back     alignment and structure
>pdb|2Z6H|A Chain A, Crystal Structure Of Beta-Catenin Armadillo Repeat Region And Its C-Terminal Domain Length = 644 Back     alignment and structure
>pdb|3M8V|A Chain A, Crystal Structure Of The Btb Domain From KaisoZBTB33, FORM II Length = 124 Back     alignment and structure
>pdb|2GL7|A Chain A, Crystal Structure Of A Beta-CateninBCL9TCF4 COMPLEX Length = 550 Back     alignment and structure
>pdb|1I7X|A Chain A, Beta-CateninE-Cadherin Complex Length = 538 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query720
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 1e-71
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 3e-69
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 1e-55
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 1e-40
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 2e-37
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 3e-07
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 4e-69
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 6e-68
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 5e-51
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 6e-42
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 2e-28
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 8e-69
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 9e-66
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 2e-55
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 5e-39
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 7e-22
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 8e-67
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 5e-49
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 2e-09
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 6e-66
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 3e-42
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 3e-39
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 2e-32
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 2e-11
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 1e-06
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 7e-66
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 9e-46
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 3e-45
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 3e-38
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 4e-20
3nmz_A458 APC variant protein; protein-protein complex, arma 4e-65
3nmz_A458 APC variant protein; protein-protein complex, arma 5e-48
3nmz_A458 APC variant protein; protein-protein complex, arma 2e-43
3nmz_A458 APC variant protein; protein-protein complex, arma 5e-27
3nmz_A458 APC variant protein; protein-protein complex, arma 1e-25
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 4e-64
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 2e-41
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 3e-29
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 1e-12
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 5e-58
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 1e-47
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 2e-41
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 4e-41
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 4e-06
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 2e-57
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 6e-44
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 1e-41
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 4e-31
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 2e-20
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 2e-13
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 2e-54
4eoz_A145 Speckle-type POZ protein; E3 ubiquitin ligase, nuc 6e-49
3hqi_A312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 9e-49
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 4e-42
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 6e-39
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 2e-24
3now_A 810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 8e-11
3now_A 810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 5e-09
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 8e-38
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 1e-23
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 1e-23
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 1e-16
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 3e-16
1xm9_A 457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 8e-05
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 2e-37
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 7e-35
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 6e-24
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 4e-19
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 7e-19
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 7e-18
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 2e-11
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 5e-34
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 2e-33
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 2e-27
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 7e-14
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 7e-34
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 4e-30
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 5e-17
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 7e-17
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 4e-09
3hve_A256 Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis 1e-31
3i3n_A279 Kelch-like protein 11; structural genomics, BTB, K 7e-29
2if5_A120 Zinc finger and BTB domain-containing protein 7A; 9e-26
2ppi_A144 Gigaxonin; BTB domain, protein degradation, struct 2e-24
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 3e-24
2ihc_A124 Transcription regulator protein BACH1; BRIC-A-BRAC 1e-22
3ohu_A125 Transcription regulator protein BACH2; BTB/POZ dom 2e-22
2yy9_A135 Zinc finger and BTB domain-containing protein 48; 3e-22
3b84_A119 Zinc finger and BTB domain-containing protein 48; 3e-22
2z8h_A138 Transcription regulator protein BACH1; BTB, POZ, d 4e-22
1buo_A121 POZ domain, protein (promyelocytic leukemia zinc f 7e-22
2vpk_A116 Myoneurin; transcription regulation, transcription 7e-22
2q81_A119 MIZ-1 protein; BTB/POZ domain, transcription; HET: 9e-20
3ga1_A129 Nucleus accumbens-associated protein 1; BTB/POZ do 1e-19
3m5b_A119 Zinc finger and BTB domain-containing protein 32; 2e-19
3fkc_A116 Transcriptional regulator kaiso; zinc finger and B 4e-18
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 3e-14
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 2e-08
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 6e-07
2db0_A253 253AA long hypothetical protein; heat repeats, hel 1e-13
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 2e-13
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 5e-08
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 4e-07
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 6e-07
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 1e-12
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 2e-12
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 3e-04
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 3e-12
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 3e-09
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 6e-10
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 2e-09
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 4e-07
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 3e-04
3grl_A651 General vesicular transport factor P115; vesicle t 9e-06
1u6g_C1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 3e-05
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 2e-04
2bpt_A861 Importin beta-1 subunit; nuclear transport, nucleo 2e-04
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
 Score =  241 bits (617), Expect = 1e-71
 Identities = 76/388 (19%), Positives = 138/388 (35%), Gaps = 37/388 (9%)

Query: 153 IVDNGALSHLVNLLKRHMDSNCSRAVNSVIRRAADAITNLAHENSSIKTRVRMEGGIPPL 212
            +   A+  L  LL              V+ +AA  +  L+ + +S    +R    +  +
Sbjct: 13  ELATRAIPELTKLLNDEDQV--------VVNKAAVMVHQLSKKEASRHAIMRSPQMVSAI 64

Query: 213 VELLEFT-DTKVQRAAAGALRTLAFKNDENKNQIVECNALPTLILMLRSEDSAIHYEAVG 271
           V  ++ T D +  R  AG L  L+  + E    I +   +P L+ ML S   ++ + A+ 
Sbjct: 65  VRTMQNTNDVETARCTAGTLHNLS-HHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAIT 123

Query: 272 VIGNLVHSSPNIKKEVLAAGALQPVIGLLSSCCSESQREAALLLGQFAATDSDCKVHIVQ 331
            + NL+      K  V  AG LQ ++ LL+    +        L   A  + + K+ I+ 
Sbjct: 124 TLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILA 183

Query: 332 RGAVRPLIEMLQSPDV-QLREMSAFALGRLAQVITDMHNQAGIAHNGGLVPLLKLLDSKN 390
            G  + L+ ++++    +L   ++  L  L+       N+  I   GG+  L   L   +
Sbjct: 184 SGGPQALVNIMRTYTYEKLLWTTSRVLKVLS---VCSSNKPAIVEAGGMQALGLHLTDPS 240

Query: 391 GSLQHNAAFALYGLADNEDNVADFIRVGGVQKL----QDGEFIVQATKDCVAKTLKRL-- 444
             L  N  + L  L+D           G +  L       +  V     C A  L  L  
Sbjct: 241 QRLVQNCLWTLRNLSDAATKQE--GMEGLLGTLVQLLGSDDINVVT---CAAGILSNLTC 295

Query: 445 ------EEKIHGRVLNHLLYLMRVA--EKGVQRRVALALAHLCSPDD----QRTIFIDGG 492
                         +  L+  +  A   + +      AL HL S        +       
Sbjct: 296 NNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHY 355

Query: 493 GLELLLGLLGSTNPKQQLDGAVALFKLA 520
           GL +++ LL   +    +   V L +  
Sbjct: 356 GLPVVVKLLHPPSHWPLIKATVGLIRNL 383


>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Length = 172 Back     alignment and structure
>4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Length = 145 Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Length = 312 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Length = 109 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Length = 256 Back     alignment and structure
>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} Length = 279 Back     alignment and structure
>2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Length = 120 Back     alignment and structure
>2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Length = 144 Back     alignment and structure
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Length = 127 Back     alignment and structure
>2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} Length = 124 Back     alignment and structure
>3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} PDB: 3ohv_A Length = 125 Back     alignment and structure
>2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Length = 135 Back     alignment and structure
>3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Length = 119 Back     alignment and structure
>2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Length = 138 Back     alignment and structure
>1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Length = 121 Back     alignment and structure
>2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Length = 116 Back     alignment and structure
>2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Length = 119 Back     alignment and structure
>3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} Length = 129 Back     alignment and structure
>3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} Length = 119 Back     alignment and structure
>3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Length = 116 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Length = 253 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Length = 201 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Length = 201 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Length = 201 Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Length = 778 Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Length = 778 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Length = 131 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Length = 131 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Length = 131 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Length = 651 Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Length = 1230 Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Length = 852 Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Length = 861 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query720
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 100.0
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 100.0
4b8j_A528 Importin subunit alpha-1A; transport protein, nucl 100.0
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 100.0
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 100.0
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 100.0
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 100.0
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 100.0
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 100.0
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 100.0
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 100.0
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 100.0
3nmz_A458 APC variant protein; protein-protein complex, arma 100.0
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 100.0
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 100.0
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 100.0
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 100.0
3nmz_A458 APC variant protein; protein-protein complex, arma 100.0
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 100.0
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 100.0
4b8j_A528 Importin subunit alpha-1A; transport protein, nucl 100.0
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 100.0
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 100.0
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 100.0
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 99.97
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 99.96
3hve_A256 Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis 99.95
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 99.95
3i3n_A279 Kelch-like protein 11; structural genomics, BTB, K 99.95
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.94
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.93
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.93
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.92
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 99.92
3hqi_A312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 99.92
4eoz_A145 Speckle-type POZ protein; E3 ubiquitin ligase, nuc 99.9
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 99.89
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.89
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.88
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 99.87
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.87
2if5_A120 Zinc finger and BTB domain-containing protein 7A; 99.86
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 99.86
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.85
2z8h_A138 Transcription regulator protein BACH1; BTB, POZ, d 99.85
2ppi_A144 Gigaxonin; BTB domain, protein degradation, struct 99.84
3b84_A119 Zinc finger and BTB domain-containing protein 48; 99.84
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 99.84
2yy9_A135 Zinc finger and BTB domain-containing protein 48; 99.84
1buo_A121 POZ domain, protein (promyelocytic leukemia zinc f 99.84
2vpk_A116 Myoneurin; transcription regulation, transcription 99.83
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.82
2q81_A119 MIZ-1 protein; BTB/POZ domain, transcription; HET: 99.82
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.81
3ohu_A125 Transcription regulator protein BACH2; BTB/POZ dom 99.81
2ihc_A124 Transcription regulator protein BACH1; BRIC-A-BRAC 99.8
3ga1_A129 Nucleus accumbens-associated protein 1; BTB/POZ do 99.8
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 99.79
3m5b_A119 Zinc finger and BTB domain-containing protein 32; 99.78
3fkc_A116 Transcriptional regulator kaiso; zinc finger and B 99.76
4fdd_A852 Transportin-1; heat repeats, karyopherin, nuclear 99.74
3grl_A651 General vesicular transport factor P115; vesicle t 99.73
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 99.69
3grl_A651 General vesicular transport factor P115; vesicle t 99.68
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 99.58
1qgr_A876 Protein (importin beta subunit); transport recepto 99.56
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 99.56
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 99.55
2bpt_A861 Importin beta-1 subunit; nuclear transport, nucleo 99.55
2bpt_A861 Importin beta-1 subunit; nuclear transport, nucleo 99.55
2vgl_B591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 99.54
2vgl_B591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 99.53
1qgr_A 876 Protein (importin beta subunit); transport recepto 99.51
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 99.45
1w63_A618 Adapter-related protein complex 1 gamma 1 subunit; 99.44
1w63_A618 Adapter-related protein complex 1 gamma 1 subunit; 99.43
2ast_A159 S-phase kinase-associated protein 1A; SCF-substrat 99.42
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 99.41
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 99.41
4gmo_A684 Putative uncharacterized protein; ARM, heat, solen 99.4
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 99.37
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 99.37
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 99.36
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 99.31
4ajy_C97 Transcription elongation factor B polypeptide 1; E 99.15
2vgl_A621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 99.09
2vgl_A621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 99.05
1fs1_B141 SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, le 99.04
2p1m_A160 SKP1-like protein 1A; F-BOX, leucine rich repeat, 98.91
4gmo_A684 Putative uncharacterized protein; ARM, heat, solen 98.91
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 98.78
2db0_A253 253AA long hypothetical protein; heat repeats, hel 98.73
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 98.67
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 98.67
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 98.65
4ady_A963 RPN2, 26S proteasome regulatory subunit RPN2; prot 98.65
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 98.6
1ho8_A480 Vacuolar ATP synthase subunit H; heat repeat, hydr 98.58
2db0_A253 253AA long hypothetical protein; heat repeats, hel 98.58
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 98.56
1hv2_A99 Elongin C, ELC1; protein-peptide complex, signalin 98.52
4ady_A963 RPN2, 26S proteasome regulatory subunit RPN2; prot 98.47
2fnj_C96 Transcription elongation factor B polypeptide 1; b 98.45
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 98.41
3v7d_A169 Suppressor of kinetochore protein 1; WD 40 domain, 98.4
2eqx_A105 Kelch repeat and BTB domain-containing protein 4; 98.38
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 98.37
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 98.34
1wa5_C960 Importin alpha RE-exporter; nuclear transport/comp 98.34
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 98.31
3drz_A107 BTB/POZ domain-containing protein KCTD5; potassium 98.26
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 98.24
1ho8_A480 Vacuolar ATP synthase subunit H; heat repeat, hydr 98.14
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 98.06
1vcb_B112 Protein (elongin C); tumor suppressor, cancer, ubi 98.01
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 97.98
2x1g_F 971 Cadmus; transport protein, developmental protein, 97.95
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 97.85
2x19_B 963 Importin-13; nuclear transport, protein transport; 97.82
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 97.77
3m1i_C 1049 Exportin-1; heat repeat, GTP-binding, nucleotide-b 97.68
3ibv_A 980 Exportin-T; karyopherin, heat repeat, cytoplasm, n 97.65
3ibv_A980 Exportin-T; karyopherin, heat repeat, cytoplasm, n 97.62
2x1g_F971 Cadmus; transport protein, developmental protein, 97.5
4hat_C 1023 Exportin-1; heat repeat, nuclear export, RAN-ranbp 97.42
2x19_B963 Importin-13; nuclear transport, protein transport; 97.35
1lrv_A244 LRV, leucine-rich repeat variant; leucine-rich rep 97.34
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 97.28
3drx_A202 BTB/POZ domain-containing protein KCTD5; golgi, gr 97.26
3m1i_C 1049 Exportin-1; heat repeat, GTP-binding, nucleotide-b 97.22
1lrv_A244 LRV, leucine-rich repeat variant; leucine-rich rep 97.16
3oc3_A800 Helicase MOT1, MOT1; regulation of transcription, 97.1
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 97.07
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 97.01
1upk_A341 MO25 protein; transferase, armadillo; HET: MSE; 1. 96.95
3oc3_A 800 Helicase MOT1, MOT1; regulation of transcription, 96.91
2fv2_A268 RCD1 required for cell differentiation1 homolog; a 96.88
1upk_A341 MO25 protein; transferase, armadillo; HET: MSE; 1. 96.8
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 96.8
2fv2_A268 RCD1 required for cell differentiation1 homolog; a 96.61
4hat_C1023 Exportin-1; heat repeat, nuclear export, RAN-ranbp 96.35
1s1g_A124 Potassium voltage-gated channel subfamily D membe; 96.19
3l9t_A240 Putative uncharacterized protein SMU.31; hypotheti 95.82
3gjx_A 1073 Exportin-1; transport, cytoplasm, nucleus, RNA-bin 95.77
3kvt_A115 Potassium channel protein SHAW; tetramerization do 95.74
3a6p_A 1204 Exportin-5; exportin-5, RANGTP, nuclearexport, imp 95.68
1nn7_A105 Potassium channel KV4.2; teteramerization domain, 95.52
2nz0_B140 Potassium voltage-gated channel subfamily D membe; 95.44
3l9t_A240 Putative uncharacterized protein SMU.31; hypotheti 95.36
3gjx_A 1073 Exportin-1; transport, cytoplasm, nucleus, RNA-bin 95.16
3u0r_A507 Apoptosis inhibitor 5; heat repeat, armadillo repe 94.84
3ebb_A304 Phospholipase A2-activating protein; armadillo rep 94.4
1t1d_A100 Protein (potassium channel KV1.1); potassium chann 94.21
3ebb_A304 Phospholipase A2-activating protein; armadillo rep 94.2
3u0r_A507 Apoptosis inhibitor 5; heat repeat, armadillo repe 91.22
2f31_A233 Diaphanous protein homolog 1; formin,MDIA1, protei 90.86
1lsh_A 1056 Lipovitellin (LV-1N, LV-1C); vitellogenin, lipopro 90.76
3c2g_A619 SYS-1 protein; beta-catenin, phylogeny, SYS-1, dev 90.35
2f31_A233 Diaphanous protein homolog 1; formin,MDIA1, protei 90.3
3eg5_B383 Protein diaphanous homolog 1; protein-protein comp 89.96
3c2g_A619 SYS-1 protein; beta-catenin, phylogeny, SYS-1, dev 89.51
1lsh_A 1056 Lipovitellin (LV-1N, LV-1C); vitellogenin, lipopro 89.31
3qml_C315 Protein SLS1, nucleotide exchange factor SIL1; arm 89.0
3a6p_A 1204 Exportin-5; exportin-5, RANGTP, nuclearexport, imp 86.56
3eg5_B383 Protein diaphanous homolog 1; protein-protein comp 86.52
2bnx_A386 Diaphanous protein homolog 1; autoinhibition, acti 85.99
2bnx_A386 Diaphanous protein homolog 1; autoinhibition, acti 85.31
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
Probab=100.00  E-value=7.2e-37  Score=334.53  Aligned_cols=402  Identities=18%  Similarity=0.271  Sum_probs=346.6

Q ss_pred             HHHHHHHHhhccccchHHhHHHHHHHHHHHHHHccC--hhhHHHHHhCCChHHHHHhhcCCCCcccccCCCcchHHHHHH
Q 004992           58 EVSAQVNVLNTTFSWLEADRAAAKRATHVLAELAKN--EEVVNWIVEGGAVPALVKHLQAPPTSEADRNLKPFEHEVEKG  135 (720)
Q Consensus        58 ~i~~ll~~L~~~l~~~~~d~~~~~~a~~~L~~l~~~--~~~~~~~~~~g~i~~L~~ll~~~~~~~~~~~~~~~~~~v~~~  135 (720)
                      .++.+++.+.+.      |...+..|+..+..+.+.  ....+.+++.|+||.|+.+|...+.           +.++..
T Consensus        77 ~l~~lv~~l~s~------d~~~q~~a~~~~rklLs~~~~~~i~~ii~~G~ip~Lv~lL~~~~~-----------~~~q~~  139 (529)
T 3tpo_A           77 SVEDIVKGINSN------NLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDC-----------SPIQFE  139 (529)
T ss_dssp             CHHHHHHHHTSS------CHHHHHHHHHHHHHHHTSSSCCCHHHHHHTTHHHHHHHHHTCTTC-----------HHHHHH
T ss_pred             HHHHHHHHhcCC------CHHHHHHHHHHHHHHHcCCCCchHHHHHHCCCHHHHHHHHcCCCC-----------HHHHHH
Confidence            356677766665      667899999999987652  3345788999999999999976544           289999


Q ss_pred             HHHHHHHhc-cChhhHHHHHHcCChHHHHHHHhccCCCccchhhhHHHHHHHHHHHHhhhcCchhhHHHHhcCCcHHHHH
Q 004992          136 SAFALGLLA-VKPEHQQLIVDNGALSHLVNLLKRHMDSNCSRAVNSVIRRAADAITNLAHENSSIKTRVRMEGGIPPLVE  214 (720)
Q Consensus       136 a~~~L~~L~-~~~~~~~~~~~~~~l~~L~~lL~~~~~~~~~~~~~~v~~~a~~~L~~l~~~~~~~~~~~~~~~~i~~L~~  214 (720)
                      |+|+|+||+ .+++....+++.|+++.|+.+|.+++.        ++++.|+|+|.|++..++..+..+...|+++.|+.
T Consensus       140 Aa~aL~nia~~~~~~~~~vv~~Gaip~Lv~LL~s~~~--------~v~e~A~~aL~nLa~~~~~~r~~i~~~g~i~~Ll~  211 (529)
T 3tpo_A          140 SAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHA--------HISEQAVWALGNIAGAGSAFRDLVIKHGAIDPLLA  211 (529)
T ss_dssp             HHHHHHHHHTSCHHHHHHHHHTTHHHHHHHHTTCSCH--------HHHHHHHHHHHHHHTTCHHHHHHHHHTTCHHHHHH
T ss_pred             HHHHHHHHHcCCHHHHHHHHHCCCHHHHHHHHcCCCH--------HHHHHHHHHHHHHhccCHHHHHHHHHcCCcHHHHH
Confidence            999999999 788888999999999999999998877        99999999999999988999999999999999999


Q ss_pred             hhcCCC-----HHHHHHHHHHHHHhccCChhcHHHHHhCCCHHHHHHhhcCCCHHHHHHHHHHHHHhhcCCcchHHHHHH
Q 004992          215 LLEFTD-----TKVQRAAAGALRTLAFKNDENKNQIVECNALPTLILMLRSEDSAIHYEAVGVIGNLVHSSPNIKKEVLA  289 (720)
Q Consensus       215 ll~~~~-----~~v~~~a~~~L~~L~~~~~~~~~~i~~~g~l~~L~~ll~~~~~~v~~~a~~~L~nL~~~~~~~~~~~~~  289 (720)
                      ++..++     ..+...+++++.+++.+...........+++|.|+.++.+++++++..++|+|.+++...+.....+..
T Consensus       212 lL~~~~~~~~~~~~~~~a~~~L~nl~~~~~~~~~~~~~~~~lp~L~~LL~~~~~~v~~~a~~aL~~l~~~~~~~~~~v~~  291 (529)
T 3tpo_A          212 LLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVK  291 (529)
T ss_dssp             TTCSSCGGGSCHHHHHHHHHHHHHHHCCCTTCCCHHHHHHHHHHHHHHTTSSCHHHHHHHHHHHHHHHSSCHHHHHHHHT
T ss_pred             HHhccchhHhHHHHHHHHHHHHHHHHhcccchhhHHHHhhHHHHHHHHhcCCcHHHHHHHHHHHHHhhhhhhhhHHHHHh
Confidence            997654     467889999999999855444444444678999999999999999999999999999888888888889


Q ss_pred             cCChHHHHHhhccCChHHHHHHHHHHHHHhccCcchhhHHHhcCChHHHHHHhcCCCHHHHHHHHHHHHHHhhhhcCcch
Q 004992          290 AGALQPVIGLLSSCCSESQREAALLLGQFAATDSDCKVHIVQRGAVRPLIEMLQSPDVQLREMSAFALGRLAQVITDMHN  369 (720)
Q Consensus       290 ~~~l~~L~~ll~~~~~~~~~~a~~~L~~l~~~~~~~~~~~~~~~~~~~L~~ll~~~~~~v~~~a~~~L~~l~~~~~~~~~  369 (720)
                      .|+++.|+.++.+.++.++..++++|+|++.+++.....+.+.|+++.|+.+|.++++.+++.|+++|+|++.  +....
T Consensus       292 ~g~i~~Lv~lL~~~~~~v~~~a~~aL~nl~~~~~~~~~~i~~~g~l~~L~~LL~~~~~~i~~~a~~aL~nl~~--~~~~~  369 (529)
T 3tpo_A          292 KGVVPQLVKLLGATELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITA--GRQDQ  369 (529)
T ss_dssp             TTCHHHHHHHHTCSCHHHHHHHHHHHHHHTTSCHHHHHHHHHTTGGGGHHHHTTCSSHHHHHHHHHHHHHHHT--SCHHH
T ss_pred             ccchHHHHHHhcCCChhHHHHHHHHHHHHHccchHHHHHHhhcccHHHHHHHHcCCCHHHHHHHHHHHHHHhc--ccHHH
Confidence            9999999999999999999999999999998888888889999999999999999999999999999999998  35556


Q ss_pred             hhhhhhcCCHHHHHHHhcCCChhHHHHHHHHHHhcccC--CCchhHHHhhcccccccchhhhhhhhHHHHHHHHHHHHHh
Q 004992          370 QAGIAHNGGLVPLLKLLDSKNGSLQHNAAFALYGLADN--EDNVADFIRVGGVQKLQDGEFIVQATKDCVAKTLKRLEEK  447 (720)
Q Consensus       370 ~~~l~~~~~i~~l~~ll~~~~~~v~~~a~~~L~~l~~~--~~~~~~l~~~~~v~~L~~~~~~~~~~~~~~~~~~~~l~~~  447 (720)
                      ...+.+.|+++.++.++.+.+..++..|+++|.|++..  ++....+++                               
T Consensus       370 ~~~v~~~g~i~~Lv~lL~~~~~~v~~~A~~aL~nl~~~~~~~~~~~l~~-------------------------------  418 (529)
T 3tpo_A          370 IQQVVNHGLVPFLVGVLSKADFKTQKAAAWAITNYTSGGTVEQIVYLVH-------------------------------  418 (529)
T ss_dssp             HHHHHHTTHHHHHHHHHHSSCHHHHHHHHHHHHHHHHHSCHHHHHHHHH-------------------------------
T ss_pred             HHHHHhcCcHHHHHHHhcCCCHHHHHHHHHHHHHHHcCCCHHHHHHHHH-------------------------------
Confidence            67788999999999999999999999999999999753  333334444                               


Q ss_pred             hhhhhHHHHHHHHHhcchhHHHHHHHHHHhhcCCc-------ccchhhhccCcHHHHHHhhcCCCchhhhhHHHHHHHH
Q 004992          448 IHGRVLNHLLYLMRVAEKGVQRRVALALAHLCSPD-------DQRTIFIDGGGLELLLGLLGSTNPKQQLDGAVALFKL  519 (720)
Q Consensus       448 ~~~~~~~~L~~ll~~~~~~v~~~a~~~L~~l~~~~-------~~~~~~~~~~~~~~L~~ll~~~~~~v~~~a~~aL~~L  519 (720)
                        .++++.|+.+++++++.++..++.+|.++....       ..+..+.+.||+..|..|..+++.++...|...|-.-
T Consensus       419 --~g~i~~L~~LL~~~d~~i~~~~L~aL~nil~~~~~~~~~~~~~~~iee~ggl~~ie~Lq~~~n~~i~~~A~~iie~y  495 (529)
T 3tpo_A          419 --CGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNLIEKY  495 (529)
T ss_dssp             --TTCHHHHHHGGGCSCHHHHHHHHHHHHHHHHHHHTTTCHHHHHHHHHHTTCHHHHTGGGGCSSHHHHHHHHHHHHHH
T ss_pred             --CcCHHHHHHHhcCCCHHHHHHHHHHHHHHHHHhHhccChHHHHHHHHHCCcHHHHHHHHcCCCHHHHHHHHHHHHHH
Confidence              456778899999999999999999999985321       1345678899999999999999999999998888654



>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Back     alignment and structure
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Back     alignment and structure
>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} PDB: 4ap2_A* 4apf_A Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Back     alignment and structure
>4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Back     alignment and structure
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Back     alignment and structure
>2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Back     alignment and structure
>3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Back     alignment and structure
>1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Back     alignment and structure
>2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} SCOP: d.42.1.0 PDB: 3ohv_A Back     alignment and structure
>2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} Back     alignment and structure
>3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} SCOP: d.42.1.0 Back     alignment and structure
>3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>4ajy_C Transcription elongation factor B polypeptide 1; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 2izv_C 3dcg_B 3zrc_B* 3zrf_B 3ztc_B* 3ztd_B* 3zun_B* 2c9w_C 4awj_B* 4b95_B* 4b9k_B* 2fnj_C 1lqb_B 1lm8_C 2jz3_C 2xai_B 4b9k_E* Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>1fs1_B SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.157.1.1 d.42.1.1 PDB: 1fs2_B 1ldk_D Back     alignment and structure
>2p1m_A SKP1-like protein 1A; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_A* 2p1o_A* 2p1p_A* 2p1q_A* 3c6n_A* 3c6o_A* 3c6p_A* 3ogk_A* 3ogl_A* 3ogm_A* Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1ho8_A Vacuolar ATP synthase subunit H; heat repeat, hydrolase; 2.95A {Saccharomyces cerevisiae} SCOP: a.118.1.9 Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1hv2_A Elongin C, ELC1; protein-peptide complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: d.42.1.1 Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>2fnj_C Transcription elongation factor B polypeptide 1; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.42.1.1 PDB: 1lqb_B 1lm8_C 2jz3_C 2xai_B 2c9w_C 2izv_C 3dcg_B 3zrc_B* 3zrf_B Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>3v7d_A Suppressor of kinetochore protein 1; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_A* 3mks_A* Back     alignment and structure
>2eqx_A Kelch repeat and BTB domain-containing protein 4; BACK domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>3drz_A BTB/POZ domain-containing protein KCTD5; potassium channel domain T1, pentamer, unkno function; 1.90A {Homo sapiens} Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>1ho8_A Vacuolar ATP synthase subunit H; heat repeat, hydrolase; 2.95A {Saccharomyces cerevisiae} SCOP: a.118.1.9 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>1vcb_B Protein (elongin C); tumor suppressor, cancer, ubiquitin, beta sandwich, transcription, transcriptional elongation; 2.70A {Homo sapiens} SCOP: d.42.1.1 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B Back     alignment and structure
>3ibv_A Exportin-T; karyopherin, heat repeat, cytoplasm, nucleus, RNA- binding, transport, tRNA processing, tRNA-binding, RNA binding protein; 3.10A {Schizosaccharomyces pombe} PDB: 3icq_T* Back     alignment and structure
>3ibv_A Exportin-T; karyopherin, heat repeat, cytoplasm, nucleus, RNA- binding, transport, tRNA processing, tRNA-binding, RNA binding protein; 3.10A {Schizosaccharomyces pombe} PDB: 3icq_T* Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>3drx_A BTB/POZ domain-containing protein KCTD5; golgi, grAsp55, potassium channel domain T1, pentameric assembly, HOST-virus interaction, nucleus; 3.11A {Homo sapiens} PDB: 3dry_A Back     alignment and structure
>3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B Back     alignment and structure
>1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 Back     alignment and structure
>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>1upk_A MO25 protein; transferase, armadillo; HET: MSE; 1.85A {Homo sapiens} SCOP: a.118.1.15 PDB: 1upl_A 2wtk_A* 3gni_A* Back     alignment and structure
>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} Back     alignment and structure
>2fv2_A RCD1 required for cell differentiation1 homolog; armadillo-repeat, transcription; 2.20A {Homo sapiens} Back     alignment and structure
>1upk_A MO25 protein; transferase, armadillo; HET: MSE; 1.85A {Homo sapiens} SCOP: a.118.1.15 PDB: 1upl_A 2wtk_A* 3gni_A* Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>2fv2_A RCD1 required for cell differentiation1 homolog; armadillo-repeat, transcription; 2.20A {Homo sapiens} Back     alignment and structure
>4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B Back     alignment and structure
>1s1g_A Potassium voltage-gated channel subfamily D membe; K+ channels, tetramerization domain, T1 domain, transport PR; 2.60A {Homo sapiens} SCOP: d.42.1.2 Back     alignment and structure
>3l9t_A Putative uncharacterized protein SMU.31; hypothetical protein, unknown function; HET: EPE; 2.21A {Streptococcus mutans} Back     alignment and structure
>3gjx_A Exportin-1; transport, cytoplasm, nucleus, RNA-binding, acetylation, GTP-binding, HOST-virus interaction, nucleotide-binding, phosphoprotein; HET: GTP; 2.50A {Mus musculus} PDB: 3nby_A* 3nbz_A* 3nc0_A* 3nc1_A* 3gb8_A Back     alignment and structure
>3kvt_A Potassium channel protein SHAW; tetramerization domain, molecular recogni zinc-binding; 2.00A {Aplysia californica} SCOP: d.42.1.2 Back     alignment and structure
>3a6p_A Exportin-5; exportin-5, RANGTP, nuclearexport, importin-BE family, nucleus, phosphoprotein, protein transport; HET: GTP; 2.92A {Homo sapiens} Back     alignment and structure
>1nn7_A Potassium channel KV4.2; teteramerization domain, voltage gated potassium channel SHAL, membrane protein; 2.10A {Rattus norvegicus} SCOP: d.42.1.2 Back     alignment and structure
>2nz0_B Potassium voltage-gated channel subfamily D membe; KV4.3, kchip1, membrane protein; 3.20A {Homo sapiens} PDB: 2i2r_A Back     alignment and structure
>3l9t_A Putative uncharacterized protein SMU.31; hypothetical protein, unknown function; HET: EPE; 2.21A {Streptococcus mutans} Back     alignment and structure
>3gjx_A Exportin-1; transport, cytoplasm, nucleus, RNA-binding, acetylation, GTP-binding, HOST-virus interaction, nucleotide-binding, phosphoprotein; HET: GTP; 2.50A {Mus musculus} PDB: 3nby_A* 3nbz_A* 3nc0_A* 3nc1_A* 3gb8_A Back     alignment and structure
>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A Back     alignment and structure
>3ebb_A Phospholipase A2-activating protein; armadillo repeat, structural genomics consortium, SGC, WD repeat, acetylation, ATP-binding; 1.90A {Homo sapiens} Back     alignment and structure
>1t1d_A Protein (potassium channel KV1.1); potassium channels, tetramerization domain, aplysia KV1.1, proton transport, membrane protein; 1.51A {Aplysia californica} SCOP: d.42.1.2 PDB: 1eod_A 1eof_A 1eoe_A 1a68_A 1qdv_A 1exb_E* 1qdw_A 1dsx_A Back     alignment and structure
>3ebb_A Phospholipase A2-activating protein; armadillo repeat, structural genomics consortium, SGC, WD repeat, acetylation, ATP-binding; 1.90A {Homo sapiens} Back     alignment and structure
>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A Back     alignment and structure
>2f31_A Diaphanous protein homolog 1; formin,MDIA1, protein-protein complex, armadillo repeats, structural protein; 2.10A {Mus musculus} Back     alignment and structure
>1lsh_A Lipovitellin (LV-1N, LV-1C); vitellogenin, lipoprotein, plasma apolipoprote apolipoprotein B, APOB; HET: PLD UPL; 1.90A {Ichthyomyzon unicuspis} SCOP: a.118.4.1 f.7.1.1 f.7.1.1 Back     alignment and structure
>3c2g_A SYS-1 protein; beta-catenin, phylogeny, SYS-1, developmental protein, DNA-binding, nucleus; 2.50A {Caenorhabditis elegans} PDB: 3c2h_A* Back     alignment and structure
>2f31_A Diaphanous protein homolog 1; formin,MDIA1, protein-protein complex, armadillo repeats, structural protein; 2.10A {Mus musculus} Back     alignment and structure
>3eg5_B Protein diaphanous homolog 1; protein-protein complex, RHO proteins, formins, armadillo repeat, G-protein, GTPase, alternative splicing; HET: GNP; 2.70A {Mus musculus} SCOP: a.118.1.23 PDB: 1z2c_B* Back     alignment and structure
>3c2g_A SYS-1 protein; beta-catenin, phylogeny, SYS-1, developmental protein, DNA-binding, nucleus; 2.50A {Caenorhabditis elegans} PDB: 3c2h_A* Back     alignment and structure
>1lsh_A Lipovitellin (LV-1N, LV-1C); vitellogenin, lipoprotein, plasma apolipoprote apolipoprotein B, APOB; HET: PLD UPL; 1.90A {Ichthyomyzon unicuspis} SCOP: a.118.4.1 f.7.1.1 f.7.1.1 Back     alignment and structure
>3qml_C Protein SLS1, nucleotide exchange factor SIL1; armadillo like repeats, chaperone-protein transport complex; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3a6p_A Exportin-5; exportin-5, RANGTP, nuclearexport, importin-BE family, nucleus, phosphoprotein, protein transport; HET: GTP; 2.92A {Homo sapiens} Back     alignment and structure
>3eg5_B Protein diaphanous homolog 1; protein-protein complex, RHO proteins, formins, armadillo repeat, G-protein, GTPase, alternative splicing; HET: GNP; 2.70A {Mus musculus} SCOP: a.118.1.23 PDB: 1z2c_B* Back     alignment and structure
>2bnx_A Diaphanous protein homolog 1; autoinhibition, actin, nucleation, cytoskeleton, structural; 2.4A {Mus musculus} SCOP: a.118.1.23 PDB: 3o4x_A 3obv_A* 2bap_B Back     alignment and structure
>2bnx_A Diaphanous protein homolog 1; autoinhibition, actin, nucleation, cytoskeleton, structural; 2.4A {Mus musculus} SCOP: a.118.1.23 PDB: 3o4x_A 3obv_A* 2bap_B Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 720
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 1e-22
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 7e-19
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 5e-15
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 6e-15
d1xm9a1 457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 2e-04
d1r29a_122 d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB 3e-22
d1q1sc_434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 8e-22
d1q1sc_434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 7e-19
d1q1sc_434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 2e-17
d1q1sc_434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 4e-09
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 3e-21
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 5e-18
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 1e-17
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 4e-13
d1jdha_ 529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 3e-07
d1buoa_121 d.42.1.1 (A:) Promyelocytic leukaemia zinc finger 9e-21
d1wa5b_503 a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (S 9e-20
d1wa5b_503 a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (S 2e-18
d1wa5b_503 a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (S 5e-15
d1xqra1264 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (Hsp 1e-16
d1xqra1264 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (Hsp 3e-06
d1xqra1264 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (Hsp 1e-05
d2vgla_584 a.118.1.10 (A:) Adaptin alpha C subunit N-terminal 7e-08
d2vgla_584 a.118.1.10 (A:) Adaptin alpha C subunit N-terminal 1e-04
d1qbkb_888 a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapi 1e-06
d1qbkb_ 888 a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapi 4e-05
d1u6gc_ 1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 4e-06
d1u6gc_ 1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 0.003
d1ibrb_458 a.118.1.1 (B:) Importin beta {Human (Homo sapiens) 2e-04
d1lrva_233 a.118.1.5 (A:) Leucine-rich repeat variant {Azotob 2e-04
d1b3ua_588 a.118.1.2 (A:) Constant regulatory domain of prote 5e-04
d1b3ua_588 a.118.1.2 (A:) Constant regulatory domain of prote 7e-04
d1oyza_276 a.118.1.16 (A:) Hypothetical protein YibA {Escheri 0.002
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Plakophilin 1 helical region
domain: Plakophilin 1
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 99.1 bits (245), Expect = 1e-22
 Identities = 56/401 (13%), Positives = 115/401 (28%), Gaps = 52/401 (12%)

Query: 159 LSHLVNLLKRHMDSNCSRAVNSVIRRAADAITNLAHENSSIKTRVRMEGGIPPLVELLEF 218
           +   V  L    +              A  I +   ++ S K +V   GGI  LV+LL  
Sbjct: 4   IPKAVQYLSSQDEK--------YQAIGAYYIQHTCFQDESAKQQVYQLGGICKLVDLLRS 55

Query: 219 TDTKVQRAAAGALRTLAFKNDENKNQIVECNALPTLI-LMLRSEDSAIHYEAVGVIGNLV 277
            +  VQ+AAAGALR L F++  NK +    N +   + L+ R+ ++ I  +  G++ NL 
Sbjct: 56  PNQNVQQAAAGALRNLVFRSTTNKLETRRQNGIREAVSLLRRTGNAEIQKQLTGLLWNLS 115

Query: 278 HSSPNIKKEV--------------LAAGALQPVIGLLSSCCSESQREAALLLGQFAATDS 323
            +    ++ +               +                E    A   L   ++ D+
Sbjct: 116 STDELKEELIADALPVLADRVIIPFSGWCDGNSNMSREVVDPEVFFNATGCLRNLSSADA 175

Query: 324 DCKVHIVQRGAVRPLIEMLQSPD--VQLREMSAFALGRLAQVITDMHNQAGIAHNGGLVP 381
             +      G +  L+  +Q+     +  + S      +   ++   +         L  
Sbjct: 176 GRQTMRNYSGLIDSLMAYVQNCVAASRCDDKSVENCMCVLHNLSYRLDAEVPTRYRQLEY 235

Query: 382 LLKLLD-----------SKNGSLQHNAAFALYGLADNEDNVADFIRVGGVQKL------- 423
             +                +  + +N    L     N            ++         
Sbjct: 236 NARNAYTEKSSTGCFSNKSDKMMNNNYDCPLPEEETNPKGSGWLYHSDAIRTYLNLMGKS 295

Query: 424 --------QDGEFIVQATKDCVAKTLKRLEEKIHGRVLNHLLYLMRVAEKGVQRRVALAL 475
                     G          +  +       +  + L  +  L++     V R  A  L
Sbjct: 296 KKDATLEACAGALQNLTASKGLMSSGMSQLIGLKEKGLPQIARLLQSGNSDVVRSGASLL 355

Query: 476 AHLCSPDDQRTIFIDGGGLELLLGLLGSTNPKQQLDGAVAL 516
           +++          +       +  LL S          +  
Sbjct: 356 SNMSRHPLLHR-VMGNQVFPEVTRLLTSHTGNTSNSEDILS 395


>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 121 Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 503 Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 503 Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 503 Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 264 Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 264 Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 264 Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Length = 888 Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Length = 888 Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Length = 458 Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Length = 233 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Length = 276 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query720
d1jdha_529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 100.0
d1jdha_529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 100.0
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 99.97
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 99.97
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.92
d1r29a_122 B-cell lymphoma 6 (Bcl6) protein BTB domain {Human 99.86
d1b3ua_588 Constant regulatory domain of protein phosphatase 99.86
d1buoa_121 Promyelocytic leukaemia zinc finger (PLZF) protein 99.84
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.84
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.8
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.78
d1b3ua_588 Constant regulatory domain of protein phosphatase 99.73
d2vglb_579 Adaptin beta subunit N-terminal fragment {Human (H 99.42
d2vglb_579 Adaptin beta subunit N-terminal fragment {Human (H 99.38
d1qbkb_888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 99.19
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 99.13
d1qbkb_888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 99.13
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 99.11
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 99.09
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 99.08
d2bpta1861 Importin beta {Baker's yeast (Saccharomyces cerevi 98.99
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 98.87
d2vgla_584 Adaptin alpha C subunit N-terminal fragment {Mouse 98.84
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 98.83
d2vgla_584 Adaptin alpha C subunit N-terminal fragment {Mouse 98.81
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 98.8
d2bpta1861 Importin beta {Baker's yeast (Saccharomyces cerevi 98.76
d1qgra_876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 98.69
d1ho8a_477 Regulatory subunit H of the V-type ATPase {Baker's 98.52
d1ho8a_477 Regulatory subunit H of the V-type ATPase {Baker's 98.34
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 98.28
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 98.16
d2c9wc196 Elongin C {Human (Homo sapiens) [TaxId: 9606]} 97.71
d1hv2a_99 Elongin C {Baker's yeast (Saccharomyces cerevisiae 97.5
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 97.31
d1nn7a_105 Potassium channel kv4.2 {Rat (Rattus norvegicus) [ 97.24
d1upka_330 Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} 97.23
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 97.07
d1upka_330 Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} 96.97
d3kvta_103 akv3.1 voltage-gated potassium channel {California 96.59
d1t1da_100 Shaker potassium channel {California sea hare (Apl 96.25
d1wa5c_ 959 Exportin Cse1p {Baker's yeast (Saccharomyces cerev 95.68
d1lsha1336 Lipovitellin-phosvitin complex, superhelical domai 95.53
d1lsha1336 Lipovitellin-phosvitin complex, superhelical domai 95.16
d1nexa272 Centromere DNA-binding protein complex Cbf3 subuni 93.23
d1fs1b155 Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sa 93.06
d1nexa170 Centromere DNA-binding protein complex Cbf3 subuni 91.15
d1fs1b261 Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sa 90.69
d2bnxa1343 Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) { 86.32
d2bnxa1343 Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) { 84.73
d1wa5c_959 Exportin Cse1p {Baker's yeast (Saccharomyces cerev 81.05
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Armadillo repeat
domain: beta-Catenin
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=5.5e-34  Score=311.41  Aligned_cols=435  Identities=22%  Similarity=0.222  Sum_probs=366.0

Q ss_pred             HHHHHHHHHhhccccchHHhHHHHHHHHHHHHHHccChhhHHHHHhCCChHHHHHhhcCCCCcccccCCCcchHHHHHHH
Q 004992           57 SEVSAQVNVLNTTFSWLEADRAAAKRATHVLAELAKNEEVVNWIVEGGAVPALVKHLQAPPTSEADRNLKPFEHEVEKGS  136 (720)
Q Consensus        57 ~~i~~ll~~L~~~l~~~~~d~~~~~~a~~~L~~l~~~~~~~~~~~~~g~i~~L~~ll~~~~~~~~~~~~~~~~~~v~~~a  136 (720)
                      ..++.++..|...     .+..++..|+.+|.+++.+++.+..+++.|+++.|+.+|++++.            +++..|
T Consensus        59 ~~v~~l~~~L~~~-----~~~~~~~~a~~~L~~l~~~~~~~~~i~~~g~i~~Li~lL~~~~~------------~v~~~a  121 (529)
T d1jdha_          59 QMVSAIVRTMQNT-----NDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVD------------SVLFYA  121 (529)
T ss_dssp             HHHHHHHHHHHHC-----CCHHHHHHHHHHHHHHTTSHHHHHHHHHTTHHHHHHHHTTCSCH------------HHHHHH
T ss_pred             hHHHHHHHHHcCC-----CCHHHHHHHHHHHHHHhCCchhHHHHHHCCCHHHHHHHhCCCCH------------HHHHHH
Confidence            3566666666553     35568999999999999999999999999999999999988776            899999


Q ss_pred             HHHHHHhc-cChhhHHHHHHcCChHHHHHHHhccCCCccchhhhHHHHHHHHHHHHhhhcCchhhHHHHhcCCcHHHHHh
Q 004992          137 AFALGLLA-VKPEHQQLIVDNGALSHLVNLLKRHMDSNCSRAVNSVIRRAADAITNLAHENSSIKTRVRMEGGIPPLVEL  215 (720)
Q Consensus       137 ~~~L~~L~-~~~~~~~~~~~~~~l~~L~~lL~~~~~~~~~~~~~~v~~~a~~~L~~l~~~~~~~~~~~~~~~~i~~L~~l  215 (720)
                      +++|.+++ +++..+..+.+.|+++.|+.+|++.+.        +++..++++|.+++..++..+..+...|+++.++.+
T Consensus       122 ~~aL~~l~~~~~~~~~~~~~~g~i~~Lv~lL~~~~~--------~~~~~a~~~L~~l~~~~~~~~~~~~~~~~~~~L~~l  193 (529)
T d1jdha_         122 ITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNV--------KFLAITTDCLQILAYGNQESKLIILASGGPQALVNI  193 (529)
T ss_dssp             HHHHHHHHHHCTTHHHHHHHHTHHHHHHHGGGCCCH--------HHHHHHHHHHHHHHTTCHHHHHHHHHTTHHHHHHHH
T ss_pred             HHHHHHhhcccchhhhHHHhcCCchHHHHHHHccCh--------HHHHHHHHHHHHHhhhhhHHHHHHHhcccchHHHHH
Confidence            99999999 788888999999999999999987766        999999999999998888888888999999999999


Q ss_pred             hcC-CCHHHHHHHHHHHHHhccCChhcHHHHHhCCCHHHHHHhhcCCCHHHHHHHHHHHHHhhcCCcchHHHHHHcCChH
Q 004992          216 LEF-TDTKVQRAAAGALRTLAFKNDENKNQIVECNALPTLILMLRSEDSAIHYEAVGVIGNLVHSSPNIKKEVLAAGALQ  294 (720)
Q Consensus       216 l~~-~~~~v~~~a~~~L~~L~~~~~~~~~~i~~~g~l~~L~~ll~~~~~~v~~~a~~~L~nL~~~~~~~~~~~~~~~~l~  294 (720)
                      +.+ +...++..+++++.+++. +++++..+.+.|+++.|+.++.+++.+++..+++++.+++.....   .....|+++
T Consensus       194 l~~~~~~~~~~~~~~~l~~ls~-~~~~~~~~~~~g~~~~L~~ll~~~~~~~~~~a~~~l~~ls~~~~~---~~~~~~~i~  269 (529)
T d1jdha_         194 MRTYTYEKLLWTTSRVLKVLSV-CSSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATK---QEGMEGLLG  269 (529)
T ss_dssp             HHHCCCHHHHHHHHHHHHHHTT-STTHHHHHHHTTHHHHHHTTTTSSCHHHHHHHHHHHHHHHTTCTT---CSCCHHHHH
T ss_pred             HHhhhhHHHHHHHHHHHhhhhc-cccccchhhhhhhhhhHHHHhcccchhhhhhhhhHHHhccccccc---hhhhhhcch
Confidence            965 457899999999999997 788899999999999999999999999999999999999744332   222357899


Q ss_pred             HHHHhhccCChHHHHHHHHHHHHHhccCcchhhHHHhcCChHHHHHHhc--CCCHHHHHHHHHHHHHHhhhhcC-cchhh
Q 004992          295 PVIGLLSSCCSESQREAALLLGQFAATDSDCKVHIVQRGAVRPLIEMLQ--SPDVQLREMSAFALGRLAQVITD-MHNQA  371 (720)
Q Consensus       295 ~L~~ll~~~~~~~~~~a~~~L~~l~~~~~~~~~~~~~~~~~~~L~~ll~--~~~~~v~~~a~~~L~~l~~~~~~-~~~~~  371 (720)
                      .|+.++.+++..++..++++|.+++..++..+..+.+.++++.++..+.  .+.+.+++.++++|.+++..... ...+.
T Consensus       270 ~Lv~ll~~~~~~~~~~a~~~L~~l~~~~~~~~~~i~~~~~i~~Li~~l~~~~~~~~~~~~a~~aL~~l~~~~~~~~~~~~  349 (529)
T d1jdha_         270 TLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQN  349 (529)
T ss_dssp             HHHHHTTCSCHHHHHHHHHHHHHHTTTCHHHHHHHHHTTHHHHHHHHHHHHTTCHHHHHHHHHHHHHHTSSSTTHHHHHH
T ss_pred             hhhhhcccccHHHHHHHHHHHHhhccchhHHHHHHHHhhhHHHHHHHHHhhhcchhHHHHHHHHhhcccchhhcchhhhh
Confidence            9999999999999999999999999877788888889999999999884  46788999999999999971111 11345


Q ss_pred             hhhhcCCHHHHHHHhcCC-ChhHHHHHHHHHHhcccCCCchhHHHhhcccccccchhhhhhh------------------
Q 004992          372 GIAHNGGLVPLLKLLDSK-NGSLQHNAAFALYGLADNEDNVADFIRVGGVQKLQDGEFIVQA------------------  432 (720)
Q Consensus       372 ~l~~~~~i~~l~~ll~~~-~~~v~~~a~~~L~~l~~~~~~~~~l~~~~~v~~L~~~~~~~~~------------------  432 (720)
                      .+...++++.+++++.++ +..++..++++|.+++.++++...+.+.|+++.|.+.......                  
T Consensus       350 ~i~~~~~l~~L~~ll~~~~~~~~~~~~~~~l~~l~~~~~~~~~l~~~g~i~~L~~lL~~~~~~~~~~~~~~~~~~~~~~~  429 (529)
T d1jdha_         350 AVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEG  429 (529)
T ss_dssp             HHHHTTCHHHHHHTTSTTCCHHHHHHHHHHHHHHTTSGGGHHHHHHTTHHHHHHHHHHHHHHHHC-----------CBTT
T ss_pred             hHHhcccchhHHHHHhccchHHHHHHHHHHHhhcchhhhhhhhhhhcccHHHHHHHHhcCCHHHHHHHHhhhhhHHhhcc
Confidence            577889999999999654 4578889999999999999999999999999887763322110                  


Q ss_pred             -----hHHHHHHHHHHH-------HHhhhhhhHHHHHHHHHhcchhHHHHHHHHHHhhcCCcccchhhhccCcHHHHHHh
Q 004992          433 -----TKDCVAKTLKRL-------EEKIHGRVLNHLLYLMRVAEKGVQRRVALALAHLCSPDDQRTIFIDGGGLELLLGL  500 (720)
Q Consensus       433 -----~~~~~~~~~~~l-------~~~~~~~~~~~L~~ll~~~~~~v~~~a~~~L~~l~~~~~~~~~~~~~~~~~~L~~l  500 (720)
                           ....+...+..+       ......+.++.|+.++.+++++++..++.+|++|+.+++.+..+.+.|+++.|+++
T Consensus       430 ~~~~~~~~~~~~al~~la~~~~~r~~~~~~~~i~~Lv~lL~~~~~~v~~~a~~aL~~L~~~~~~~~~i~~~g~~~~L~~L  509 (529)
T d1jdha_         430 VRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTEL  509 (529)
T ss_dssp             BCHHHHHHHHHHHHHHHTTSHHHHHHHHHTTCHHHHHHGGGCSCHHHHHHHHHHHHHHTTSHHHHHHHHHTTCHHHHHHG
T ss_pred             cchHHHHHHHHHHHHHHccCHHHHHHHHHCCCHHHHHHHhCCCCHHHHHHHHHHHHHHhcChhhHHHHHHCCCHHHHHHH
Confidence                 111112222111       12235678999999999999999999999999999999889999999999999999


Q ss_pred             hcCCCchhhhhHHHHHHHHH
Q 004992          501 LGSTNPKQQLDGAVALFKLA  520 (720)
Q Consensus       501 l~~~~~~v~~~a~~aL~~L~  520 (720)
                      +.++++.+|..|+.+|.+|+
T Consensus       510 l~s~n~~v~~~a~~aL~~ls  529 (529)
T d1jdha_         510 LHSRNEGVATYAAAVLFRMS  529 (529)
T ss_dssp             GGCSSHHHHHHHHHHHHHHC
T ss_pred             hCCCCHHHHHHHHHHHHHhC
Confidence            99999999999999999875



>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2c9wc1 d.42.1.1 (C:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv2a_ d.42.1.1 (A:) Elongin C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1nn7a_ d.42.1.2 (A:) Potassium channel kv4.2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1upka_ a.118.1.15 (A:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1upka_ a.118.1.15 (A:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3kvta_ d.42.1.2 (A:) akv3.1 voltage-gated potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} Back     information, alignment and structure
>d1t1da_ d.42.1.2 (A:) Shaker potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lsha1 a.118.4.1 (A:285-620) Lipovitellin-phosvitin complex, superhelical domain {Lamprey (Ichthyomyzon unicuspis) [TaxId: 30308]} Back     information, alignment and structure
>d1lsha1 a.118.4.1 (A:285-620) Lipovitellin-phosvitin complex, superhelical domain {Lamprey (Ichthyomyzon unicuspis) [TaxId: 30308]} Back     information, alignment and structure
>d1nexa2 d.42.1.1 (A:4-103) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fs1b1 a.157.1.1 (B:86-140) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexa1 a.157.1.1 (A:116-185) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fs1b2 d.42.1.1 (B:2-68) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bnxa1 a.118.1.23 (A:133-475) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bnxa1 a.118.1.23 (A:133-475) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure