Citrus Sinensis ID: 005004

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720
MKAVSLLRNLEALTLGRGQLGDAFFHALADCSMLKSLNVNDATLGNGVQEIPINHDQLRRLEITKCRVMRVSIRCPQLEHLSLKRSNMAQAVLNCPLLHLLDIASCHKLSDAAIRLAATSCPQLESLDMSNCSCVSDESLREIALSCANLRILNSSYCPNISLESVRLPMLTVLQLHSCEGITSASMAAISHSYMLEVLELDNCNLLTSVSLELPRLQNIRLVHCRKFADLNLRAMMLSSIMVSNCAALHRINITSNSLQKLSLQKQENLTSLALQCQCLQEVDLTDCESLTNSVCEVFSDGGGCPMLKSLVLDNCEGLTVVRFCSTSLVSLSLVGCRAITALELKCPILEKVCLDGCDHIESASFVPVALQSLNLGICPKLSTLGIEALHMVVLELKGCGVLSDAYINCPLLTSLDASFCSQLKDDCLSATTTSCPLIESLILMSCQSIGPDGLYSLRSLQNLTMLDLSYTFLTNLEPVFESCLQLKVLKLQACKYLTNTSLESLYKKGSLPALQELDLSYGTLCQSAIEELLAYCTHLTHVSLNGCGNMHDLNWGASGCQPFESPSVYNSCGIFPHENIHESIDQPNRLLQNLNCVGCPNIRKVFIPPQARCFHLSSLNLSLSANLKEVDVACFNLCFLNLSNCCSLETLKLDCPKLTSLFLQSCNIDEEGVESAITQCGMLETLDVRFCPKICSTSMGRLRAACPSLKRIFSSLTTS
cccccccccccEEEcccccccHHHHHHHcccccccEEEEEcccccHHHHHcccccccccEEEEccccccccccccccccEEEcccccHHHHHcccccccEEEEcccccccHHHHHHHHHccccccEEEEcccccccHHHHHHHHHccccccEEEccccccccccccccccccEEccccccccccHHHHHHHccccccEEEccccccccccccccccccEEEccccccccccHHHHHHccccccccccccccccccccccccccccccHHHHHHHHccccccEEEccccccccHHHHHHHHcccccccccEEEccccccccccccccccccEEEccccccHHHHHHccccccEEEccccccccccccccccccEEEccccccccccccccccccEEEEcccccccccccccccccEEEccccccccHHHHHHHHcccccccEEEccccccccHHHHHHccccccccEEEcccccccccHHHHcccccccEEEccccccccHHHHHHHHcccccccccEEEEEcccccHHHHHHHHHccccccEEEEEccccccccccccccccccccccccccccccccHHHHHHHHcccccccEEEEEccccccccccccccccccccEEcccccccccccccccccccEEEccccccccHHccccccccEEEcccccccHHHHHHHHHccccccEEEEcccccccHHHHHHHHHccccccEEEcccccc
ccHHccHHHHHEEEcccccccHHHHHHHHHcccccEEEcccccccccHHHHHHHHccHHcccccHHHHHHHHHHcccccEEccccHHHHHHHHHcccccEEEccccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHHHcccccEEEcccccccccHHcccccccEEEccccccccHHHHHHHHccccccEEEccccccccHHHcccccccEEEccccccccHHHHHHHHHcccccccccccccccccEEcccccccccHHHHHHHHHHcccccEEEccccccccHHHHHHHHHccccccccEEEccccccccHHHHHHHcHHHcccccccHHHHHHHHcccccEEEccccccccHHHHHHHHHHHccccccccccHHHHHHccccEEEccccccccHHHcccccccEEEccccccccHHHHHHHHHHcccccEEEccccccccHHHHHHHHcccccEEEccccccHHHHHHHHHHcccccEEEccccccccHHHHHHHHHcccccccEEEEcccccccHHHHHHHHHHcccccEEEccccccccHHHHHHHHcccccEEEEEccccccccHHHHHHHHHccccccEEEccccccccHHHHHHHHHcccccEEEccccccccHHHHHHHHHccccccccHHHHHHHHHcccccEEEcccccccHHHHHHHHHHcccccEEEccccccccHHHHHHHHHHcccccEEEEccccc
MKAVSLLRNLEALTLGRGQLGDAFFHALADCSmlkslnvndatlgngvqeipinhdQLRRLEITKCRVMrvsircpqlehlsLKRSNMAQAVLNCPLLHLLDIASCHKLSDAAIRLAAtscpqlesldmsncscvsdESLREIALSCANLrilnssycpnislesvrlpmlTVLQLHscegitsaSMAAISHSYMLEVLEldncnlltsvslelprlqnirlvHCRKFADLNLRAMMLSSIMVSNCAALHRINITSNSLQKLSLQKQENLTSLALQCQclqevdltdcesltnsvcevfsdgggcpmlkslvldncegltVVRFCSTSLVSLSLVGCRAITALElkcpilekvcldgcdhiesasfVPVALQslnlgicpklstLGIEALHMVVLELKgcgvlsdayincplltsldasfcsqlkddclsatttscpLIESLILMscqsigpdglysLRSLQNLTMLDLSYTFLTNLEPVFESCLQLKVLKLQACKYLtntsleslykkgslpalqeLDLSYGTLCQSAIEELLAYCTHLthvslngcgnmhdlnwgasgcqpfespsvynscgifphenihesidqpnrllqnlncvgcpnirkvfippqarcfhLSSLNLSLSANLKEVDVACFNLCFlnlsnccsletlkldcpkltslFLQSCNIDEEGVESAITqcgmletldvrfcpkicstsmgrlraaCPSLKRIFSSLTTS
MKAVSLLRNLEALTLGRGQLGDAFFHALADCSMLKSLNVNDATLGNgvqeipinhdqlrRLEITKCRVMRVSIRCPQLEHLSLKRSNMAQAVLNCPLLHLLDIASCHKLSDAAIRLAATSCPQLESLDMSNCSCVSDESLREIALSCANLRILNSSYCPNISLESVRLPMLTVLQLHSCEGITSASMAAISHSYMLEVLELDNCNLLTSVSLELPRLQNIRLVHCRKFADLNLRAMMLSSIMVSNCAALHRINITSNSLQKLSLQKQENLTSLALQCQCLQEVDLTDCESLTNSVCEVFSDGGGCPMLKSLVLDNCEGLTVVRFCSTSLVSLSLVGCRAITALELKCPILEKVCLDGCDHIESASFVPVALQSLNLGICPKLSTLGIEALHMVVLELKGCGVLSDAYINCPLLTSLDASFCSQLKDDCLSATTTSCPLIESLILMSCQSIGPDGLYSLRSLQNLTMLDLSYTFLTNLEPVFESCLQLKVLKLQACKYLTNTSLESLYKKGSLPALQELDLSYGTLCQSAIEELLAYCTHLTHVSLNGCGNMHDLNWGASGCQPFESPSVYNSCGIFPHENIHESIDQPNRLLQNLNCVGCPNIRKVFIPPQARCFHLSSLNLSLSANLKEVDVACFNLCFLNLSNCCSLETLKLDCPKLTSLFLQSCNIDEEGVESAITQCGMLETLDVRFCPKICStsmgrlraacpslkrifssltts
MKAVSLLRNLEALTLGRGQLGDAFFHALADCSMLKSLNVNDATLGNGVQEIPINHDQLRRLEITKCRVMRVSIRCPQLEHLSLKRSNMAQAVLNCPLLHLLDIASCHKLSDAAIRLAATSCPQLESLDMSNCSCVSDESLREIALSCANLRILNSSYCPNISLESVRLPMLTVLQLHSCEGITSASMAAISHSYMLEVLELDNCNLLTSVSLELPRLQNIRLVHCRKFADLNLRAMMLSSIMVSNCAALHRINITSNSLQKLSLQKQENLTSLALQCQCLQEVDLTDCESLTNSVCEVFSDGGGCPMLKSLVLDNCEGLTVVRFCSTSLVSLSLVGCRAITALELKCPILEKVCLDGCDHIESASFVPVALQSLNLGICPKLSTLGIEALHMVVLELKGCGVLSDAYINCPLLTSLDASFCSQLKDDCLSATTTSCPLIESLILMSCQSIGPDGLYSLRSLQNLTMLDLSYTFLTNLEPVFESCLQLKVLKLQACKYLTNTSLESLYKKGSLPALQELDLSYGTLCQSAIEELLAYCTHLTHVSLNGCGNMHDLNWGASGCQPFESPSVYNSCGIFPHENIHESIDQPNRLLQNLNCVGCPNIRKVFIPPQARCFHlsslnlslsanlKEVDVAcfnlcflnlsnccslETLKLDCPKLTSLFLQSCNIDEEGVESAITQCGMLETLDVRFCPKICSTSMGRLRAACPSLKRIFSSLTTS
*****LLRNLEALTLGRGQLGDAFFHALADCSMLKSLNVNDATLGNGVQEIPINHDQLRRLEITKCRVMRVSIRCPQLEHLSLKRSNMAQAVLNCPLLHLLDIASCHKLSDAAIRLAATSCPQLESLDMSNCSCVSDESLREIALSCANLRILNSSYCPNISLESVRLPMLTVLQLHSCEGITSASMAAISHSYMLEVLELDNCNLLTSVSLELPRLQNIRLVHCRKFADLNLRAMMLSSIMVSNCAALHRINITSNSLQKLSLQKQENLTSLALQCQCLQEVDLTDCESLTNSVCEVFSDGGGCPMLKSLVLDNCEGLTVVRFCSTSLVSLSLVGCRAITALELKCPILEKVCLDGCDHIESASFVPVALQSLNLGICPKLSTLGIEALHMVVLELKGCGVLSDAYINCPLLTSLDASFCSQLKDDCLSATTTSCPLIESLILMSCQSIGPDGLYSLRSLQNLTMLDLSYTFLTNLEPVFESCLQLKVLKLQACKYLTNTSLESLYKKGSLPALQELDLSYGTLCQSAIEELLAYCTHLTHVSLNGCGNMHDLNWGASGCQPFESPSVYNSCGIFPHENIHESIDQPNRLLQNLNCVGCPNIRKVFIPPQARCFHLSSLNLSLSANLKEVDVACFNLCFLNLSNCCSLETLKLDCPKLTSLFLQSCNIDEEGVESAITQCGMLETLDVRFCPKICSTSMGRLRAACPSLKRIF******
MKAVSLLRNLEALTLGRGQLGDAFFHALADCSMLKSLNVNDATLGNGVQEIPINHDQLRRLEITKCRVMRVSIRCPQLEHLSLKRSNMAQAVLNCPLLHLLDIASCHKLSDAAIRLAATSCPQLESLDMSNCSCVSDESLREIALSCANLRILNSSYCPNISLESVRLPMLTVLQLHSCEGITSASMAAISHSYMLEVLELDNCNLLTSVSLELPRLQNIRLVHCRKFADLNLRAMMLSSIMVSNCAALHRINITSNSLQKLSLQKQENLTSLALQCQCLQEVDLTDCESLTNSVCEVFSDGGGCPMLKSLVLDNCEGLTVVRFCSTSLVSLSLVGCRAITALELKCPILEKVCLDGCDHIESASFVPVALQSLNLGICPKLSTLGIEALHMVVLELKGCGVLSDAYINCPLLTSLDASFCSQLKDDCLSATTTSCPLIESLILMSCQSIGPDGLYSLRSLQNLTMLDLSYTFLTNLEPVFESCLQLKVLKLQACKYLTNTSLESLYKKGSLPALQELDLSYGTLCQSAIEELLAYCTHLTHVSLNGCGNMHDLNWGASGCQPFESPSVYNSCGIFPHENIHESIDQPNRLLQNLNCVGCPNIRKVFIPPQARCFHLSSLNLSLSANLKEVDVACFNLCFLNLSNCCSLETLKLDCPKLTSLFLQSCNIDEEGVESAITQCGMLETLDVRFCPKICSTSMGRLRAACPSLKRIFSSLT**
MKAVSLLRNLEALTLGRGQLGDAFFHALADCSMLKSLNVNDATLGNGVQEIPINHDQLRRLEITKCRVMRVSIRCPQLEHLSLKRSNMAQAVLNCPLLHLLDIASCHKLSDAAIRLAATSCPQLESLDMSNCSCVSDESLREIALSCANLRILNSSYCPNISLESVRLPMLTVLQLHSCEGITSASMAAISHSYMLEVLELDNCNLLTSVSLELPRLQNIRLVHCRKFADLNLRAMMLSSIMVSNCAALHRINITSNSLQKLSLQKQENLTSLALQCQCLQEVDLTDCESLTNSVCEVFSDGGGCPMLKSLVLDNCEGLTVVRFCSTSLVSLSLVGCRAITALELKCPILEKVCLDGCDHIESASFVPVALQSLNLGICPKLSTLGIEALHMVVLELKGCGVLSDAYINCPLLTSLDASFCSQLKDDCLSATTTSCPLIESLILMSCQSIGPDGLYSLRSLQNLTMLDLSYTFLTNLEPVFESCLQLKVLKLQACKYLTNTSLESLYKKGSLPALQELDLSYGTLCQSAIEELLAYCTHLTHVSLNGCGNMHDLNWGASGCQPFESPSVYNSCGIFPHENIHESIDQPNRLLQNLNCVGCPNIRKVFIPPQARCFHLSSLNLSLSANLKEVDVACFNLCFLNLSNCCSLETLKLDCPKLTSLFLQSCNIDEEGVESAITQCGMLETLDVRFCPKICSTSMGRLRAACPSLKRIFSSLTTS
MKAVSLLRNLEALTLGRGQLGDAFFHALADCSMLKSLNVNDATLGNGVQEIPINHDQLRRLEITKCRVMRVSIRCPQLEHLSLKRSNMAQAVLNCPLLHLLDIASCHKLSDAAIRLAATSCPQLESLDMSNCSCVSDESLREIALSCANLRILNSSYCPNISLESVRLPMLTVLQLHSCEGITSASMAAISHSYMLEVLELDNCNLLTSVSLELPRLQNIRLVHCRKFADLNLRAMMLSSIMVSNCAALHRINITSNSLQKLSLQKQENLTSLALQCQCLQEVDLTDCESLTNSVCEVFSDGGGCPMLKSLVLDNCEGLTVVRFCSTSLVSLSLVGCRAITALELKCPILEKVCLDGCDHIESASFVPVALQSLNLGICPKLSTLGIEALHMVVLELKGCGVLSDAYINCPLLTSLDASFCSQLKDDCLSATTTSCPLIESLILMSCQSIGPDGLYSLRSLQNLTMLDLSYTFLTNLEPVFESCLQLKVLKLQACKYLTNTSLESLYKKGSLPALQELDLSYGTLCQSAIEELLAYCTHLTHVSLNGCGNMHDLNWGASGCQPFESPSVYNSCGIFPHENIHESIDQPNRLLQNLNCVGCPNIRKVFIPPQARCFHLSSLNLSLSANLKEVDVACFNLCFLNLSNCCSLETLKLDCPKLTSLFLQSCNIDEEGVESAITQCGMLETLDVRFCPKICSTSMGRLRAACPSLKRIFSSLT**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKAVSLLRNLEALTLGRGQLGDAFFHALADCSMLKSLNVNDATLGNGVQEIPINHDQLRRLEITKCRVMRVSIRCPQLEHLSLKRSNMAQAVLNCPLLHLLDIASCHKLSDAAIRLAATSCPQLESLDMSNCSCVSDESLREIALSCANLRILNSSYCPNISLESVRLPMLTVLQLHSCEGITSASMAAISHSYMLEVLELDNCNLLTSVSLELPRLQNIRLVHCRKFADLNLRAMMLSSIMVSNCAALHRINITSNSLQKLSLQKQENLTSLALQCQCLQEVDLTDCESLTNSVCEVFSDGGGCPMLKSLVLDNCEGLTVVRFCSTSLVSLSLVGCRAITALELKCPILEKVCLDGCDHIESASFVPVALQSLNLGICPKLSTLGIEALHMVVLELKGCGVLSDAYINCPLLTSLDASFCSQLKDDCLSATTTSCPLIESLILMSCQSIGPDGLYSLRSLQNLTMLDLSYTFLTNLEPVFESCLQLKVLKLQACKYLTNTSLESLYKKGSLPALQELDLSYGTLCQSAIEELLAYCTHLTHVSLNGCGNMHDLNWGASGCQPFESPSVYNSCGIFPHENIHESIDQPNRLLQNLNCVGCPNIRKVFIPPQARCFHLSSLNLSLSANLKEVDVACFNLCFLNLSNCCSLETLKLDCPKLTSLFLQSCNIDEEGVESAITQCGMLETLDVRFCPKICSTSMGRLRAACPSLKRIFSSLTTS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query720 2.2.26 [Sep-21-2011]
Q9SMY8990 F-box/LRR-repeat protein yes no 0.987 0.718 0.744 0.0
Q9C5D2610 F-box/LRR-repeat protein no no 0.540 0.637 0.248 2e-18
A6H779423 F-box/LRR-repeat protein yes no 0.279 0.475 0.298 5e-13
Q96IG2436 F-box/LRR-repeat protein no no 0.358 0.591 0.249 9e-13
Q58DG6436 F-box/LRR-repeat protein no no 0.358 0.591 0.249 9e-13
P34284466 Uncharacterized F-box/LRR yes no 0.373 0.577 0.251 9e-13
Q9CZV8436 F-box/LRR-repeat protein yes no 0.225 0.371 0.292 2e-12
Q8BH16423 F-box/LRR-repeat protein no no 0.268 0.456 0.308 3e-12
Q8NEE6735 F-box/LRR-repeat protein no no 0.511 0.500 0.237 3e-12
Q9SKK0628 EIN3-binding F-box protei no no 0.543 0.622 0.246 3e-12
>sp|Q9SMY8|FBL15_ARATH F-box/LRR-repeat protein 15 OS=Arabidopsis thaliana GN=FBL15 PE=1 SV=2 Back     alignment and function desciption
 Score = 1069 bits (2765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 533/716 (74%), Positives = 616/716 (86%), Gaps = 5/716 (0%)

Query: 1   MKAVSLLRNLEALTLGRGQLGDAFFHALADCSMLKSLNVNDATLGNGVQEIPINHDQLRR 60
           MKA + LRNLE LT+G+G + ++FF AL +C+ML+S+ V+DA LGNG QEI ++HD+LR 
Sbjct: 274 MKAATTLRNLEVLTIGKGHISESFFQALGECNMLRSVTVSDAILGNGAQEIHLSHDRLRE 333

Query: 61  LEITKCRVMRVSIRCPQLEHLSLKRSNMAQAVLNCPLLHLLDIASCHKLSDAAIRLAATS 120
           L+ITKCRVMR+SIRCPQL  LSLKRSNM+QA+LNCPLL LLDIASCHKL DAAIR AA S
Sbjct: 334 LKITKCRVMRLSIRCPQLRSLSLKRSNMSQAMLNCPLLQLLDIASCHKLLDAAIRSAAIS 393

Query: 121 CPQLESLDMSNCSCVSDESLREIALSCANLRILNSSYCPNISLESVRLPMLTVLQLHSCE 180
           CPQLESLD+SNCSCVSDE+LREIA +CANL ILN+SYCPNISLESV LPMLTVL+LHSCE
Sbjct: 394 CPQLESLDVSNCSCVSDETLREIAQACANLHILNASYCPNISLESVHLPMLTVLKLHSCE 453

Query: 181 GITSASMAAISHSYMLEVLELDNCNLLTSVSLELPRLQNIRLVHCRKFADLNLRAMMLSS 240
           GITSASM  I++S  LEVLELDNCNLLT+VSL L RLQ+I LVHCRKF DLNL+++MLSS
Sbjct: 454 GITSASMTWIANSPALEVLELDNCNLLTTVSLHLSRLQSISLVHCRKFTDLNLQSIMLSS 513

Query: 241 IMVSNCAALHRINITSNSLQKLSLQKQENLTSLALQCQCLQEVDLTDCESLTNSVCEVFS 300
           I VSNC AL RI ITSN+L++L+LQKQENLT+L LQC  LQEVDL+DCESL+NSVC++FS
Sbjct: 514 ITVSNCPALRRITITSNALRRLALQKQENLTTLVLQCHSLQEVDLSDCESLSNSVCKIFS 573

Query: 301 DGGGCPMLKSLVLDNCEGLTVVRFCSTSLVSLSLVGCRAITALELKCPILEKVCLDGCDH 360
           D GGCPMLKSL+LDNCE LT VRFC++SL SLSLVGCRA+T+LELKCP +E++CLDGCDH
Sbjct: 574 DDGGCPMLKSLILDNCESLTAVRFCNSSLASLSLVGCRAVTSLELKCPRIEQICLDGCDH 633

Query: 361 IESASFVPVALQSLNLGICPKLSTLGIEALHMVVLELKGCGVLSDAYINCPLLTSLDASF 420
           +E+A F PVAL+SLNLGICPKLS L IEA +MV LELKGCGVLS+A I CPLLTSLDASF
Sbjct: 634 LETAFFQPVALRSLNLGICPKLSVLNIEAPYMVSLELKGCGVLSEASIMCPLLTSLDASF 693

Query: 421 CSQLKDDCLSATTTSCPLIESLILMSCQSIGPDGLYSLRSLQNLTMLDLSYTFLTNLEPV 480
           CSQL+DDCLSATT SCPLIESL+LMSC SIG DGL SL  L NLT+LDLSYTFL NLEPV
Sbjct: 694 CSQLRDDCLSATTASCPLIESLVLMSCPSIGSDGLSSLNGLPNLTVLDLSYTFLMNLEPV 753

Query: 481 FESCLQLKVLKLQACKYLTNTSLESLYKKGSLPALQELDLSYGTLCQSAIEELLAYCTHL 540
           F+SC+QLKVLKLQACKYLT++SLE LYK+G+LPAL+ELDLSYGTLCQ+AI++LLA CTHL
Sbjct: 754 FKSCIQLKVLKLQACKYLTDSSLEPLYKEGALPALEELDLSYGTLCQTAIDDLLACCTHL 813

Query: 541 THVSLNGCGNMHDLNWGASGCQPFESPSVYNSCGIFPHENIHESIDQPNRLLQNLNCVGC 600
           TH+SLNGC NMHDL+WG++    F+   VY+S      +N  E  +  NRLLQNLNCVGC
Sbjct: 814 THLSLNGCVNMHDLDWGSTSVHLFDYFGVYSS-----SDNTQEPAETANRLLQNLNCVGC 868

Query: 601 PNIRKVFIPPQARCFHLSSLNLSLSANLKEVDVACFNLCFLNLSNCCSLETLKLDCPKLT 660
           PNIRKV IPP AR +HLS+LNLSLS NLKEVD+ C NL  LNLSNCCSLE LKL CP+L 
Sbjct: 869 PNIRKVLIPPAARFYHLSTLNLSLSVNLKEVDLTCSNLVLLNLSNCCSLEVLKLGCPRLA 928

Query: 661 SLFLQSCNIDEEGVESAITQCGMLETLDVRFCPKICSTSMGRLRAACPSLKRIFSS 716
           SLFLQSCN+DE GVE+AI+ C  LETLD+RFCPKI S SM + R  CPSLKR+FSS
Sbjct: 929 SLFLQSCNMDEAGVEAAISGCSSLETLDLRFCPKISSVSMSKFRTVCPSLKRVFSS 984

Arabidopsis thaliana (taxid: 3702)
>sp|Q9C5D2|FBL4_ARATH F-box/LRR-repeat protein 4 OS=Arabidopsis thaliana GN=FBL4 PE=2 SV=1 Back     alignment and function description
>sp|A6H779|FBXL2_BOVIN F-box/LRR-repeat protein 2 OS=Bos taurus GN=FBXL2 PE=2 SV=1 Back     alignment and function description
>sp|Q96IG2|FXL20_HUMAN F-box/LRR-repeat protein 20 OS=Homo sapiens GN=FBXL20 PE=1 SV=2 Back     alignment and function description
>sp|Q58DG6|FXL20_BOVIN F-box/LRR-repeat protein 20 OS=Bos taurus GN=FBXL20 PE=2 SV=2 Back     alignment and function description
>sp|P34284|YKK7_CAEEL Uncharacterized F-box/LRR-repeat protein C02F5.7 OS=Caenorhabditis elegans GN=C02F5.7 PE=4 SV=3 Back     alignment and function description
>sp|Q9CZV8|FXL20_MOUSE F-box/LRR-repeat protein 20 OS=Mus musculus GN=Fbxl20 PE=1 SV=3 Back     alignment and function description
>sp|Q8BH16|FBXL2_MOUSE F-box/LRR-repeat protein 2 OS=Mus musculus GN=Fbxl2 PE=1 SV=1 Back     alignment and function description
>sp|Q8NEE6|FXL13_HUMAN F-box/LRR-repeat protein 13 OS=Homo sapiens GN=FBXL13 PE=2 SV=3 Back     alignment and function description
>sp|Q9SKK0|EBF1_ARATH EIN3-binding F-box protein 1 OS=Arabidopsis thaliana GN=EBF1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query720
343887327 1068 F-box / LRR-repeat protein [Citrus unshi 0.954 0.643 0.928 0.0
255550167 997 conserved hypothetical protein [Ricinus 0.8 0.577 0.847 0.0
224141687 957 predicted protein [Populus trichocarpa] 0.995 0.749 0.828 0.0
356552386 975 PREDICTED: F-box/LRR-repeat protein 15-l 0.998 0.737 0.802 0.0
356564031 982 PREDICTED: F-box/LRR-repeat protein 15-l 0.993 0.728 0.792 0.0
356514729 893 PREDICTED: F-box/LRR-repeat protein 15-l 0.994 0.801 0.780 0.0
296081717 957 unnamed protein product [Vitis vinifera] 0.995 0.749 0.801 0.0
297798620 990 predicted protein [Arabidopsis lyrata su 0.987 0.718 0.748 0.0
334187119 990 F-box/LRR-repeat protein 15 [Arabidopsis 0.987 0.718 0.744 0.0
356509840 895 PREDICTED: F-box/LRR-repeat protein 15-l 0.994 0.8 0.765 0.0
>gi|343887327|dbj|BAK61873.1| F-box / LRR-repeat protein [Citrus unshiu] Back     alignment and taxonomy information
 Score = 1319 bits (3414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 686/739 (92%), Positives = 687/739 (92%), Gaps = 52/739 (7%)

Query: 1    MKAVSLLRNLEALTLGRGQLGDAFFHALADCSMLKSLNVNDATLGNGVQEIPINHDQLRR 60
            MKAVSLLRNLEALTLGRGQLGDAFFHALADCSMLKSLNVNDATLGNGVQEIPINHDQLRR
Sbjct: 363  MKAVSLLRNLEALTLGRGQLGDAFFHALADCSMLKSLNVNDATLGNGVQEIPINHDQLRR 422

Query: 61   LEITKCRVMRVSIRCPQLEHLSLKRSNMAQAVLNCPLLHLLDIASCHKLSDAAIRLAATS 120
            LEITKCRVMRVSIRCPQLEHLSLKRSNMAQAVLNCPLLHLLDIASCHKLSDAAIRLAATS
Sbjct: 423  LEITKCRVMRVSIRCPQLEHLSLKRSNMAQAVLNCPLLHLLDIASCHKLSDAAIRLAATS 482

Query: 121  CPQLESLDMSNCSCVSDESLREIALSCANLRILNSSYCPNISLESVRLPMLTVLQLHSCE 180
            CPQLESLDMSNCSCVSDESLREIALSCANLRILNSSYCPNISLE                
Sbjct: 483  CPQLESLDMSNCSCVSDESLREIALSCANLRILNSSYCPNISLE---------------- 526

Query: 181  GITSASMAAISHSYMLEVLELDNCNLLTSVSLELPRLQNIRLVHCRKFADLNLRAMMLSS 240
                             VLELDNCNLLTSVSLELPRLQNIRLVHCRKFADLNLRAMMLSS
Sbjct: 527  -----------------VLELDNCNLLTSVSLELPRLQNIRLVHCRKFADLNLRAMMLSS 569

Query: 241  IMVSNCAALHRINITSNSLQKLSLQKQENLTSLALQCQCLQEVDLTDCESLTNSVCEVFS 300
            IMVSNCAALHRINITSNSLQKLSLQKQENLTSLALQCQCLQEVDLTDCESLTNSVCEVFS
Sbjct: 570  IMVSNCAALHRINITSNSLQKLSLQKQENLTSLALQCQCLQEVDLTDCESLTNSVCEVFS 629

Query: 301  DGGGCPMLKSLVLDNCE-------------------GLTVVRFCSTSLVSLSLVGCRAIT 341
            DGGGCPMLKSLVLDNCE                   GLTVVRFCSTSLVSLSLVGCRAIT
Sbjct: 630  DGGGCPMLKSLVLDNCECEEPCSYDGKHCYIKNEKGGLTVVRFCSTSLVSLSLVGCRAIT 689

Query: 342  ALELKCPILEKVCLDGCDHIESASFVPVALQSLNLGICPKLSTLGIEALHMVVLELKGCG 401
            ALELKCPILEKVCLDGCDHIESASFVPVALQSLNLGICPKLSTLGIEALHMVVLELKGCG
Sbjct: 690  ALELKCPILEKVCLDGCDHIESASFVPVALQSLNLGICPKLSTLGIEALHMVVLELKGCG 749

Query: 402  VLSDAYINCPLLTSLDASFCSQLKDDCLSATTTSCPLIESLILMSCQSIGPDGLYSLRSL 461
            VLSDAYINCPLLTSLDASFCSQLKDDCLSATTTSCPLIESLILMSCQSIGPDGLYSLRSL
Sbjct: 750  VLSDAYINCPLLTSLDASFCSQLKDDCLSATTTSCPLIESLILMSCQSIGPDGLYSLRSL 809

Query: 462  QNLTMLDLSYTFLTNLEPVFESCLQLKVLKLQACKYLTNTSLESLYKKGSLPALQELDLS 521
            QNLTMLDLSYTFLTNLEPVFESCLQLKVLKLQACKYLTNTSLESLYKKGSLPALQELDLS
Sbjct: 810  QNLTMLDLSYTFLTNLEPVFESCLQLKVLKLQACKYLTNTSLESLYKKGSLPALQELDLS 869

Query: 522  YGTLCQSAIEELLAYCTHLTHVSLNGCGNMHDLNWGASGCQPFESPSVYNSCGIFPHENI 581
            YGTLCQSAIEELLAYCTHLTHVSLNGCGNMHDLNWG+SGCQPFESPSVYNSCGIFPHENI
Sbjct: 870  YGTLCQSAIEELLAYCTHLTHVSLNGCGNMHDLNWGSSGCQPFESPSVYNSCGIFPHENI 929

Query: 582  HESIDQPNRLLQNLNCVGCPNIRKVFIPPQARCFHLSSLNLSLSANLKEVDVACFNLCFL 641
            HESIDQPNRLLQNLNCVGCPNIRKVFIPPQARCFHLSSLNLSLSANLKEVDVACFNLCFL
Sbjct: 930  HESIDQPNRLLQNLNCVGCPNIRKVFIPPQARCFHLSSLNLSLSANLKEVDVACFNLCFL 989

Query: 642  NLSNCCSLETLKLDCPKLTSLFLQSCNIDEEGVESAITQCGMLETLDVRFCPKICSTSMG 701
            NLSNCCSLETLKLDCPKLTSLFLQSCNIDEEGVESAITQCGMLETLDVRFCPKICSTSMG
Sbjct: 990  NLSNCCSLETLKLDCPKLTSLFLQSCNIDEEGVESAITQCGMLETLDVRFCPKICSTSMG 1049

Query: 702  RLRAACPSLKRIFSSLTTS 720
            RLRAACPSLKRIFSSLTTS
Sbjct: 1050 RLRAACPSLKRIFSSLTTS 1068

Source: Citrus unshiu

Species: Citrus unshiu

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255550167|ref|XP_002516134.1| conserved hypothetical protein [Ricinus communis] gi|223544620|gb|EEF46136.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|224141687|ref|XP_002324196.1| predicted protein [Populus trichocarpa] gi|222865630|gb|EEF02761.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356552386|ref|XP_003544549.1| PREDICTED: F-box/LRR-repeat protein 15-like [Glycine max] Back     alignment and taxonomy information
>gi|356564031|ref|XP_003550260.1| PREDICTED: F-box/LRR-repeat protein 15-like [Glycine max] Back     alignment and taxonomy information
>gi|356514729|ref|XP_003526056.1| PREDICTED: F-box/LRR-repeat protein 15-like [Glycine max] Back     alignment and taxonomy information
>gi|296081717|emb|CBI20722.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297798620|ref|XP_002867194.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297313030|gb|EFH43453.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|334187119|ref|NP_567916.2| F-box/LRR-repeat protein 15 [Arabidopsis thaliana] gi|124007179|sp|Q9SMY8.2|FBL15_ARATH RecName: Full=F-box/LRR-repeat protein 15 gi|332660791|gb|AEE86191.1| F-box/LRR-repeat protein 15 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356509840|ref|XP_003523653.1| PREDICTED: F-box/LRR-repeat protein 15-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query720
TAIR|locus:505006471610 AT4G15475 "AT4G15475" [Arabido 0.604 0.713 0.253 7e-19
TAIR|locus:2149805665 AT5G01720 "AT5G01720" [Arabido 0.645 0.699 0.247 2.4e-18
DICTYBASE|DDB_G0287415 1012 DDB_G0287415 "SCF E3 ubiquitin 0.623 0.443 0.218 5.9e-18
RGD|1562243422 Fbxl2 "F-box and leucine-rich 0.427 0.729 0.265 3.8e-17
MGI|MGI:1919429423 Fbxl2 "F-box and leucine-rich 0.427 0.728 0.265 3.8e-17
UNIPROTKB|F1PWK1422 FBXL2 "Uncharacterized protein 0.477 0.815 0.258 8.3e-17
UNIPROTKB|F1NHD2423 FBXL2 "Uncharacterized protein 0.466 0.794 0.258 1.8e-16
UNIPROTKB|A6H779423 FBXL2 "F-box/LRR-repeat protei 0.463 0.789 0.262 1.8e-16
UNIPROTKB|Q9UKC9423 FBXL2 "F-box/LRR-repeat protei 0.477 0.813 0.258 1.8e-16
UNIPROTKB|Q5R3Z8423 FBXL2 "F-box/LRR-repeat protei 0.477 0.813 0.258 1.8e-16
TAIR|locus:505006471 AT4G15475 "AT4G15475" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 259 (96.2 bits), Expect = 7.0e-19, P = 7.0e-19
 Identities = 125/494 (25%), Positives = 215/494 (43%)

Query:    78 LEHLSLKRSNMAQAVLNCPLLHLLDIASCHKLSDAAIRLAATSCPQLESLDMSNCSCVSD 137
             +E  SL  + +       P +  L +  C  +S   +   A  C  L+SLD+  C  V D
Sbjct:   122 VESSSLTDTGLTALANGFPRIENLSLIWCPNVSSVGLCSLAQKCTSLKSLDLQGCY-VGD 180

Query:   138 ESLREIALSCANLRILNSSYCPNIS-LESVRLPM-----LTVLQLHSCEGITSASMAAI- 190
             + L  +   C  L  LN  +C  ++ +  + L +     L  + + +   IT  S+ A+ 
Sbjct:   181 QGLAAVGKFCKQLEELNLRFCEGLTDVGVIDLVVGCSKSLKSIGVAASAKITDLSLEAVG 240

Query:   191 SHSYMLEVLELDNCNL----LTSVSLELPRLQNIRLVHCRKFADLNLRAMMLSSIMVSNC 246
             SH  +LEVL LD+  +    L +V+    RL+N++L  C    D+   A+    +    C
Sbjct:   241 SHCKLLEVLYLDSEYIHDKGLIAVAQGCHRLKNLKL-QCVSVTDVAFAAV--GEL----C 293

Query:   247 AALHRINITSNSLQKLSLQKQENLTSLALQCQCLQEVDLTDCESLTNSVCEVFSDGGGCP 306
              +L R+ + S   Q  +    + + ++    + L+++ L+DC  ++    E  + G  C 
Sbjct:   294 TSLERLALYS--FQHFT---DKGMRAIGKGSKKLKDLTLSDCYFVSCKGLEAIAHG--CK 346

Query:   307 MLKSLVLDNCE-----GLTVVRFCSTSLVSLSLVGCRAI--TALE---LKCPILEKVCLD 356
              L+ + ++ C      G+  +      L  L+L+ C+ I  +AL+     C  LE + L 
Sbjct:   347 ELERVEINGCHNIGTRGIEAIGKSCPRLKELALLYCQRIGNSALQEIGKGCKSLEILHLV 406

Query:   357 GCDHIESASFVPVALQSLNLGICPKLSTLGIEALHMVVLELKGCGVLSDAYINCPLLTSL 416
              C  I       +A+ S+  G C  L  L I   +    E+   G++S    +C  LT L
Sbjct:   407 DCSGIGD-----IAMCSIAKG-CRNLKKLHIRRCY----EIGNKGIISIGK-HCKSLTEL 455

Query:   417 DASFCSQLKDDCLSATTTSCPLIESLILMSCQSIGPDGLYSL-RSLQNLTMLDLSYTFLT 475
                FC ++ +  L A    C L + L +  C  I   G+ ++ R    LT LD+S   L 
Sbjct:   456 SLRFCDKVGNKALIAIGKGCSL-QQLNVSGCNQISDAGITAIARGCPQLTHLDISV--LQ 512

Query:   476 N-----LEPVFESCLQLKVLKLQACKYLTNTSLESLYKKGSLPALQELDLSYGTLCQSA- 529
             N     L  + E C  LK L L  C ++T+  L  L +K  L  L+   + Y     SA 
Sbjct:   513 NIGDMPLAELGEGCPMLKDLVLSHCHHITDNGLNHLVQKCKL--LETCHMVYCPGITSAG 570

Query:   530 IEELLAYCTHLTHV 543
             +  +++ C H+  V
Sbjct:   571 VATVVSSCPHIKKV 584
GO:0004842 "ubiquitin-protein ligase activity" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=TAS
GO:0006486 "protein glycosylation" evidence=RCA
TAIR|locus:2149805 AT5G01720 "AT5G01720" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0287415 DDB_G0287415 "SCF E3 ubiquitin ligase complex F-box protein GRR1" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
RGD|1562243 Fbxl2 "F-box and leucine-rich repeat protein 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1919429 Fbxl2 "F-box and leucine-rich repeat protein 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1PWK1 FBXL2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1NHD2 FBXL2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|A6H779 FBXL2 "F-box/LRR-repeat protein 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UKC9 FBXL2 "F-box/LRR-repeat protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5R3Z8 FBXL2 "F-box/LRR-repeat protein 2" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SMY8FBL15_ARATHNo assigned EC number0.74440.98750.7181yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00032274001
SubName- Full=Chromosome chr4 scaffold_6, whole genome shotgun sequence; (888 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query720
cd09293226 cd09293, AMN1, Antagonist of mitotic exit network 9e-15
cd09293226 cd09293, AMN1, Antagonist of mitotic exit network 3e-08
cd09293226 cd09293, AMN1, Antagonist of mitotic exit network 2e-06
cd09293226 cd09293, AMN1, Antagonist of mitotic exit network 1e-05
cd09293226 cd09293, AMN1, Antagonist of mitotic exit network 3e-05
>gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 Back     alignment and domain information 
 Score = 73.9 bits (182), Expect = 9e-15
 Identities = 51/184 (27%), Positives = 84/184 (45%), Gaps = 21/184 (11%)

Query: 49  QEIPINHDQLRRLEITKCRV----MRVSIRCPQLEHLSLKRSN------MAQAVLNCPLL 98
           Q + I H  L  LE+  C +    +     C +L+ L L  S       +     +CP L
Sbjct: 21  QLLRILHSGLEWLELYMCPISDPPLDQLSNCNKLKKLILPGSKLIDDEGLIALAQSCPNL 80

Query: 99  HLLDIASCHKLSDAAIRLAATSCPQLESLDMS---NCSCVSDESLREIALSCANLRILNS 155
            +LD+ +C  ++D+ I   AT+CP+L+++++    N   ++D SL  +  +C  L+ +  
Sbjct: 81  QVLDLRACENITDSGIVALATNCPKLQTINLGRHRNGHLITDVSLSALGKNCTFLQTVGF 140

Query: 156 SYCP-----NISLESVRLPMLTVLQLHSCEGITSASMAAISHSYM---LEVLELDNCNLL 207
           + C         L S     L  L L++C  +T  S+ AI  S     L VLE   C L+
Sbjct: 141 AGCDVTDKGVWELASGCSKSLERLSLNNCRNLTDQSIPAILASNYFPNLSVLEFRGCPLI 200

Query: 208 TSVS 211
           T  S
Sbjct: 201 TDFS 204

Amn1 has been functionally characterized in Saccharomyces cerevisiae as a component of the Antagonist of MEN pathway (AMEN). The AMEN network is activated by MEN (mitotic exit network) via an active Cdc14, and in turn switches off MEN. Amn1 constitutes one of the alternative mechanisms by which MEN may be disrupted. Specifically, Amn1 binds Tem1 (Termination of M-phase, a GTPase that belongs to the RAS superfamily), and disrupts its association with Cdc15, the primary downstream target. Amn1 is a leucine-rich repeat (LRR) protein, with 12 repeats in the S. cerevisiae ortholog. As a negative regulator of the signal transduction pathway MEN, overexpression of AMN1 slows the growth of wild type cells. The function of the vertebrate members of this family has not been determined experimentally, they have fewer LRRs that determine the extent of this model. Length = 226
>gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 Back     alignment and domain information
>gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 Back     alignment and domain information
>gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 Back     alignment and domain information
>gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 720
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.94
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.92
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.92
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.9
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.9
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.9
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.87
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.85
PLN032101153 Resistant to P. syringae 6; Provisional 99.8
PLN032101153 Resistant to P. syringae 6; Provisional 99.77
KOG4341483 consensus F-box protein containing LRR [General fu 99.67
KOG4341483 consensus F-box protein containing LRR [General fu 99.63
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.54
KOG4237498 consensus Extracellular matrix protein slit, conta 99.51
KOG4237498 consensus Extracellular matrix protein slit, conta 99.47
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.44
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.41
KOG0617264 consensus Ras suppressor protein (contains leucine 99.39
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.38
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.2
KOG0617264 consensus Ras suppressor protein (contains leucine 99.17
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.12
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.09
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.09
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.01
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.99
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.97
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.97
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.93
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.87
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.85
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.82
KOG1947482 consensus Leucine rich repeat proteins, some prote 98.73
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.66
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.63
KOG1947482 consensus Leucine rich repeat proteins, some prote 98.6
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.52
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.42
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.34
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.3
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 98.24
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.19
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.18
PLN03150623 hypothetical protein; Provisional 98.17
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.17
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.14
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.05
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.92
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.91
PLN03150623 hypothetical protein; Provisional 97.89
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.84
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.83
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.73
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.63
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.62
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.53
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.46
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.44
PRK15386426 type III secretion protein GogB; Provisional 97.42
PRK15386426 type III secretion protein GogB; Provisional 97.11
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 96.84
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.82
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 96.77
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.72
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.61
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.6
KOG3864221 consensus Uncharacterized conserved protein [Funct 96.47
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.4
KOG3864221 consensus Uncharacterized conserved protein [Funct 96.3
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.31
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 94.99
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 92.8
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 92.7
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 92.66
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.24
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 89.76
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 89.72
KOG4308478 consensus LRR-containing protein [Function unknown 89.19
KOG4308478 consensus LRR-containing protein [Function unknown 86.65
smart0037026 LRR Leucine-rich repeats, outliers. 83.26
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 83.26
smart0037026 LRR Leucine-rich repeats, outliers. 81.73
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 81.73
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 81.05
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.1e-39  Score=384.57  Aligned_cols=523  Identities=19%  Similarity=0.196  Sum_probs=335.6

Q ss_pred             CcCCeeecCCCCCchhhHHhhhcCCCCcEEEeCCCccCCccccccc-ccCCCcEEEccccccee-ee-ccCCCccEEecc
Q 005004            8 RNLEALTLGRGQLGDAFFHALADCSMLKSLNVNDATLGNGVQEIPI-NHDQLRRLEITKCRVMR-VS-IRCPQLEHLSLK   84 (720)
Q Consensus         8 ~~L~~L~l~~~~i~~~~~~~~~~~~~L~~L~l~~~~l~~~~~~~~~-~l~~L~~L~l~~~~~~~-~~-~~~~~L~~L~l~   84 (720)
                      .+++.|+++++.+++..+.+|..+++|++|++++|.+.+.+|..+. .+++|++|++++|.+.. ++ +.+++|++|+++
T Consensus        69 ~~v~~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~~~l~~L~~L~Ls  148 (968)
T PLN00113         69 SRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRGSIPNLETLDLS  148 (968)
T ss_pred             CcEEEEEecCCCccccCChHHhCCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCccccccCccccCCCCEEECc
Confidence            4688899999888888888899999999999999988777776655 78889999998888753 33 357778888887


Q ss_pred             CcchH----HHHhcCCCceEEeeccccCcchhhHHHHhhcCCCCCEEEecCCCCCchhhHHHHHHhcCccceeeccCCC-
Q 005004           85 RSNMA----QAVLNCPLLHLLDIASCHKLSDAAIRLAATSCPQLESLDMSNCSCVSDESLREIALSCANLRILNSSYCP-  159 (720)
Q Consensus        85 ~~~~~----~~~~~l~~L~~L~l~~~~~l~~~~l~~~~~~l~~L~~L~l~~~~~l~~~~~~~~~~~l~~L~~L~l~~~~-  159 (720)
                      +|.+.    ..+.++++|++|++++|. +. ..+|..+.++++|++|++++|. +....+..+. .+++|+.|++++|. 
T Consensus       149 ~n~~~~~~p~~~~~l~~L~~L~L~~n~-l~-~~~p~~~~~l~~L~~L~L~~n~-l~~~~p~~l~-~l~~L~~L~L~~n~l  224 (968)
T PLN00113        149 NNMLSGEIPNDIGSFSSLKVLDLGGNV-LV-GKIPNSLTNLTSLEFLTLASNQ-LVGQIPRELG-QMKSLKWIYLGYNNL  224 (968)
T ss_pred             CCcccccCChHHhcCCCCCEEECccCc-cc-ccCChhhhhCcCCCeeeccCCC-CcCcCChHHc-CcCCccEEECcCCcc
Confidence            77664    456777777777777764 33 2456667777777777777776 5545555555 66777777777665 


Q ss_pred             --CCccccccCCcCcEEeccCCCCCchhhHHHhhccccccEEeccCCccccccccccccccceecccccccccchhhhcc
Q 005004          160 --NISLESVRLPMLTVLQLHSCEGITSASMAAISHSYMLEVLELDNCNLLTSVSLELPRLQNIRLVHCRKFADLNLRAMM  237 (720)
Q Consensus       160 --~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~L~~l~~~~~~~l~~~~l~~~~  237 (720)
                        .+|..++++++|++|++++ +.+.+..+..+.++++|++|++++|.+.+.+|..                        
T Consensus       225 ~~~~p~~l~~l~~L~~L~L~~-n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~------------------------  279 (968)
T PLN00113        225 SGEIPYEIGGLTSLNHLDLVY-NNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPS------------------------  279 (968)
T ss_pred             CCcCChhHhcCCCCCEEECcC-ceeccccChhHhCCCCCCEEECcCCeeeccCchh------------------------
Confidence              4555666667777777766 3555555666666666666666666544433321                        


Q ss_pred             cceeeccCCCcccEEEeccCcccccccccchhhHHHHhhCCCceEEecCCCcccchhhhhhhcCCCCCCCccEEEeccCC
Q 005004          238 LSSIMVSNCAALHRINITSNSLQKLSLQKQENLTSLALQCQCLQEVDLTDCESLTNSVCEVFSDGGGCPMLKSLVLDNCE  317 (720)
Q Consensus       238 l~~l~~~~~~~L~~l~l~~~~~~~~~~~~~~~l~~l~~~~~~L~~L~l~~c~~l~~~~~~~~~~~~~~~~L~~L~l~~~~  317 (720)
                           +.++++|+++++++|.+.+..+..+.       .+++|+.|++++ |.+++..+..+   ..+++|+.|++++|.
T Consensus       280 -----l~~l~~L~~L~Ls~n~l~~~~p~~~~-------~l~~L~~L~l~~-n~~~~~~~~~~---~~l~~L~~L~L~~n~  343 (968)
T PLN00113        280 -----IFSLQKLISLDLSDNSLSGEIPELVI-------QLQNLEILHLFS-NNFTGKIPVAL---TSLPRLQVLQLWSNK  343 (968)
T ss_pred             -----HhhccCcCEEECcCCeeccCCChhHc-------CCCCCcEEECCC-CccCCcCChhH---hcCCCCCEEECcCCC
Confidence                 23344555566665555443222221       235666666665 35555444444   455566666665554


Q ss_pred             CCceeccccCCceeEeecCCCccccccccCCcccEEeccCCCccccccccccccceeccCCCCCCcccccccceeeeeee
Q 005004          318 GLTVVRFCSTSLVSLSLVGCRAITALELKCPILEKVCLDGCDHIESASFVPVALQSLNLGICPKLSTLGIEALHMVVLEL  397 (720)
Q Consensus       318 ~l~~~~~~~~~l~~l~l~~~~~l~~l~~~~~~L~~l~l~~~~~l~~~~~~p~~L~~L~~~~~~~L~~l~l~~~~l~~l~~  397 (720)
                      -..                                             .+|..     +..+++|+.++++.|.++    
T Consensus       344 l~~---------------------------------------------~~p~~-----l~~~~~L~~L~Ls~n~l~----  369 (968)
T PLN00113        344 FSG---------------------------------------------EIPKN-----LGKHNNLTVLDLSTNNLT----  369 (968)
T ss_pred             CcC---------------------------------------------cCChH-----HhCCCCCcEEECCCCeeE----
Confidence            111                                             12222     345566666677666654    


Q ss_pred             cCcccccccccCCCCccEEeccCCCCCcchhhhhhhccCCCccEEeecCCCCCCchhhHHhhcCCCCCeeecCCcccCC-
Q 005004          398 KGCGVLSDAYINCPLLTSLDASFCSQLKDDCLSATTTSCPLIESLILMSCQSIGPDGLYSLRSLQNLTMLDLSYTFLTN-  476 (720)
Q Consensus       398 ~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~-  476 (720)
                         +.+|..+..+++|+.|++++|. +. ..++..+..+++|+.|++++|.+.... +..+..++.|+.|++++|.+.+ 
T Consensus       370 ---~~~p~~~~~~~~L~~L~l~~n~-l~-~~~p~~~~~~~~L~~L~L~~n~l~~~~-p~~~~~l~~L~~L~Ls~N~l~~~  443 (968)
T PLN00113        370 ---GEIPEGLCSSGNLFKLILFSNS-LE-GEIPKSLGACRSLRRVRLQDNSFSGEL-PSEFTKLPLVYFLDISNNNLQGR  443 (968)
T ss_pred             ---eeCChhHhCcCCCCEEECcCCE-ec-ccCCHHHhCCCCCCEEECcCCEeeeEC-ChhHhcCCCCCEEECcCCcccCc
Confidence               5566666667777777777763 32 225555667777888888777765543 4567777788888888887775 


Q ss_pred             hhHHHhccccccEEEcCCCCCCChhHHHHHHhcCCCCCcceeecCCCccchHHHHHHHhhCCCCcEEeccCccCcccccc
Q 005004          477 LEPVFESCLQLKVLKLQACKYLTNTSLESLYKKGSLPALQELDLSYGTLCQSAIEELLAYCTHLTHVSLNGCGNMHDLNW  556 (720)
Q Consensus       477 l~~~~~~~~~L~~L~l~~~~~l~~~~~~~l~~~~~~~~L~~L~l~~~~i~~~~~~~~l~~~~~L~~L~l~~~~~l~~~~~  556 (720)
                      ++..+..+++|+.|++++|. +.+..+..    ...++|+.|++++|++++ .++..+..+++|+.|++++|.....   
T Consensus       444 ~~~~~~~l~~L~~L~L~~n~-~~~~~p~~----~~~~~L~~L~ls~n~l~~-~~~~~~~~l~~L~~L~Ls~N~l~~~---  514 (968)
T PLN00113        444 INSRKWDMPSLQMLSLARNK-FFGGLPDS----FGSKRLENLDLSRNQFSG-AVPRKLGSLSELMQLKLSENKLSGE---  514 (968)
T ss_pred             cChhhccCCCCcEEECcCce-eeeecCcc----cccccceEEECcCCccCC-ccChhhhhhhccCEEECcCCcceee---
Confidence            34466677788888888776 44332332    235677888888887776 5666677777788888887752211   


Q ss_pred             cccCCCCCCCCccccccccCCCcccccccccchhccccccccCCCCccccCcC-CccccCCccEEEcCCCc---ChHHHH
Q 005004          557 GASGCQPFESPSVYNSCGIFPHENIHESIDQPNRLLQNLNCVGCPNIRKVFIP-PQARCFHLSSLNLSLSA---NLKEVD  632 (720)
Q Consensus       557 ~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~L~~l~l~~c~~l~~~~~~-~~~~~~~L~~L~l~~~~---~l~~~~  632 (720)
                                                                         +| .+..+++|++|+++++.   .++...
T Consensus       515 ---------------------------------------------------~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~  543 (968)
T PLN00113        515 ---------------------------------------------------IPDELSSCKKLVSLDLSHNQLSGQIPASF  543 (968)
T ss_pred             ---------------------------------------------------CChHHcCccCCCEEECCCCcccccCChhH
Confidence                                                               11 14455667777777543   233344


Q ss_pred             hhCCCccEEecccccchhhhhh---cCCcccEEEeecccCChhhHHHHHhcCCCcceEeccCCcCCCc
Q 005004          633 VACFNLCFLNLSNCCSLETLKL---DCPKLTSLFLQSCNIDEEGVESAITQCGMLETLDVRFCPKICS  697 (720)
Q Consensus       633 ~~~~~L~~L~l~~~~~L~~l~~---~~~~L~~L~l~~~~i~~~~~~~~~~~~~~L~~L~l~~c~~l~~  697 (720)
                      ..+++|+.|++++|.....++.   .+++|+.|++++|++. ..+|. ...+..+....+.+|+.++.
T Consensus       544 ~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~-~~~p~-~~~~~~~~~~~~~~n~~lc~  609 (968)
T PLN00113        544 SEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLH-GSLPS-TGAFLAINASAVAGNIDLCG  609 (968)
T ss_pred             hCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcce-eeCCC-cchhcccChhhhcCCccccC
Confidence            5678888899988875544443   3577888899988875 34443 13334555566677766554

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query720
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-35
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-27
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-27
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 6e-20
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 6e-18
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-04
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 2e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-32
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 7e-30
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 7e-28
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-26
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 6e-16
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-06
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 9e-26
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 5e-22
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-19
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-16
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 9e-12
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-11
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 6e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-17
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-08
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-06
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-12
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-12
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-12
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-12
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-12
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-12
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-10
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-11
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-09
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-11
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 7e-06
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 3e-10
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 4e-09
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 5e-09
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 3e-08
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 2e-07
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 3e-07
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 4e-06
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 3e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-10
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-06
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-04
1o6v_A 466 Internalin A; bacterial infection, extracellular r 8e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-04
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-07
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 4e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-04
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-04
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-04
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-04
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-04
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-04
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-04
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-04
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 1e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-04
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
 Score =  141 bits (357), Expect = 2e-35
 Identities = 81/529 (15%), Positives = 152/529 (28%), Gaps = 68/529 (12%)

Query: 70  RVSIRCPQLEHLSLK-------------------RSNMAQAVLNCPLLHLLDIASCHKLS 110
           R+S R P L  L LK                      + +   N   L  +         
Sbjct: 67  RLSRRFPNLRSLKLKGKPRAAMFNLIPENWGGYVTPWVTEISNNLRQLKSVHFRRMIVSD 126

Query: 111 DAAIRLAATSCPQLESLDMSNCSCVSDESLREIALSCANLRILNSSYCPNISLESVRL-- 168
               RLA      LE+L +  CS  + + L  I   C  ++ L          +   L  
Sbjct: 127 LDLDRLAKARADDLETLKLDKCSGFTTDGLLSIVTHCRKIKTLLMEESSFSEKDGKWLHE 186

Query: 169 -----PMLTVLQLH--SCEGITSASMAAI-SHSYMLEVLELDNCNLLTSVSL-----ELP 215
                  L VL  +      I+   +  I  +   L  +++ +  +L  V        L 
Sbjct: 187 LAQHNTSLEVLNFYMTEFAKISPKDLETIARNCRSLVSVKVGDFEILELVGFFKAAANLE 246

Query: 216 RLQNIRLVHCRKFADLNLRAMMLSSIMVSNC-----AALHRINITSNSLQKLSLQKQENL 270
                 L       +  +  +    +            +  +   +  ++KL L      
Sbjct: 247 EFCGGSLNEDIGMPEKYMNLVFPRKLCRLGLSYMGPNEMPILFPFAAQIRKLDLLYALLE 306

Query: 271 T----SLALQCQCLQEVDLTDCESLTNSVCEVFSDGGGCPMLKSLVLDNCEGLTVVRFCS 326
           T    +L  +C  L+ ++  +   + +   EV +    C  LK L ++            
Sbjct: 307 TEDHCTLIQKCPNLEVLETRNV--IGDRGLEVLAQ--YCKQLKRLRIERGADEQ------ 356

Query: 327 TSLVSLSLVGCRAITALELKCPILEKVCLDGCDHIESASFVPVALQSLNLGICPKLSTLG 386
                  LV  R + AL   C  LE + +     I + S   +            L    
Sbjct: 357 GMEDEEGLVSQRGLIALAQGCQELEYMAVY-VSDITNESLESIGTY------LKNLCDFR 409

Query: 387 IEALHMV--VLELKGCGVLSDAYINCPLLTSLDASF-CSQLKDDCLSATTTSCPLIESLI 443
           +  L     + +L     +    I C  L           L D  LS      P +  ++
Sbjct: 410 LVLLDREERITDLPLDNGVRSLLIGCKKLRRFAFYLRQGGLTDLGLSYIGQYSPNVRWML 469

Query: 444 LMSCQSIGPDGLYSLRSLQNLTMLDLSYTFLTN--LEPVFESCLQLKVLKLQACKYLTNT 501
           L          +   R   NL  L++     +   +         L+ L +Q  +  + T
Sbjct: 470 LGYVGESDEGLMEFSRGCPNLQKLEMRGCCFSERAIAAAVTKLPSLRYLWVQGYR-ASMT 528

Query: 502 SLESLYKKGSLPALQELDLSY-GTLCQSAIEELLAYCTHL-THVSLNGC 548
             + +        ++ +       + Q      + +  H+  + SL G 
Sbjct: 529 GQDLMQMARPYWNIELIPSRRVPEVNQQGEIREMEHPAHILAYYSLAGQ 577
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query720
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.98
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.97
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.97
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.97
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.96
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.96
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.96
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.95
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.95
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.95
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.95
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.95
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.94
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.94
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.94
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.94
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.94
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.93
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.93
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.93
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.93
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.92
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.91
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.91
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.91
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.9
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.89
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.89
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.86
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.86
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.85
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.84
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.84
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.83
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.83
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.81
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.8
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.78
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.78
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.77
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.77
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.77
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.76
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.76
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.76
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.76
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.75
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.75
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.75
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.75
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.74
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.74
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.74
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.74
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.73
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.72
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.71
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.71
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.71
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.69
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.68
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.68
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.66
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.63
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.63
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.63
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.63
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.63
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.61
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.61
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.6
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.6
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.59
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.57
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.53
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.52
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.51
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.47
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.47
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.46
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.44
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.42
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.42
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.4
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.4
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.39
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.39
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.37
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.37
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.36
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.36
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.35
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.35
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.34
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.33
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.33
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.32
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.32
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.32
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.31
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.31
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.29
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.27
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.26
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.25
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.25
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.22
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.2
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.18
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.17
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.14
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.12
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.12
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.1
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.08
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.05
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.02
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.01
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 99.0
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.0
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.97
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.91
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.89
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.81
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.74
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.74
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.73
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.73
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.71
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.63
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.58
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.55
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.49
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.39
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.38
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.31
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.26
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.04
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.7
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.69
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.06
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.05
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 92.29
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=1.4e-45  Score=422.47  Aligned_cols=615  Identities=18%  Similarity=0.158  Sum_probs=361.1

Q ss_pred             cccccCcCCeeecCCCCCchhhHHhhhcCCCCcEEEeCCCccCCcccc--cccccCCCcEEEcccccceeee-----ccC
Q 005004            3 AVSLLRNLEALTLGRGQLGDAFFHALADCSMLKSLNVNDATLGNGVQE--IPINHDQLRRLEITKCRVMRVS-----IRC   75 (720)
Q Consensus         3 ~~~~~~~L~~L~l~~~~i~~~~~~~~~~~~~L~~L~l~~~~l~~~~~~--~~~~l~~L~~L~l~~~~~~~~~-----~~~   75 (720)
                      +|.++++|+.++++.+.+.. .+..|..+++|++|+|++|.+.+.+|.  .++++++|++|++++|.+....     ..+
T Consensus        72 ~l~~L~~L~~l~~~~~~~~~-l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l  150 (768)
T 3rgz_A           72 SLLSLTGLESLFLSNSHING-SVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKL  150 (768)
T ss_dssp             HTTTCTTCCEEECTTSCEEE-CCCCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEECCSSCCSCCCC
T ss_pred             hHhccCcccccCCcCCCcCC-CchhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCccCCcCCHHHhccC
Confidence            46677778888887776642 456788888888888888888777777  7888888888888888875321     467


Q ss_pred             CCccEEeccCcchH----HH---HhcCCCceEEeeccccCcchhhHHHHhhcCCCCCEEEecCCCCCchhhHHHHHHhcC
Q 005004           76 PQLEHLSLKRSNMA----QA---VLNCPLLHLLDIASCHKLSDAAIRLAATSCPQLESLDMSNCSCVSDESLREIALSCA  148 (720)
Q Consensus        76 ~~L~~L~l~~~~~~----~~---~~~l~~L~~L~l~~~~~l~~~~l~~~~~~l~~L~~L~l~~~~~l~~~~~~~~~~~l~  148 (720)
                      ++|++|++++|.+.    ..   +.++++|++|++++|. ++. ..  .+..+++|++|++++|. +....+. +. .++
T Consensus       151 ~~L~~L~Ls~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~-l~~-~~--~~~~l~~L~~L~Ls~n~-l~~~~~~-l~-~l~  223 (768)
T 3rgz_A          151 NSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNK-ISG-DV--DVSRCVNLEFLDVSSNN-FSTGIPF-LG-DCS  223 (768)
T ss_dssp             TTCSEEECCSSCCEEETHHHHHHTTCCTTCCEEECCSSE-EES-CC--BCTTCTTCCEEECCSSC-CCSCCCB-CT-TCC
T ss_pred             CCCCEEECCCCccCCcCChhhhhhccCCCCCEEECCCCc-ccc-cC--CcccCCcCCEEECcCCc-CCCCCcc-cc-cCC
Confidence            88888888888775    22   6788888888888885 442 11  12778888888888887 5443333 43 788


Q ss_pred             ccceeeccCCC---CCccccccCCcCcEEeccCCCCCchhhHHHhhccccccEEeccCCccccccccccccccceecccc
Q 005004          149 NLRILNSSYCP---NISLESVRLPMLTVLQLHSCEGITSASMAAISHSYMLEVLELDNCNLLTSVSLELPRLQNIRLVHC  225 (720)
Q Consensus       149 ~L~~L~l~~~~---~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~L~~l~~~~~  225 (720)
                      +|++|++++|.   .+|..+.++++|++|+++++ .+.+..+..  .+++|++|++++|.+.+.+|..+..       .|
T Consensus       224 ~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L~Ls~n-~l~~~~~~~--~l~~L~~L~L~~n~l~~~ip~~~~~-------~~  293 (768)
T 3rgz_A          224 ALQHLDISGNKLSGDFSRAISTCTELKLLNISSN-QFVGPIPPL--PLKSLQYLSLAENKFTGEIPDFLSG-------AC  293 (768)
T ss_dssp             SCCEEECCSSCCCSCHHHHTTTCSSCCEEECCSS-CCEESCCCC--CCTTCCEEECCSSEEEESCCCCSCT-------TC
T ss_pred             CCCEEECcCCcCCCcccHHHhcCCCCCEEECCCC-cccCccCcc--ccCCCCEEECcCCccCCccCHHHHh-------hc
Confidence            88888888886   45667888888888888884 555443332  6788889999888877776654321       12


Q ss_pred             cccccchhhhccccee---eccCCCcccEEEeccCcccccccccchhhHHHHhhCCCceEEecCCCcccchhhhhhhcCC
Q 005004          226 RKFADLNLRAMMLSSI---MVSNCAALHRINITSNSLQKLSLQKQENLTSLALQCQCLQEVDLTDCESLTNSVCEVFSDG  302 (720)
Q Consensus       226 ~~l~~~~l~~~~l~~l---~~~~~~~L~~l~l~~~~~~~~~~~~~~~l~~l~~~~~~L~~L~l~~c~~l~~~~~~~~~~~  302 (720)
                      ++++.++++++.+...   .+.++++|+++++++|.+.+..+..      ....+++|++|++++ +.+++..+..+   
T Consensus       294 ~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~ip~~------~l~~l~~L~~L~Ls~-n~l~~~~p~~l---  363 (768)
T 3rgz_A          294 DTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNFSGELPMD------TLLKMRGLKVLDLSF-NEFSGELPESL---  363 (768)
T ss_dssp             TTCSEEECCSSEEEECCCGGGGGCTTCCEEECCSSEEEEECCHH------HHTTCTTCCEEECCS-SEEEECCCTTH---
T ss_pred             CcCCEEECcCCcCCCccchHHhcCCCccEEECCCCcccCcCCHH------HHhcCCCCCEEeCcC-CccCccccHHH---
Confidence            2333344444444322   5778899999999999887543322      112458999999999 57776666655   


Q ss_pred             CCCC-CccEEEeccCCCCceeccccCCceeEeecCCCcccccc-ccCCcccEEeccCCCccccccccccccceeccCCCC
Q 005004          303 GGCP-MLKSLVLDNCEGLTVVRFCSTSLVSLSLVGCRAITALE-LKCPILEKVCLDGCDHIESASFVPVALQSLNLGICP  380 (720)
Q Consensus       303 ~~~~-~L~~L~l~~~~~l~~~~~~~~~l~~l~l~~~~~l~~l~-~~~~~L~~l~l~~~~~l~~~~~~p~~L~~L~~~~~~  380 (720)
                      ..++ +|++|++++|.-...++.                 .+. ..+++|+++++++|.-.+   .+|..     +.+++
T Consensus       364 ~~l~~~L~~L~Ls~N~l~~~~~~-----------------~~~~~~~~~L~~L~L~~n~l~~---~~p~~-----l~~l~  418 (768)
T 3rgz_A          364 TNLSASLLTLDLSSNNFSGPILP-----------------NLCQNPKNTLQELYLQNNGFTG---KIPPT-----LSNCS  418 (768)
T ss_dssp             HHHTTTCSEEECCSSEEEEECCT-----------------TTTCSTTCCCCEEECCSSEEEE---ECCGG-----GGGCT
T ss_pred             HhhhcCCcEEEccCCCcCCCcCh-----------------hhhhcccCCccEEECCCCcccc---ccCHH-----HhcCC
Confidence            4455 899999998852111110                 000 013455666666553221   22332     45566


Q ss_pred             CCcccccccceeeeeeecCcccccccccCCCCccEEeccCCCCCcchhhhhhhccCCCccEEeecCCCCCCchhhHHhhc
Q 005004          381 KLSTLGIEALHMVVLELKGCGVLSDAYINCPLLTSLDASFCSQLKDDCLSATTTSCPLIESLILMSCQSIGPDGLYSLRS  460 (720)
Q Consensus       381 ~L~~l~l~~~~l~~l~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~  460 (720)
                      +|+.+++++|.++       +.+|..+..+++|+.|++++|. +. ..++..+..+++|++|++++|.+.... +..+..
T Consensus       419 ~L~~L~Ls~N~l~-------~~~p~~l~~l~~L~~L~L~~n~-l~-~~~p~~~~~l~~L~~L~L~~N~l~~~~-p~~l~~  488 (768)
T 3rgz_A          419 ELVSLHLSFNYLS-------GTIPSSLGSLSKLRDLKLWLNM-LE-GEIPQELMYVKTLETLILDFNDLTGEI-PSGLSN  488 (768)
T ss_dssp             TCCEEECCSSEEE-------SCCCGGGGGCTTCCEEECCSSC-CC-SCCCGGGGGCTTCCEEECCSSCCCSCC-CGGGGG
T ss_pred             CCCEEECcCCccc-------CcccHHHhcCCCCCEEECCCCc-cc-CcCCHHHcCCCCceEEEecCCcccCcC-CHHHhc
Confidence            6666666666654       4566666666666666666663 22 124455566666666666666655433 445666


Q ss_pred             CCCCCeeecCCcccCC-hhHHHhccccccEEEcCCCCCCChhHHHHHHhcCCCCCcceeecCCCccchHHHHHHHhhCCC
Q 005004          461 LQNLTMLDLSYTFLTN-LEPVFESCLQLKVLKLQACKYLTNTSLESLYKKGSLPALQELDLSYGTLCQSAIEELLAYCTH  539 (720)
Q Consensus       461 ~~~L~~L~l~~~~~~~-l~~~~~~~~~L~~L~l~~~~~l~~~~~~~l~~~~~~~~L~~L~l~~~~i~~~~~~~~l~~~~~  539 (720)
                      +++|++|++++|++.+ +|..+..+++|+.|++++|+ +++..+..+   ..+++|+.|++++|++++ .+|..+.....
T Consensus       489 l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~-l~~~~p~~l---~~l~~L~~L~Ls~N~l~g-~ip~~~~~~~~  563 (768)
T 3rgz_A          489 CTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNS-FSGNIPAEL---GDCRSLIWLDLNTNLFNG-TIPAAMFKQSG  563 (768)
T ss_dssp             CTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSC-CEEECCGGG---GGCTTCCEEECCSSEEES-BCCGGGGTTTT
T ss_pred             CCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCc-ccCcCCHHH---cCCCCCCEEECCCCccCC-cCChHHhcccc
Confidence            6666666666666663 55566666666666666665 544444443   456666666666666654 34444444444


Q ss_pred             CcEEeccCccCcccccccccCCCCCCCCccccccccCCCcccccccccchhccccccccCCCCccccCcCCccccCCccE
Q 005004          540 LTHVSLNGCGNMHDLNWGASGCQPFESPSVYNSCGIFPHENIHESIDQPNRLLQNLNCVGCPNIRKVFIPPQARCFHLSS  619 (720)
Q Consensus       540 L~~L~l~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~L~~l~l~~c~~l~~~~~~~~~~~~~L~~  619 (720)
                      +..+.+........+..............+....+..      .........+..+++.. ..+.....+.+..+++|+.
T Consensus       564 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~l~~~~~~~l~~-~~~~g~~~~~~~~l~~L~~  636 (768)
T 3rgz_A          564 KIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIR------SEQLNRLSTRNPCNITS-RVYGGHTSPTFDNNGSMMF  636 (768)
T ss_dssp             CBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCC------GGGGGGGGGTCCSCTTS-CEEEEECCCSCSSSBCCCE
T ss_pred             hhhhhcccccccccccccccccccccccccccccccc------chhhhcccccccccccc-ceecccCchhhhccccccE
Confidence            4333333221111110000000000000000000000      00000000111111110 0111111122556667777


Q ss_pred             EEcCCCc---ChHHHHhhCCCccEEecccccchhhhh---hcCCcccEEEeecccCChhhHHHHHhcCCCcceEeccCCc
Q 005004          620 LNLSLSA---NLKEVDVACFNLCFLNLSNCCSLETLK---LDCPKLTSLFLQSCNIDEEGVESAITQCGMLETLDVRFCP  693 (720)
Q Consensus       620 L~l~~~~---~l~~~~~~~~~L~~L~l~~~~~L~~l~---~~~~~L~~L~l~~~~i~~~~~~~~~~~~~~L~~L~l~~c~  693 (720)
                      |+++++.   .++.....+++|+.|++++|..-..++   ..+++|++|++++|.++ ..+|..+..+++|+.|++++|+
T Consensus       637 LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~-g~ip~~l~~l~~L~~L~ls~N~  715 (768)
T 3rgz_A          637 LDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLD-GRIPQAMSALTMLTEIDLSNNN  715 (768)
T ss_dssp             EECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCE-ECCCGGGGGCCCCSEEECCSSE
T ss_pred             EECcCCcccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCccc-CcCChHHhCCCCCCEEECcCCc
Confidence            7777543   344444566777777777765333333   23566777777777765 4556666777777777777764
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 720
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.002
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.004
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.004
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 47.4 bits (111), Expect = 3e-06
 Identities = 39/265 (14%), Positives = 76/265 (28%), Gaps = 17/265 (6%)

Query: 465 TMLDLSYTFLTNLEPVFESCLQLKVLKLQACKYLTNTSLESLYKKGSLPALQELDLSYGT 524
             LDL+   L            +   +        +   + L +  S   +Q +DLS   
Sbjct: 3   QTLDLTGKNLHPDVTGRLLSQGVIAFRCPR-----SFMDQPLAEHFSPFRVQHMDLSNSV 57

Query: 525 LCQSAIEELLAYCTHLTHVSLNGCGNMHDLNWGASGCQPFESPSVYNSCGIF-----PHE 579
           +  S +  +L+ C+ L ++SL G      +    +        ++    G          
Sbjct: 58  IEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLL 117

Query: 580 NIHESIDQPNRLLQNLNCVGCPNIRKVFIPPQARCFHLSSLNLSLSANLKEVDVACFNLC 639
           +    +D+ N             +    +       +LS    +L  +     V      
Sbjct: 118 SSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNL 177

Query: 640 FLNLSNCCSLETLKL-----DCPKLTSLFLQSCNIDEEGVESAITQCGMLETLDVRFCPK 694
                +   +              L  L L  C          + +   L+TL V     
Sbjct: 178 VHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGI-- 235

Query: 695 ICSTSMGRLRAACPSLKRIFSSLTT 719
           +   ++  L+ A P L+   S  TT
Sbjct: 236 VPDGTLQLLKEALPHLQINCSHFTT 260
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query720
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.84
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.82
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.74
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.74
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.73
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.72
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.71
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.7
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.68
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.66
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.59
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.57
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.56
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.54
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.54
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.52
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.49
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.44
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.44
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.43
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.38
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.36
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.36
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.35
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.31
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.27
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.26
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.25
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.16
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.14
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.07
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.05
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.04
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.81
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.69
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.51
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.22
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.9
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.86
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.84
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.79
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.54
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.84  E-value=1.1e-19  Score=188.54  Aligned_cols=58  Identities=19%  Similarity=0.324  Sum_probs=35.9

Q ss_pred             CCCcccEEEeccCcccccccccchhhHHHHhhCCCceEEecCCCcccchhhhhhhcCCCCCCCccEEEeccCC
Q 005004          245 NCAALHRINITSNSLQKLSLQKQENLTSLALQCQCLQEVDLTDCESLTNSVCEVFSDGGGCPMLKSLVLDNCE  317 (720)
Q Consensus       245 ~~~~L~~l~l~~~~~~~~~~~~~~~l~~l~~~~~~L~~L~l~~c~~l~~~~~~~~~~~~~~~~L~~L~l~~~~  317 (720)
                      .+++|+++++++|.++...  .+       ..+++|+.|++++ +.+++..+  +   ..+++|++|+++++.
T Consensus       217 ~~~~L~~L~l~~n~l~~~~--~l-------~~l~~L~~L~l~~-n~l~~~~~--~---~~~~~L~~L~l~~~~  274 (384)
T d2omza2         217 ILTNLDELSLNGNQLKDIG--TL-------ASLTNLTDLDLAN-NQISNLAP--L---SGLTKLTELKLGANQ  274 (384)
T ss_dssp             GCTTCCEEECCSSCCCCCG--GG-------GGCTTCSEEECCS-SCCCCCGG--G---TTCTTCSEEECCSSC
T ss_pred             ccCCCCEEECCCCCCCCcc--hh-------hcccccchhcccc-CccCCCCc--c---cccccCCEeeccCcc
Confidence            3445666666666655431  11       1347888888888 46765432  2   567888888887764
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure