Citrus Sinensis ID: 005014

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------72

MNKVVRSNLRVRLGDVVSVHQCADVKYGKRVHILPVDDTIEGVTGNLFDAYLKPYFTEAYRPVRKGDLFLVRGGMRSVEFKVIETDPPEYCVVAPDTEIFCEGEPVRREDENRLDEVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANETGAFFFCINGPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDEIDSIAPKREKTHGEVERRIVSQLLTLMDGLKSRAHVIVIGATNRPNSIDPALRRFGRFDREIDIGVPDEVGRLEVLRIHTKNMKLSDDVDLERIAKDTHGYVGADLAALCTEAALQCIREKMDVIDLEDETIDAEILNSMAVTDEHFKTALGTSNPSALRETVVEVPNVNWEDIGGLENVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDSIATQRGSSVGDAGGAADRVLNQLLTEMDGMSAKKTVFIIGATNRPDIIDPALLRPGRLDQLIYIPLPDEESRLQIFKACLRKSPVSKDVDLRALAKYTQGFSGADITEICQRACKYAIRENIEKDIERERRRSENPEAMEEDVEDEVAEIKAVHFEESMKYARRSVSDADIRKYQAFAQTLQQSRGFGSEFRFPDAAPPGADGGSDPFASSAGGADDDDLYS

ccHHHHHHcccccccEEEEEEccccccccEEEEEccccccccccccHHHHHHHHHHHccccccccccEEEEEcccEEEEEEEEEEcccccEEEccccEEEEcccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHcccccccEEEEEcccccHHHHHHHHHHHHHccEEEEEEccccccccccHHHHHHHHHHHHHHHcccEEEEEcccccccccccccccHHHHHHHHHHHHHHHcccccccEEEEEEccccccccHHHcccccccEEEEEccccHHHHHHHHHHHHccccccccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHccccccHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHcccHHHHHHcccccccEEEEEccccccHHHHHHHHHHHcccEEEEEcccccccccccHHHHHHHHHHHHHHHcccEEEEEEccccccccccccccccccHHHHHHHHHHHHHHcccccccEEEEEEcccccccccccccccccccEEEcccccHHHHHHHHHHHHccccccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccc

cccHEHHHcccccccEEEEEEccccccccEEEEEcccccEEcccccHHHHHHHHHHHHHccccccccEEEEEcccEEEEEEEEEEccccEEEEEcccEEEEcccccccccccccccccHccccHHHHHHHHHHHHHHcccccHHHHHHHcccccccEEEEccccccHHHHHHHHHHHHcccEEEEccHHHHHHHHcccHHHHHHHHHHHHHccccEEEEccHHHccccccccccHHHHHHHHHHHHHHHHHHHcccEEEEEEccccccccHHHcccccccEEEEccccccccHHHHHHHHHccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHccccHHHHHHHHHcccccHHcEEEEEcccccHcccccHHHHHHHHHHHHccccccHHHHHHHccccccEEEEEcccccHHHHHHHHHHHHccccEEEEccHHHHHHHHcHcHHHHHHHHHHHHHcccEEEEEcHHHHHcHHccccccccccHHHHHHHHHHHHHccccccccEEEEEEccccccccHHHcccccccEEEEEccccHHHHHHHHHHHHccccccccccHHHHHHHHccccHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHcccccccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccc

MNKVVRSNLRVrlgdvvsvhqcadvkygkrvhilpvddtiegvtgnlfdaylkpyfteayrpvrkgdlflvrggmrsvefkvietdppeycvvapdteifcegepvrredenrldevgyddvggVRKQMAQIRELVElplrhpqlfksigvkppkgillygppgsgkTLIARAVANETgafffcingpeimsKLAGESESNLRKAFEEAeknapsiifideidsiapkrekthgeVERRIVSQLLTLMDGLKSRAHVIVIgatnrpnsidpalrrfgrfdreidigvpdevgRLEVLRIHtknmklsddvdleriakdthgyvgADLAALCTEAALQCIREKmdvidledeTIDAEILNSMAVTDEHFKtalgtsnpsaLRETVVevpnvnwedigglENVKRELQETvqypvehpekfekfgmspskgvlfygppgcgkTLLAKAIANECQanfisvkgpelltmwfgesEANVREIFDKArqsapcvlffDELDSIatqrgssvgdaggAADRVLNQLLTEMDGMSAKKTVFIIgatnrpdiidpallrpgrldqliyiplpdeeSRLQIFKAClrkspvskdvDLRALAKYtqgfsgadITEICQRACKYAIRENIEKDIERErrrsenpeameeDVEDEVAEIKAVHFEESMKYARRSVSDADIRKYQAFAQTLQQsrgfgsefrfpdaappgadggsdpfassaggaddddlys

mnkvvrsnlrvrlgdvvsvhqcadvkygkrvhilpvddtiegVTGNLFDAYLKPYFTEAYRPVRKGDLFLVRGGMRSvefkvietdppeycvvapdteifcegepvrredenrldevgyddvggVRKQMAQIRELVelplrhpqlfksigvkppkgILLYGPPGSGKTLIARAVANETGAFFFCINGPEIMSKLAGESESNLRKAFEEaeknapsiifideidsiapkrekthgeverRIVSQLLTLMDGLKSRAHVIVigatnrpnsidpalRRFGrfdreidigvpdevgrlevlrihtknmklsddvdLERIAKDTHGYVGADLAALCTEAALQCIREKMDVIDLEDETIDAEILNSMAVTDEHFKTalgtsnpsalrETVVEVPNVNWEDIGGLENVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDSIATQrgssvgdaggAADRVLNQLLTEMDGMSAKKTVFIIGatnrpdiidpallrpGRLDQLIYIPLPDEESRLQIFKACLrkspvskdvdLRALAKytqgfsgaditEICQRACKYAIREniekdiererrrsenpeameedvedEVAEIKAVHFEESMKYARRSVSDADIRKYQAFAQTLQQSRGFGSEFRFPDAAPPgadggsdpfassaggaddddlYS

MNKVVRSNLRVRLGDVVSVHQCADVKYGKRVHILPVDDTIEGVTGNLFDAYLKPYFTEAYRPVRKGDLFLVRGGMRSVEFKVIETDPPEYCVVAPDTEIFCEGEPVRREDENRLDEVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANETGAFFFCINGPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDEIDSIAPKREKTHGEVERRIVSQLLTLMDGLKSRAHVIVIGATNRPNSIDPALRRFGRFDREIDIGVPDEVGRLEVLRIHTKNMKLSDDVDLERIAKDTHGYVGADLAALCTEAALQCIREKMDVIDLEDETIDAEILNSMAVTDEHFKTALGTSNPSALRETVVEVPNVNWEDIGGLENVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDSIATQrgssvgdaggaadrvLNQLLTEMDGMSAKKTVFIIGATNRPDIIDPALLRPGRLDQLIYIPLPDEESRLQIFKACLRKSPVSKDVDLRALAKYTQGFSGADITEICQRACKYAIRENIEKDIERERRRSENPeameedvedevaeIKAVHFEESMKYARRSVSDADIRKYQAFAQTLQQSRGFGSEFRFPDAAPPgadggsdpfassaggaddddLYS

*******NLRVRLGDVVSVHQCADVKYGKRVHILPVDDTIEGVTGNLFDAYLKPYFTEAYRPVRKGDLFLVRGGMRSVEFKVIETDPPEYCVVAPDTEIFCEGEPV*******LDEVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANETGAFFFCINGPEIM***********************SIIFIDEIDSIA********EVERRIVSQLLTLMDGLKSRAHVIVIGATNRPNSIDPALRRFGRFDREIDIGVPDEVGRLEVLRIHTKNMKLSDDVDLERIAKDTHGYVGADLAALCTEAALQCIREKMDVIDLEDETIDAEILNSMAVTDEHFKTALGTSNPSALRETVVEVPNVNWEDIGGLENVKRELQETVQYPVE****FEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDSIATQ*********GAADRVLNQLLTEMDGMSAKKTVFIIGATNRPDIIDPALLRPGRLDQLIYIPLPDEESRLQIFKACLRKSPVSKDVDLRALAKYTQGFSGADITEICQRACKYAIRENI***************************************************YQAF*********************************************

MNKVVRSNLRVRLGDVVSVHQCADVKYGKRVHILPVDDTIEGVTGNLFDAYLKPYFTEAYRPVRKGDLFLVRGGMRSVEFKVIETDPPEYCVVAPDTEIF******************YDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANETGAFFFCINGPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDEIDS*****************SQLLTLMDGLKSRAHVIVIGATNRPNSIDPALRRFGRFDREIDIGVPDEVGRLEVLRIHTKNMKLSDDVDLERIAKDTHGYVGADLAALCTEAALQCIREKM************EILNSMAVTDEHFKTALGTSNPSALRETVVEVPNVNWEDIGGLENVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDS******************VLNQLLTEMDGMSAKKTVFIIGATNRPDIIDPALLRPGRLDQLIYIPLPDEESRLQIFKACLRKSPVSKDVDLRALAKYTQGFSGADITEICQRACKYAIRENIEKDI***************DVEDEVAEIKAVHFEESMKYARRSVSDADIRKYQAFAQ*****************************************Y*

MNKVVRSNLRVRLGDVVSVHQCADVKYGKRVHILPVDDTIEGVTGNLFDAYLKPYFTEAYRPVRKGDLFLVRGGMRSVEFKVIETDPPEYCVVAPDTEIFCEGEPVRREDENRLDEVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANETGAFFFCINGPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDEIDSIAPK********ERRIVSQLLTLMDGLKSRAHVIVIGATNRPNSIDPALRRFGRFDREIDIGVPDEVGRLEVLRIHTKNMKLSDDVDLERIAKDTHGYVGADLAALCTEAALQCIREKMDVIDLEDETIDAEILNSMAVTDEHFKTALGTSNPSALRETVVEVPNVNWEDIGGLENVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDSIATQRGSSVGDAGGAADRVLNQLLTEMDGMSAKKTVFIIGATNRPDIIDPALLRPGRLDQLIYIPLPDEESRLQIFKACLRKSPVSKDVDLRALAKYTQGFSGADITEICQRACKYAIRENIEKDIE*******************VAEIKAVHFEESMKYARRSVSDADIRKYQAFAQTLQQSRGFGSEFRFPDAAPPGADGGSDPFASSAGGADDDDLYS

*NKVVRSNLRVRLGDVVSVHQCADVKYGKRVHILPVDDTIEGVTGNLFDAYLKPYFTEAYRPVRKGDLFLVRGGMRSVEFKVIETDPPEYCVVAPDTEIFCEGEPVRREDENRLDEVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANETGAFFFCINGPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDEIDSIAPKREKTHGEVERRIVSQLLTLMDGLKSRAHVIVIGATNRPNSIDPALRRFGRFDREIDIGVPDEVGRLEVLRIHTKNMKLSDDVDLERIAKDTHGYVGADLAALCTEAALQCIREKMDVIDLEDETIDAEILNSMAVTDEHFKTALGTSNPSALRETVVEVPNVNWEDIGGLENVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDSIATQR********GAADRVLNQLLTEMDGMSAKKTVFIIGATNRPDIIDPALLRPGRLDQLIYIPLPDEESRLQIFKACLRKSPVSKDVDLRALAKYTQGFSGADITEICQRACKYAIRENIEKDIERERRRSE*********EDEVAEIKAVHFEESMKYARRSVSDADIRKYQAFAQTLQQSR*************************************

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		719	2.2.26 [Sep-21-2011]
P54774		807	Cell division cycle prote	no	no	0.998	0.889	0.945	0.0
Q96372		805	Cell division cycle prote	N/A	no	0.997	0.890	0.923	0.0
Q9LZF6		810	Cell division control pro	yes	no	1.0	0.887	0.929	0.0
Q9SCN8		815	Cell division control pro	no	no	0.998	0.880	0.921	0.0
P54609		809	Cell division control pro	yes	no	0.984	0.875	0.929	0.0
P23787		805	Transitional endoplasmic	N/A	no	0.959	0.857	0.816	0.0
Q7ZU99		806	Transitional endoplasmic	yes	no	0.962	0.858	0.814	0.0
Q6GL04		805	Transitional endoplasmic	yes	no	0.958	0.855	0.816	0.0
P46462		806	Transitional endoplasmic	yes	no	0.959	0.856	0.815	0.0
Q01853		806	Transitional endoplasmic	yes	no	0.959	0.856	0.815	0.0

>sp\|P54774\|CDC48_SOYBN Cell division cycle protein 48 homolog OS=Glycine max GN=CDC48 PE=2 SV=1	Back alignment and function desciption

 Score = 1397 bits (3616), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 681/720 (94%), Positives = 704/720 (97%), Gaps = 2/720 (0%)

Query: 1   MNKVVRSNLRVRLGDVVSVHQCADVKYGKRVHILPVDDTIEGVTGNLFDAYLKPYFTEAY 60
           MNKVVRSNLRVRLGDVVSVHQC DVKYGKRVHILP+DDTIEGVTGNLFDA+LKPYF EAY
Sbjct: 89  MNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGNLFDAFLKPYFLEAY 148

Query: 61  RPVRKGDLFLVRGGMRSVEFKVIETDPPEYCVVAPDTEIFCEGEPVRREDENRLDEVGYD 120
           RPVRKGDLFLVRGGMRSVEFKV+ETDP EYCVVAPDTEIFCEGEP++REDE RLDEVGYD
Sbjct: 149 RPVRKGDLFLVRGGMRSVEFKVVETDPGEYCVVAPDTEIFCEGEPLKREDEERLDEVGYD 208

Query: 121 DVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANETGA 180
           DVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANETGA
Sbjct: 209 DVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANETGA 268

Query: 181 FFFCINGPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDEIDSIAPKREKTHGEVERRI 240
           FFFCINGPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDEIDSIAPKREKTHGEVERRI
Sbjct: 269 FFFCINGPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDEIDSIAPKREKTHGEVERRI 328

Query: 241 VSQLLTLMDGLKSRAHVIVIGATNRPNSIDPALRRFGRFDREIDIGVPDEVGRLEVLRIH 300
           VSQLLTLMDGLKSRAHVIVIGATNRPNSIDPALRRFGRFDREIDIGVPDEVGRLEVLRIH
Sbjct: 329 VSQLLTLMDGLKSRAHVIVIGATNRPNSIDPALRRFGRFDREIDIGVPDEVGRLEVLRIH 388

Query: 301 TKNMKLSDDVDLERIAKDTHGYVGADLAALCTEAALQCIREKMDVIDLEDETIDAEILNS 360
           TKNMKLSDDVDLERIAKDTHGYVGADLAALCTEAALQCIREKMDVIDLEDETIDAE+LNS
Sbjct: 389 TKNMKLSDDVDLERIAKDTHGYVGADLAALCTEAALQCIREKMDVIDLEDETIDAEVLNS 448

Query: 361 MAVTDEHFKTALGTSNPSALRETVVEVPNVNWEDIGGLENVKRELQETVQYPVEHPEKFE 420
           MAVT+EHF+TALGTSNPSALRETVVEVPNV+WEDIGGLENVKRELQETVQYPVEHPEKFE
Sbjct: 449 MAVTNEHFQTALGTSNPSALRETVVEVPNVSWEDIGGLENVKRELQETVQYPVEHPEKFE 508

Query: 421 KFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVREIFD 480
           KFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVREIFD
Sbjct: 509 KFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVREIFD 568

Query: 481 KARQSAPCVLFFDELDSIATQRGSSVGDAGGAADRVLNQLLTEMDGMSAKKTVFIIGATN 540
           KARQSAPCVLFFDELDSIATQRGSSVGDAGGAADRVLNQLLTEMDGMSAKKTVFIIGATN
Sbjct: 569 KARQSAPCVLFFDELDSIATQRGSSVGDAGGAADRVLNQLLTEMDGMSAKKTVFIIGATN 628

Query: 541 RPDIIDPALLRPGRLDQLIYIPLPDEESRLQIFKACLRKSPVSKDVDLRALAKYTQGFSG 600
           RPDIIDPALLRPGRLDQLIYIPLPDE+SR QIFKACLRKSP++K+VDLRALA++TQGFSG
Sbjct: 629 RPDIIDPALLRPGRLDQLIYIPLPDEDSRHQIFKACLRKSPIAKNVDLRALARHTQGFSG 688

Query: 601 ADITEICQRACKYAIRENIEKDIERERRRSENPEAMEED-VEDEVAEIKAVHFEESMKYA 659
           ADITEICQRACKYAIRENIEKDIERER+  ENPEAM+ED V+DEVAEIKA HFEESMK+A
Sbjct: 689 ADITEICQRACKYAIRENIEKDIERERKSRENPEAMDEDTVDDEVAEIKAAHFEESMKFA 748

Query: 660 RRSVSDADIRKYQAFAQTLQQSRGFGSEFRFPDAAPPGADGGSDPFASSAGGADDDDLYS 719
           RRSVSDADIRKYQAFAQTLQQSRGFGSEFRFP++       GSDPFA+SAGGAD+DDLYS
Sbjct: 749 RRSVSDADIRKYQAFAQTLQQSRGFGSEFRFPESG-DRTTTGSDPFAASAGGADEDDLYS 807

Probably functions in cell division and growth processes.
Glycine max (taxid: 3847)

>sp\|Q96372\|CDC48_CAPAN Cell division cycle protein 48 homolog OS=Capsicum annuum GN=CAFP PE=2 SV=1	Back alignment and function description

>sp\|Q9LZF6\|CD48E_ARATH Cell division control protein 48 homolog E OS=Arabidopsis thaliana GN=CDC48E PE=1 SV=2	Back alignment and function description

>sp\|Q9SCN8\|CD48D_ARATH Cell division control protein 48 homolog D OS=Arabidopsis thaliana GN=CDC48D PE=1 SV=1	Back alignment and function description

>sp\|P54609\|CD48A_ARATH Cell division control protein 48 homolog A OS=Arabidopsis thaliana GN=CDC48A PE=1 SV=1	Back alignment and function description

>sp\|P23787\|TERA_XENLA Transitional endoplasmic reticulum ATPase OS=Xenopus laevis GN=vcp PE=1 SV=3	Back alignment and function description

>sp\|Q7ZU99\|TERA_DANRE Transitional endoplasmic reticulum ATPase OS=Danio rerio GN=vcp PE=1 SV=1	Back alignment and function description

>sp\|Q6GL04\|TERA_XENTR Transitional endoplasmic reticulum ATPase OS=Xenopus tropicalis GN=vcp PE=2 SV=1	Back alignment and function description

>sp\|P46462\|TERA_RAT Transitional endoplasmic reticulum ATPase OS=Rattus norvegicus GN=Vcp PE=1 SV=3	Back alignment and function description

>sp\|Q01853\|TERA_MOUSE Transitional endoplasmic reticulum ATPase OS=Mus musculus GN=Vcp PE=1 SV=4	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		719
255556938		805	Transitional endoplasmic reticulum ATPas	0.997	0.890	0.956	0.0
449440119		804	PREDICTED: cell division cycle protein 4	0.995	0.890	0.948	0.0
356572464		808	PREDICTED: cell division cycle protein 4	0.998	0.888	0.955	0.0
356505246		808	PREDICTED: cell division cycle protein 4	0.998	0.888	0.952	0.0
98962497		808	putative spindle disassembly related pro	1.0	0.889	0.948	0.0
351727028		807	cell division cycle protein 48 homolog [	0.998	0.889	0.945	0.0
356543494		807	PREDICTED: cell division cycle protein 4	0.998	0.889	0.945	0.0
224140199		802	predicted protein [Populus trichocarpa]	0.993	0.890	0.959	0.0
224069527		810	predicted protein [Populus trichocarpa]	0.995	0.883	0.961	0.0
209865725		805	cell division cycle protein [Dimocarpus	0.997	0.890	0.952	0.0

>gi\|255556938\|ref\|XP_002519502.1\| Transitional endoplasmic reticulum ATPase, putative [Ricinus communis] gi\|223541365\|gb\|EEF42916.1\| Transitional endoplasmic reticulum ATPase, putative [Ricinus communis]	Back alignment and taxonomy information

 Score = 1412 bits (3656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 688/719 (95%), Positives = 706/719 (98%), Gaps = 2/719 (0%)

Query: 1   MNKVVRSNLRVRLGDVVSVHQCADVKYGKRVHILPVDDTIEGVTGNLFDAYLKPYFTEAY 60
           MNKVVRSNLRVRLGDVVSVHQC DVKYGKRVHILP+DDTIEGVTGNLFDAYLKPYF EAY
Sbjct: 89  MNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVHILPIDDTIEGVTGNLFDAYLKPYFLEAY 148

Query: 61  RPVRKGDLFLVRGGMRSVEFKVIETDPPEYCVVAPDTEIFCEGEPVRREDENRLDEVGYD 120
           RPVRKGDLFLVRGGMRSVEFKVIETDP EYCVVAPDTEIFCEGEPVRREDENRLDEVGYD
Sbjct: 149 RPVRKGDLFLVRGGMRSVEFKVIETDPAEYCVVAPDTEIFCEGEPVRREDENRLDEVGYD 208

Query: 121 DVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANETGA 180
           DVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANETGA
Sbjct: 209 DVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANETGA 268

Query: 181 FFFCINGPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDEIDSIAPKREKTHGEVERRI 240
           FFFCINGPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDEIDSIAPKREKTHGEVERRI
Sbjct: 269 FFFCINGPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDEIDSIAPKREKTHGEVERRI 328

Query: 241 VSQLLTLMDGLKSRAHVIVIGATNRPNSIDPALRRFGRFDREIDIGVPDEVGRLEVLRIH 300
           VSQLLTLMDGLKSRAHVIVIGATNRPNSIDPALRRFGRFDREIDIGVPDEVGRLEVLRIH
Sbjct: 329 VSQLLTLMDGLKSRAHVIVIGATNRPNSIDPALRRFGRFDREIDIGVPDEVGRLEVLRIH 388

Query: 301 TKNMKLSDDVDLERIAKDTHGYVGADLAALCTEAALQCIREKMDVIDLEDETIDAEILNS 360
           TKNMKL++DVDLERI+KDTHGYVGADLAALCTEAALQCIREKMDVIDLEDE+IDAEILNS
Sbjct: 389 TKNMKLAEDVDLERISKDTHGYVGADLAALCTEAALQCIREKMDVIDLEDESIDAEILNS 448

Query: 361 MAVTDEHFKTALGTSNPSALRETVVEVPNVNWEDIGGLENVKRELQETVQYPVEHPEKFE 420
           MAV++EHF+TALGTSNPSALRETVVEVPNV+WEDIGGLENVKRELQETVQYPVEHPEKFE
Sbjct: 449 MAVSNEHFQTALGTSNPSALRETVVEVPNVSWEDIGGLENVKRELQETVQYPVEHPEKFE 508

Query: 421 KFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVREIFD 480
           KFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVREIFD
Sbjct: 509 KFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVREIFD 568

Query: 481 KARQSAPCVLFFDELDSIATQRGSSVGDAGGAADRVLNQLLTEMDGMSAKKTVFIIGATN 540
           KARQSAPCVLFFDELDSIATQRGSSVGDAGGAADRVLNQLLTEMDGMSAKKTVFIIGATN
Sbjct: 569 KARQSAPCVLFFDELDSIATQRGSSVGDAGGAADRVLNQLLTEMDGMSAKKTVFIIGATN 628

Query: 541 RPDIIDPALLRPGRLDQLIYIPLPDEESRLQIFKACLRKSPVSKDVDLRALAKYTQGFSG 600
           RPDIIDPALLRPGRLDQLIYIPLPDE+SR QIFKACLRKSPVSKDVDLRALAKYTQGFSG
Sbjct: 629 RPDIIDPALLRPGRLDQLIYIPLPDEDSRHQIFKACLRKSPVSKDVDLRALAKYTQGFSG 688

Query: 601 ADITEICQRACKYAIRENIEKDIERERRRSENPEAMEEDVEDEVAEIKAVHFEESMKYAR 660
           ADITEICQRACKYAIRENIEKDIERERR+ +NPEAMEEDVED+VAEIKA HFEESMKYAR
Sbjct: 689 ADITEICQRACKYAIRENIEKDIERERRQRDNPEAMEEDVEDDVAEIKAAHFEESMKYAR 748

Query: 661 RSVSDADIRKYQAFAQTLQQSRGFGSEFRFPDAAPPGADGGSDPFASSAGGADDDDLYS 719
           RSVSDADIRKYQAFAQTLQQSRGFGSEFRF ++   G   G+DPFA+SAGGADDDDLY+
Sbjct: 749 RSVSDADIRKYQAFAQTLQQSRGFGSEFRFSEST--GGAAGADPFAASAGGADDDDLYN 805

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|449440119\|ref\|XP_004137832.1\| PREDICTED: cell division cycle protein 48 homolog [Cucumis sativus] gi\|449525650\|ref\|XP_004169829.1\| PREDICTED: cell division cycle protein 48 homolog [Cucumis sativus]	Back alignment and taxonomy information

>gi\|356572464\|ref\|XP_003554388.1\| PREDICTED: cell division cycle protein 48 homolog [Glycine max]	Back alignment and taxonomy information

>gi\|356505246\|ref\|XP_003521403.1\| PREDICTED: cell division cycle protein 48 homolog [Glycine max]	Back alignment and taxonomy information

>gi\|98962497\|gb\|ABF59516.1\| putative spindle disassembly related protein CDC48 [Nicotiana tabacum]	Back alignment and taxonomy information

>gi\|351727028\|ref\|NP_001235099.1\| cell division cycle protein 48 homolog [Glycine max] gi\|1705678\|sp\|P54774.1\|CDC48_SOYBN RecName: Full=Cell division cycle protein 48 homolog; AltName: Full=Valosin-containing protein homolog; Short=VCP gi\|862480\|gb\|AAA80587.1\| valosin-containing protein [Glycine max] gi\|86212372\|gb\|ABC87759.1\| plamsma membrane-associated AAA-ATPase [Glycine max]	Back alignment and taxonomy information

>gi\|356543494\|ref\|XP_003540195.1\| PREDICTED: cell division cycle protein 48 homolog [Glycine max]	Back alignment and taxonomy information

>gi\|224140199\|ref\|XP_002323472.1\| predicted protein [Populus trichocarpa] gi\|222868102\|gb\|EEF05233.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|224069527\|ref\|XP_002326365.1\| predicted protein [Populus trichocarpa] gi\|222833558\|gb\|EEE72035.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|209865725\|gb\|ACC66148.3\| cell division cycle protein [Dimocarpus longan] gi\|221327637\|gb\|ACM17483.1\| cell division cycle protein [Dimocarpus longan]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		719
TAIR\|locus:2101933		815	AtCDC48B "AT3G53230" [Arabidop	0.962	0.849	0.906	0.0
TAIR\|locus:2831844		810	AtCDC48C "cell division cycle	0.965	0.856	0.909	0.0
TAIR\|locus:2085064		809	CDC48 "cell division cycle 48"	0.965	0.857	0.906	0.0
DICTYBASE\|DDB_G0288065		793	cdcD "CDC48 family AAA ATPase"	0.962	0.872	0.805	9.4e-304
ZFIN\|ZDB-GENE-030131-5408		806	vcp "valosin containing protei	0.962	0.858	0.788	9.7e-302
UNIPROTKB\|Q6GL04		805	vcp "Transitional endoplasmic	0.959	0.857	0.791	5.3e-301
UNIPROTKB\|P55072		806	VCP "Transitional endoplasmic	0.959	0.856	0.790	1.1e-300
MGI\|MGI:99919		806	Vcp "valosin containing protei	0.959	0.856	0.790	1.1e-300
RGD\|621595		806	Vcp "valosin-containing protei	0.959	0.856	0.790	1.1e-300
UNIPROTKB\|P23787		805	vcp "Transitional endoplasmic	0.959	0.857	0.791	1.8e-300

TAIR\|locus:2101933 AtCDC48B "AT3G53230" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 3260 (1152.6 bits), Expect = 0., P = 0.
 Identities = 628/693 (90%), Positives = 656/693 (94%)

Query:     1 MNKVVRSNLRVRLGDVVSVHQCADVKYGKRVHILPVDDTIEGVTGNLFDAYLKPYFTEAY 60
             MNKVVRSNLRVRLGDV+SVHQC DVKYG RVHILP+DDTIEGV+GN+FDAYLKPYF EAY
Sbjct:    89 MNKVVRSNLRVRLGDVISVHQCPDVKYGNRVHILPLDDTIEGVSGNIFDAYLKPYFLEAY 148

Query:    61 RPVRKGDLFLVRGGMRSVEFKVIETDPPEYCVVAPDTEIFCEGEPVRREDENRLDEVGYD 120
             RPVRKGDLFLVRGGMRS+EFKVIETDP EYCVVAPDTEIFCEGEP++REDE RLDEVGYD
Sbjct:   149 RPVRKGDLFLVRGGMRSIEFKVIETDPAEYCVVAPDTEIFCEGEPIKREDEERLDEVGYD 208

Query:   121 DVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANETGA 180
             DVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANETGA
Sbjct:   209 DVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANETGA 268

Query:   181 FFFCINGPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDEIDSIAPKREKTHGEVERRI 240
             FFFCINGPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDEIDSIAPKREKTHGEVERRI
Sbjct:   269 FFFCINGPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDEIDSIAPKREKTHGEVERRI 328

Query:   241 VSQLLTLMDGLKSRAHVIVIGATNRPNSIDPALRRFGRFDREIDIGVPDEVGRLEVLRIH 300
             VSQLLTLMDGLKSRAHVIV+GATNRPNSIDPALRRFGRFDREIDIGVPDE+GRLEVLRIH
Sbjct:   329 VSQLLTLMDGLKSRAHVIVMGATNRPNSIDPALRRFGRFDREIDIGVPDEIGRLEVLRIH 388

Query:   301 TKNMKLSDDVDLERIAKDTHGYVGADLAALCTEAALQCIREKMDVIDLEDETIDAEILNS 360
             TKNMKL++DVDLER++KDTHGYVGADLAALCTEAALQCIREKMDVIDL+DE IDAEILNS
Sbjct:   389 TKNMKLAEDVDLERVSKDTHGYVGADLAALCTEAALQCIREKMDVIDLDDEEIDAEILNS 448

Query:   361 MAVTDEHFKTALGTSNPSALRETVVEVPNVNWEDIGGLENVKRELQETVQYPVEHPEKFE 420
             MAV+++HF+TALG SNPSALRETVVEVPNV+WEDIGGLENVKRELQETVQYPVEHPEKFE
Sbjct:   449 MAVSNDHFQTALGNSNPSALRETVVEVPNVSWEDIGGLENVKRELQETVQYPVEHPEKFE 508

Query:   421 KFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVREIFD 480
             KFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFIS+KGPELLTMWFGESEANVREIFD
Sbjct:   509 KFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFD 568

Query:   481 KARQSAPCVLFFDELDSIATQXXXXXXXXXXXXXXXLNQLLTEMDGMSAKKTVFIIGATN 540
             KARQSAPCVLFFDELDSIATQ               LNQLLTEMDGM+AKKTVFIIGATN
Sbjct:   569 KARQSAPCVLFFDELDSIATQRGNSVGDAGGAADRVLNQLLTEMDGMNAKKTVFIIGATN 628

Query:   541 RPDIIDPALLRPGRLDQLIYIPLPDEESRLQIFKACLRKSPVSKDVDLRALAKYTQGFSG 600
             RPDIIDPALLRPGRLDQLIYIPLPDEESR QIFK+CLRKSPV+KDVDLRALAKYTQGFSG
Sbjct:   629 RPDIIDPALLRPGRLDQLIYIPLPDEESRYQIFKSCLRKSPVAKDVDLRALAKYTQGFSG 688

Query:   601 ADITEICQRACKYAIRENIEKDIERERRRSENPXXXXXXXXXXXXXIKAVHFEESMKYAR 660
             ADITEICQR+CKYAIRENIEKDIE+ER+R+E+P             IKA HFEESMKYAR
Sbjct:   689 ADITEICQRSCKYAIRENIEKDIEKERKRAESPEAMEEDEEEIAE-IKAGHFEESMKYAR 747

Query:   661 RSVSDADIRKYQAFAQTLQQSRGFGSEFRFPDA 693
             RSVSDADIRKYQAFAQTLQQSRGFGSEFRFPDA
Sbjct:   748 RSVSDADIRKYQAFAQTLQQSRGFGSEFRFPDA 780

GO:0005524 "ATP binding" evidence=ISS

GO:0005730 "nucleolus" evidence=IDA

GO:0046686 "response to cadmium ion" evidence=IEP

GO:0005886 "plasma membrane" evidence=IDA

GO:0005829 "cytosol" evidence=IDA

GO:0005794 "Golgi apparatus" evidence=IDA

GO:0005515 "protein binding" evidence=IPI

GO:0005654 "nucleoplasm" evidence=IDA

GO:0045732 "positive regulation of protein catabolic process" evidence=IDA

TAIR\|locus:2831844 AtCDC48C "cell division cycle 48C" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2085064 CDC48 "cell division cycle 48" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0288065 cdcD "CDC48 family AAA ATPase" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-030131-5408 vcp "valosin containing protein" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|Q6GL04 vcp "Transitional endoplasmic reticulum ATPase" [Xenopus (Silurana) tropicalis (taxid:8364)]	Back alignment and assigned GO terms

UNIPROTKB\|P55072 VCP "Transitional endoplasmic reticulum ATPase" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

MGI\|MGI:99919 Vcp "valosin containing protein" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

RGD\|621595 Vcp "valosin-containing protein" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|P23787 vcp "Transitional endoplasmic reticulum ATPase" [Xenopus laevis (taxid:8355)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q58556	Y1156_METJA	No assigned EC number	0.5555	0.8623	0.6866	yes	no
P54609	CD48A_ARATH	No assigned EC number	0.9295	0.9847	0.8751	yes	no
Q9SCN8	CD48D_ARATH	No assigned EC number	0.9217	0.9986	0.8809	no	no
P46462	TERA_RAT	No assigned EC number	0.8150	0.9596	0.8560	yes	no
Q3ZBT1	TERA_BOVIN	No assigned EC number	0.8135	0.9596	0.8560	yes	no
O28972	Y1297_ARCFU	No assigned EC number	0.5221	0.9123	0.8949	yes	no
Q9P3A7	CDC48_SCHPO	No assigned EC number	0.6975	0.9833	0.8674	yes	no
P55072	TERA_HUMAN	No assigned EC number	0.8150	0.9596	0.8560	yes	no
Q01853	TERA_MOUSE	No assigned EC number	0.8150	0.9596	0.8560	yes	no
Q5AWS6	CDC48_EMENI	No assigned EC number	0.7085	0.9902	0.8651	yes	no
Q8SSJ5	CDC48_ENCCU	No assigned EC number	0.6235	0.9290	0.8564	yes	no
Q7KN62	TERA_DROME	No assigned EC number	0.7600	1.0	0.8976	yes	no
Q9LZF6	CD48E_ARATH	No assigned EC number	0.9294	1.0	0.8876	yes	no
P54811	TERA1_CAEEL	No assigned EC number	0.7324	0.9930	0.8825	no	no
P54812	TERA2_CAEEL	No assigned EC number	0.7714	0.9652	0.8567	yes	no
Q7ZU99	TERA_DANRE	No assigned EC number	0.8141	0.9624	0.8585	yes	no
Q6GL04	TERA_XENTR	No assigned EC number	0.8162	0.9582	0.8559	yes	no
O05209	VAT_THEAC	No assigned EC number	0.4963	0.9040	0.8724	yes	no
P54774	CDC48_SOYBN	No assigned EC number	0.9458	0.9986	0.8897	no	no
P25694	CDC48_YEAST	No assigned EC number	0.6796	0.9986	0.8598	yes	no
P23787	TERA_XENLA	No assigned EC number	0.8164	0.9596	0.8571	N/A	no
Q96372	CDC48_CAPAN	No assigned EC number	0.9235	0.9972	0.8906	N/A	no
P03974	TERA_PIG	No assigned EC number	0.8121	0.9596	0.8560	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		719
TIGR01243		733	TIGR01243, CDC48, AAA family ATPase, CDC48 subfami	0.0
COG0464		494	COG0464, SpoVK, ATPases of the AAA+ class [Posttra	0.0
PRK03992		389	PRK03992, PRK03992, proteasome-activating nucleoti	2e-96
COG1222		406	COG1222, RPT1, ATP-dependent 26S proteasome regula	1e-95
PRK03992		389	PRK03992, PRK03992, proteasome-activating nucleoti	5e-95
COG1222		406	COG1222, RPT1, ATP-dependent 26S proteasome regula	2e-92
TIGR01242		364	TIGR01242, 26Sp45, 26S proteasome subunit P45 fami	1e-86
TIGR01242		364	TIGR01242, 26Sp45, 26S proteasome subunit P45 fami	4e-84
COG0464		494	COG0464, SpoVK, ATPases of the AAA+ class [Posttra	1e-82
TIGR01241		495	TIGR01241, FtsH_fam, ATP-dependent metalloprotease	6e-74
PTZ00454		398	PTZ00454, PTZ00454, 26S protease regulatory subuni	6e-73
TIGR01241		495	TIGR01241, FtsH_fam, ATP-dependent metalloprotease	7e-73
PTZ00361		438	PTZ00361, PTZ00361, 26 proteosome regulatory subun	7e-73
CHL00176		638	CHL00176, ftsH, cell division protein; Validated	3e-70
PTZ00454		398	PTZ00454, PTZ00454, 26S protease regulatory subuni	4e-68
COG0465		596	COG0465, HflB, ATP-dependent Zn proteases [Posttra	3e-65
COG0465		596	COG0465, HflB, ATP-dependent Zn proteases [Posttra	8e-64
CHL00176		638	CHL00176, ftsH, cell division protein; Validated	2e-63
PTZ00361		438	PTZ00361, PTZ00361, 26 proteosome regulatory subun	9e-61
PRK10733		644	PRK10733, hflB, ATP-dependent metalloprotease; Rev	2e-59
pfam00004		131	pfam00004, AAA, ATPase family associated with vari	6e-57
TIGR03689		512	TIGR03689, pup_AAA, proteasome ATPase	3e-56
pfam00004		131	pfam00004, AAA, ATPase family associated with vari	1e-55
TIGR03689		512	TIGR03689, pup_AAA, proteasome ATPase	2e-54
COG1223		368	COG1223, COG1223, Predicted ATPase (AAA+ superfami	3e-53
PRK10733		644	PRK10733, hflB, ATP-dependent metalloprotease; Rev	5e-53
COG1223		368	COG1223, COG1223, Predicted ATPase (AAA+ superfami	5e-52
CHL00195		489	CHL00195, ycf46, Ycf46; Provisional	5e-33
cd00009		151	cd00009, AAA, The AAA+ (ATPases Associated with a	4e-32
cd00009		151	cd00009, AAA, The AAA+ (ATPases Associated with a	1e-30
smart00382		148	smart00382, AAA, ATPases associated with a variety	8e-21
smart00382		148	smart00382, AAA, ATPases associated with a variety	2e-20
CHL00195		489	CHL00195, ycf46, Ycf46; Provisional	2e-16
PRK13342		413	PRK13342, PRK13342, recombination factor protein R	1e-11
smart01072		64	smart01072, CDC48_2, Cell division protein 48 (CDC	4e-11
COG2256		436	COG2256, MGS1, ATPase related to the helicase subu	2e-09
PRK13342		413	PRK13342, PRK13342, recombination factor protein R	1e-08
pfam02933		61	pfam02933, CDC48_2, Cell division protein 48 (CDC4	2e-08
COG0714		329	COG0714, COG0714, MoxR-like ATPases [General funct	6e-08
COG0542		786	COG0542, clpA, ATP-binding subunits of Clp proteas	1e-07
TIGR03922		557	TIGR03922, T7SS_EccA, type VII secretion AAA-ATPas	2e-07
TIGR03922		557	TIGR03922, T7SS_EccA, type VII secretion AAA-ATPas	2e-07
COG0593		408	COG0593, DnaA, ATPase involved in DNA replication	2e-07
PRK13341		725	PRK13341, PRK13341, recombination factor protein R	2e-07
COG2255		332	COG2255, RuvB, Holliday junction resolvasome, heli	2e-07
PRK00080		328	PRK00080, ruvB, Holliday junction DNA helicase Ruv	3e-07
pfam07728		135	pfam07728, AAA_5, AAA domain (dynein-related subfa	7e-07
TIGR00635		305	TIGR00635, ruvB, Holliday junction DNA helicase, R	8e-07
COG2256		436	COG2256, MGS1, ATPase related to the helicase subu	9e-07
PHA02544		316	PHA02544, 44, clamp loader, small subunit; Provisi	1e-06
PRK00080		328	PRK00080, ruvB, Holliday junction DNA helicase Ruv	2e-06
pfam05496		231	pfam05496, RuvB_N, Holliday junction DNA helicase	5e-06
COG2255		332	COG2255, RuvB, Holliday junction resolvasome, heli	6e-06
pfam13401		124	pfam13401, AAA_22, AAA domain	6e-06
TIGR00635		305	TIGR00635, ruvB, Holliday junction DNA helicase, R	1e-05
pfam07724		168	pfam07724, AAA_2, AAA domain (Cdc48 subfamily)	1e-05
COG0714		329	COG0714, COG0714, MoxR-like ATPases [General funct	3e-05
COG1484		254	COG1484, DnaC, DNA replication protein [DNA replic	3e-05
PRK04195		482	PRK04195, PRK04195, replication factor C large sub	3e-05
PRK04195		482	PRK04195, PRK04195, replication factor C large sub	4e-05
TIGR00382		413	TIGR00382, clpX, endopeptidase Clp ATP-binding reg	4e-05
COG1224		450	COG1224, TIP49, DNA helicase TIP49, TBP-interactin	8e-05
COG1484		254	COG1484, DnaC, DNA replication protein [DNA replic	1e-04
pfam05496		231	pfam05496, RuvB_N, Holliday junction DNA helicase	2e-04
pfam06068		395	pfam06068, TIP49, TIP49 C-terminus	2e-04
PRK13341		725	PRK13341, PRK13341, recombination factor protein R	3e-04
COG1219		408	COG1219, ClpX, ATP-dependent protease Clp, ATPase	3e-04
PRK05342		412	PRK05342, clpX, ATP-dependent protease ATP-binding	3e-04
COG1474		366	COG1474, CDC6, Cdc6-related protein, AAA superfami	4e-04
PRK08116		268	PRK08116, PRK08116, hypothetical protein; Validate	4e-04
pfam07724		168	pfam07724, AAA_2, AAA domain (Cdc48 subfamily)	5e-04
PRK06835		329	PRK06835, PRK06835, DNA replication protein DnaC;	6e-04
COG0542		786	COG0542, clpA, ATP-binding subunits of Clp proteas	0.001
PRK08116		268	PRK08116, PRK08116, hypothetical protein; Validate	0.001
pfam00910		105	pfam00910, RNA_helicase, RNA helicase	0.001
cd01120		165	cd01120, RecA-like_NTPases, RecA-like NTPases	0.001
pfam13207		114	pfam13207, AAA_17, AAA domain	0.002
TIGR02881		261	TIGR02881, spore_V_K, stage V sporulation protein	0.003
CHL00206		2281	CHL00206, ycf2, Ycf2; Provisional	0.003
pfam01057		271	pfam01057, Parvo_NS1, Parvovirus non-structural pr	0.003
COG1373		398	COG1373, COG1373, Predicted ATPase (AAA+ superfami	0.004
TIGR02639		730	TIGR02639, ClpA, ATP-dependent Clp protease ATP-bi	0.004
pfam01078		207	pfam01078, Mg_chelatase, Magnesium chelatase, subu	0.004

>gnl\|CDD\|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily	Back alignment and domain information

 Score =  747 bits (1930), Expect = 0.0
 Identities = 357/682 (52%), Positives = 489/682 (71%), Gaps = 17/682 (2%)

Query: 1   MNKVVRSNLRVRLGDVVSVHQCADVKYGKRVHILPVDDTIEGVTGNLFDAYLKPYFTEAY 60
           M+  +R+N  V +GD V+V + A+VK  K+V + P   T     G  F  Y+K +     
Sbjct: 65  MDGYLRANAGVTIGDTVTVER-AEVKEAKKVVLAP---TQPIRFGRDFVDYVKEFLLG-- 118

Query: 61  RPVRKGDLFLVRGGMRSVEFKVIETDPPEYCVVAPDTEIFCEGEPVRREDENRLDEVGYD 120
           +P+ KG+  +V     ++ F V+ T P  +  V   TE+    +PVR E E ++ +V Y+
Sbjct: 119 KPISKGETVIVPVLEGALPFVVVSTQPAGFVYVTEATEVEIREKPVREEIERKVPKVTYE 178

Query: 121 DVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANETGA 180
           D+GG+++   +IRE+VELP++HP+LF+ +G++PPKG+LLYGPPG+GKTL+A+AVANE GA
Sbjct: 179 DIGGLKEAKEKIREMVELPMKHPELFEHLGIEPPKGVLLYGPPGTGKTLLAKAVANEAGA 238

Query: 181 FFFCINGPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDEIDSIAPKREKTHGEVERRI 240
           +F  INGPEIMSK  GESE  LR+ F+EAE+NAPSIIFIDEID+IAPKRE+  GEVE+R+
Sbjct: 239 YFISINGPEIMSKYYGESEERLREIFKEAEENAPSIIFIDEIDAIAPKREEVTGEVEKRV 298

Query: 241 VSQLLTLMDGLKSRAHVIVIGATNRPNSIDPALRRFGRFDREIDIGVPDEVGRLEVLRIH 300
           V+QLLTLMDGLK R  VIVIGATNRP+++DPALRR GRFDREI I VPD+  R E+L++H
Sbjct: 299 VAQLLTLMDGLKGRGRVIVIGATNRPDALDPALRRPGRFDREIVIRVPDKRARKEILKVH 358

Query: 301 TKNMKLSDDVDLERIAKDTHGYVGADLAALCTEAALQCIREKMDV--IDLEDETIDAEIL 358
           T+NM L++DVDL+++A+ THG+VGADLAAL  EAA+  +R  +    I+ E E I AE+L
Sbjct: 359 TRNMPLAEDVDLDKLAEVTHGFVGADLAALAKEAAMAALRRFIREGKINFEAEEIPAEVL 418

Query: 359 NSMAVTDEHFKTALGTSNPSALRETVVEVPNVNWEDIGGLENVKRELQETVQYPVEHPEK 418
             + VT + F  AL    PSA+RE +VEVPNV W DIGGLE VK+EL+E V++P++HPE 
Sbjct: 419 KELKVTMKDFMEALKMVEPSAIREVLVEVPNVRWSDIGGLEEVKQELREAVEWPLKHPEI 478

Query: 419 FEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVREI 478
           FEK G+ P KGVL +GPPG GKTLLAKA+A E  ANFI+V+GPE+L+ W GESE  +REI
Sbjct: 479 FEKMGIRPPKGVLLFGPPGTGKTLLAKAVATESGANFIAVRGPEILSKWVGESEKAIREI 538

Query: 479 FDKARQSAPCVLFFDELDSIATQRGSSVGDAGGAADRVLNQLLTEMDGMSAKKTVFIIGA 538
           F KARQ+AP ++FFDE+D+IA  RG+    +    DR++NQLLTEMDG+     V +I A
Sbjct: 539 FRKARQAAPAIIFFDEIDAIAPARGARFDTS--VTDRIVNQLLTEMDGIQELSNVVVIAA 596

Query: 539 TNRPDIIDPALLRPGRLDQLIYIPLPDEESRLQIFKACLRKSPVSKDVDLRALAKYTQGF 598
           TNRPDI+DPALLRPGR D+LI +P PDEE+R +IFK   R  P+++DVDL  LA+ T+G+
Sbjct: 597 TNRPDILDPALLRPGRFDRLILVPPPDEEARKEIFKIHTRSMPLAEDVDLEELAEMTEGY 656

Query: 599 SGADITEICQRACKYAIRENIEKDIERERRRSENPEAMEEDVEDEVAEIKAVHFEESMKY 658
           +GADI  +C+ A   A+RE+I    +      E  E  EE+   ++ +++  HF E++K 
Sbjct: 657 TGADIEAVCREAAMAALRESIGSPAK------EKLEVGEEEFLKDL-KVEMRHFLEALKK 709

Query: 659 ARRSVSDADIRKYQAFAQTLQQ 680
            + SVS  D+ +Y+  A+ L++
Sbjct: 710 VKPSVSKEDMLRYERLAKELKR 731

This subfamily of the AAA family ATPases includes two members each from three archaeal species. It also includes yeast CDC48 (cell division control protein 48) and the human ortholog, transitional endoplasmic reticulum ATPase (valosin-containing protein). These proteins in eukaryotes are involved in the budding and transfer of membrane from the transitional endoplasmic reticulum to the Golgi apparatus. Length = 733

>gnl\|CDD\|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional	Back alignment and domain information

>gnl\|CDD\|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional	Back alignment and domain information

>gnl\|CDD\|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family	Back alignment and domain information

>gnl\|CDD\|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family	Back alignment and domain information

>gnl\|CDD\|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH	Back alignment and domain information

>gnl\|CDD\|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional	Back alignment and domain information

>gnl\|CDD\|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH	Back alignment and domain information

>gnl\|CDD\|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional	Back alignment and domain information

>gnl\|CDD\|214386 CHL00176, ftsH, cell division protein; Validated	Back alignment and domain information

>gnl\|CDD\|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional	Back alignment and domain information

>gnl\|CDD\|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|214386 CHL00176, ftsH, cell division protein; Validated	Back alignment and domain information

>gnl\|CDD\|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional	Back alignment and domain information

>gnl\|CDD\|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed	Back alignment and domain information

>gnl\|CDD\|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA)	Back alignment and domain information

>gnl\|CDD\|200312 TIGR03689, pup_AAA, proteasome ATPase	Back alignment and domain information

>gnl\|CDD\|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA)	Back alignment and domain information

>gnl\|CDD\|200312 TIGR03689, pup_AAA, proteasome ATPase	Back alignment and domain information

>gnl\|CDD\|224144 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed	Back alignment and domain information

>gnl\|CDD\|224144 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|177094 CHL00195, ycf46, Ycf46; Provisional	Back alignment and domain information

>gnl\|CDD\|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>gnl\|CDD\|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>gnl\|CDD\|214640 smart00382, AAA, ATPases associated with a variety of cellular activities	Back alignment and domain information

>gnl\|CDD\|214640 smart00382, AAA, ATPases associated with a variety of cellular activities	Back alignment and domain information

>gnl\|CDD\|177094 CHL00195, ycf46, Ycf46; Provisional	Back alignment and domain information

>gnl\|CDD\|237355 PRK13342, PRK13342, recombination factor protein RarA; Reviewed	Back alignment and domain information

>gnl\|CDD\|215011 smart01072, CDC48_2, Cell division protein 48 (CDC48) domain 2	Back alignment and domain information

>gnl\|CDD\|225165 COG2256, MGS1, ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|237355 PRK13342, PRK13342, recombination factor protein RarA; Reviewed	Back alignment and domain information

>gnl\|CDD\|202475 pfam02933, CDC48_2, Cell division protein 48 (CDC48), domain 2	Back alignment and domain information

>gnl\|CDD\|223786 COG0714, COG0714, MoxR-like ATPases [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|223616 COG0542, clpA, ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|188437 TIGR03922, T7SS_EccA, type VII secretion AAA-ATPase EccA	Back alignment and domain information

>gnl\|CDD\|188437 TIGR03922, T7SS_EccA, type VII secretion AAA-ATPase EccA	Back alignment and domain information

>gnl\|CDD\|223666 COG0593, DnaA, ATPase involved in DNA replication initiation [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|237354 PRK13341, PRK13341, recombination factor protein RarA/unknown domain fusion protein; Reviewed	Back alignment and domain information

>gnl\|CDD\|225164 COG2255, RuvB, Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|234619 PRK00080, ruvB, Holliday junction DNA helicase RuvB; Reviewed	Back alignment and domain information

>gnl\|CDD\|219538 pfam07728, AAA_5, AAA domain (dynein-related subfamily)	Back alignment and domain information

>gnl\|CDD\|129721 TIGR00635, ruvB, Holliday junction DNA helicase, RuvB subunit	Back alignment and domain information

>gnl\|CDD\|225165 COG2256, MGS1, ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|222866 PHA02544, 44, clamp loader, small subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|234619 PRK00080, ruvB, Holliday junction DNA helicase RuvB; Reviewed	Back alignment and domain information

>gnl\|CDD\|203260 pfam05496, RuvB_N, Holliday junction DNA helicase ruvB N-terminus	Back alignment and domain information

>gnl\|CDD\|225164 COG2255, RuvB, Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|222104 pfam13401, AAA_22, AAA domain	Back alignment and domain information

>gnl\|CDD\|129721 TIGR00635, ruvB, Holliday junction DNA helicase, RuvB subunit	Back alignment and domain information

>gnl\|CDD\|219536 pfam07724, AAA_2, AAA domain (Cdc48 subfamily)	Back alignment and domain information

>gnl\|CDD\|223786 COG0714, COG0714, MoxR-like ATPases [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|224401 COG1484, DnaC, DNA replication protein [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|232949 TIGR00382, clpX, endopeptidase Clp ATP-binding regulatory subunit (clpX)	Back alignment and domain information

>gnl\|CDD\|224145 COG1224, TIP49, DNA helicase TIP49, TBP-interacting protein [Transcription]	Back alignment and domain information

>gnl\|CDD\|224401 COG1484, DnaC, DNA replication protein [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|203260 pfam05496, RuvB_N, Holliday junction DNA helicase ruvB N-terminus	Back alignment and domain information

>gnl\|CDD\|147949 pfam06068, TIP49, TIP49 C-terminus	Back alignment and domain information

>gnl\|CDD\|237354 PRK13341, PRK13341, recombination factor protein RarA/unknown domain fusion protein; Reviewed	Back alignment and domain information

>gnl\|CDD\|224140 COG1219, ClpX, ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|235422 PRK05342, clpX, ATP-dependent protease ATP-binding subunit ClpX; Provisional	Back alignment and domain information

>gnl\|CDD\|224391 COG1474, CDC6, Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|236153 PRK08116, PRK08116, hypothetical protein; Validated	Back alignment and domain information

>gnl\|CDD\|219536 pfam07724, AAA_2, AAA domain (Cdc48 subfamily)	Back alignment and domain information

>gnl\|CDD\|235871 PRK06835, PRK06835, DNA replication protein DnaC; Validated	Back alignment and domain information

>gnl\|CDD\|223616 COG0542, clpA, ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|236153 PRK08116, PRK08116, hypothetical protein; Validated	Back alignment and domain information

>gnl\|CDD\|216186 pfam00910, RNA_helicase, RNA helicase	Back alignment and domain information

>gnl\|CDD\|238540 cd01120, RecA-like_NTPases, RecA-like NTPases	Back alignment and domain information

>gnl\|CDD\|221983 pfam13207, AAA_17, AAA domain	Back alignment and domain information

>gnl\|CDD\|163057 TIGR02881, spore_V_K, stage V sporulation protein K	Back alignment and domain information

>gnl\|CDD\|214396 CHL00206, ycf2, Ycf2; Provisional	Back alignment and domain information

>gnl\|CDD\|216270 pfam01057, Parvo_NS1, Parvovirus non-structural protein NS1	Back alignment and domain information

>gnl\|CDD\|224292 COG1373, COG1373, Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|233959 TIGR02639, ClpA, ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>gnl\|CDD\|144608 pfam01078, Mg_chelatase, Magnesium chelatase, subunit ChlI	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		719
KOG0733		802	consensus Nuclear AAA ATPase (VCP subfamily) [Post	100.0
KOG0730		693	consensus AAA+-type ATPase [Posttranslational modi	100.0
TIGR01243		733	CDC48 AAA family ATPase, CDC48 subfamily. This sub	100.0
KOG0736		953	consensus Peroxisome assembly factor 2 containing	100.0
KOG0735		952	consensus AAA+-type ATPase [Posttranslational modi	100.0
COG0464		494	SpoVK ATPases of the AAA+ class [Posttranslational	100.0
COG1222		406	RPT1 ATP-dependent 26S proteasome regulatory subun	100.0
KOG0738		491	consensus AAA+-type ATPase [Posttranslational modi	100.0
KOG0741		744	consensus AAA+-type ATPase [Posttranslational modi	100.0
COG1222		406	RPT1 ATP-dependent 26S proteasome regulatory subun	100.0
KOG0739		439	consensus AAA+-type ATPase [Posttranslational modi	100.0
KOG0727		408	consensus 26S proteasome regulatory complex, ATPas	100.0
KOG0728		404	consensus 26S proteasome regulatory complex, ATPas	100.0
CHL00195		489	ycf46 Ycf46; Provisional	100.0
KOG0734		752	consensus AAA+-type ATPase containing the peptidas	100.0
KOG0729		435	consensus 26S proteasome regulatory complex, ATPas	100.0
KOG0726		440	consensus 26S proteasome regulatory complex, ATPas	100.0
KOG0652		424	consensus 26S proteasome regulatory complex, ATPas	100.0
KOG0730		693	consensus AAA+-type ATPase [Posttranslational modi	100.0
KOG0733		802	consensus Nuclear AAA ATPase (VCP subfamily) [Post	100.0
KOG0731		774	consensus AAA+-type ATPase containing the peptidas	100.0
KOG0737		386	consensus AAA+-type ATPase [Posttranslational modi	100.0
PTZ00454		398	26S protease regulatory subunit 6B-like protein; P	100.0
COG1223		368	Predicted ATPase (AAA+ superfamily) [General funct	100.0
COG0465		596	HflB ATP-dependent Zn proteases [Posttranslational	100.0
PRK03992		389	proteasome-activating nucleotidase; Provisional	100.0
KOG0736		953	consensus Peroxisome assembly factor 2 containing	100.0
PTZ00361		438	26 proteosome regulatory subunit 4-like protein; P	100.0
KOG0741		744	consensus AAA+-type ATPase [Posttranslational modi	100.0
KOG0740		428	consensus AAA+-type ATPase [Posttranslational modi	100.0
KOG0738		491	consensus AAA+-type ATPase [Posttranslational modi	100.0
COG1223		368	Predicted ATPase (AAA+ superfamily) [General funct	100.0
KOG0728		404	consensus 26S proteasome regulatory complex, ATPas	100.0
KOG0651		388	consensus 26S proteasome regulatory complex, ATPas	100.0
KOG0734		752	consensus AAA+-type ATPase containing the peptidas	100.0
TIGR01241		495	FtsH_fam ATP-dependent metalloprotease FtsH. HflB(	100.0
KOG0652		424	consensus 26S proteasome regulatory complex, ATPas	100.0
TIGR03689		512	pup_AAA proteasome ATPase. In the Actinobacteria,	100.0
KOG0727		408	consensus 26S proteasome regulatory complex, ATPas	100.0
KOG0726		440	consensus 26S proteasome regulatory complex, ATPas	100.0
TIGR01242		364	26Sp45 26S proteasome subunit P45 family. Many pro	100.0
KOG0729		435	consensus 26S proteasome regulatory complex, ATPas	100.0
KOG0732		1080	consensus AAA+-type ATPase containing the bromodom	100.0
CHL00176		638	ftsH cell division protein; Validated	100.0
KOG0735		952	consensus AAA+-type ATPase [Posttranslational modi	100.0
PRK10733		644	hflB ATP-dependent metalloprotease; Reviewed	100.0
PTZ00454		398	26S protease regulatory subunit 6B-like protein; P	100.0
KOG0739		439	consensus AAA+-type ATPase [Posttranslational modi	100.0
CHL00206		2281	ycf2 Ycf2; Provisional	100.0
KOG0732		1080	consensus AAA+-type ATPase containing the bromodom	100.0
KOG0731		774	consensus AAA+-type ATPase containing the peptidas	100.0
KOG0737		386	consensus AAA+-type ATPase [Posttranslational modi	100.0
TIGR01243		733	CDC48 AAA family ATPase, CDC48 subfamily. This sub	100.0
PLN00020		413	ribulose bisphosphate carboxylase/oxygenase activa	100.0
PRK03992		389	proteasome-activating nucleotidase; Provisional	100.0
TIGR02639		731	ClpA ATP-dependent Clp protease ATP-binding subuni	100.0
PTZ00361		438	26 proteosome regulatory subunit 4-like protein; P	100.0
COG0464		494	SpoVK ATPases of the AAA+ class [Posttranslational	100.0
PRK11034		758	clpA ATP-dependent Clp protease ATP-binding subuni	100.0
COG0465		596	HflB ATP-dependent Zn proteases [Posttranslational	100.0
CHL00195		489	ycf46 Ycf46; Provisional	100.0
TIGR01242		364	26Sp45 26S proteasome subunit P45 family. Many pro	100.0
KOG0651		388	consensus 26S proteasome regulatory complex, ATPas	99.98
TIGR01241		495	FtsH_fam ATP-dependent metalloprotease FtsH. HflB(	99.98
TIGR03689		512	pup_AAA proteasome ATPase. In the Actinobacteria,	99.97
CHL00176		638	ftsH cell division protein; Validated	99.97
TIGR03345		852	VI_ClpV1 type VI secretion ATPase, ClpV1 family. M	99.97
CHL00095		821	clpC Clp protease ATP binding subunit	99.97
PRK10865		857	protein disaggregation chaperone; Provisional	99.96
KOG0740		428	consensus AAA+-type ATPase [Posttranslational modi	99.96
TIGR03346		852	chaperone_ClpB ATP-dependent chaperone ClpB. Membe	99.96
PRK10733		644	hflB ATP-dependent metalloprotease; Reviewed	99.96
COG0542		786	clpA ATP-binding subunits of Clp protease and DnaK	99.96
PLN00020		413	ribulose bisphosphate carboxylase/oxygenase activa	99.96
CHL00206		2281	ycf2 Ycf2; Provisional	99.96
KOG0743		457	consensus AAA+-type ATPase [Posttranslational modi	99.92
KOG0744		423	consensus AAA+-type ATPase [Posttranslational modi	99.9
CHL00181		287	cbbX CbbX; Provisional	99.89
TIGR02881		261	spore_V_K stage V sporulation protein K. Members o	99.88
TIGR02880		284	cbbX_cfxQ probable Rubsico expression protein CbbX	99.88
PF00004		132	AAA: ATPase family associated with various cellula	99.88
KOG0742		630	consensus AAA+-type ATPase [Posttranslational modi	99.86
PF00004		132	AAA: ATPase family associated with various cellula	99.82
CHL00181		287	cbbX CbbX; Provisional	99.77
TIGR02880		284	cbbX_cfxQ probable Rubsico expression protein CbbX	99.76
TIGR00763		775	lon ATP-dependent protease La. This protein is ind	99.76
PF05496		233	RuvB_N: Holliday junction DNA helicase ruvB N-term	99.75
TIGR02639		731	ClpA ATP-dependent Clp protease ATP-binding subuni	99.74
TIGR02881		261	spore_V_K stage V sporulation protein K. Members o	99.74
TIGR00635		305	ruvB Holliday junction DNA helicase, RuvB subunit.	99.71
PRK00080		328	ruvB Holliday junction DNA helicase RuvB; Reviewed	99.71
KOG0744		423	consensus AAA+-type ATPase [Posttranslational modi	99.7
KOG0742		630	consensus AAA+-type ATPase [Posttranslational modi	99.7
PRK11034		758	clpA ATP-dependent Clp protease ATP-binding subuni	99.69
KOG2004		906	consensus Mitochondrial ATP-dependent protease PIM	99.69
COG0466		782	Lon ATP-dependent Lon protease, bacterial type [Po	99.68
COG2256		436	MGS1 ATPase related to the helicase subunit of the	99.67
COG2255		332	RuvB Holliday junction resolvasome, helicase subun	99.67
KOG0743		457	consensus AAA+-type ATPase [Posttranslational modi	99.66
KOG1051		898	consensus Chaperone HSP104 and related ATP-depende	99.66
PF05496		233	RuvB_N: Holliday junction DNA helicase ruvB N-term	99.65
PRK05342		412	clpX ATP-dependent protease ATP-binding subunit Cl	99.64
PRK10787		784	DNA-binding ATP-dependent protease La; Provisional	99.62
TIGR00390		441	hslU ATP-dependent protease HslVU, ATPase subunit.	99.6
TIGR00382		413	clpX endopeptidase Clp ATP-binding regulatory subu	99.59
TIGR00763		775	lon ATP-dependent protease La. This protein is ind	99.59
PRK07003		830	DNA polymerase III subunits gamma and tau; Validat	99.59
PRK12323		700	DNA polymerase III subunits gamma and tau; Provisi	99.58
TIGR02902		531	spore_lonB ATP-dependent protease LonB. Members of	99.57
PRK10865		857	protein disaggregation chaperone; Provisional	99.57
TIGR03345		852	VI_ClpV1 type VI secretion ATPase, ClpV1 family. M	99.57
PRK13342		413	recombination factor protein RarA; Reviewed	99.57
PRK14962		472	DNA polymerase III subunits gamma and tau; Provisi	99.57
TIGR02928		365	orc1/cdc6 family replication initiation protein. M	99.57
TIGR00362		405	DnaA chromosomal replication initiator protein Dna	99.57
PRK00149		450	dnaA chromosomal replication initiation protein; R	99.57
PRK14956		484	DNA polymerase III subunits gamma and tau; Provisi	99.55
PRK00411		394	cdc6 cell division control protein 6; Reviewed	99.55
PRK04195		482	replication factor C large subunit; Provisional	99.54
PRK05201		443	hslU ATP-dependent protease ATP-binding subunit Hs	99.54
PRK07940		394	DNA polymerase III subunit delta'; Validated	99.54
PRK00080		328	ruvB Holliday junction DNA helicase RuvB; Reviewed	99.54
COG2255		332	RuvB Holliday junction resolvasome, helicase subun	99.54
TIGR00635		305	ruvB Holliday junction DNA helicase, RuvB subunit.	99.53
TIGR03346		852	chaperone_ClpB ATP-dependent chaperone ClpB. Membe	99.53
PRK14960		702	DNA polymerase III subunits gamma and tau; Provisi	99.53
PRK14961		363	DNA polymerase III subunits gamma and tau; Provisi	99.52
CHL00095		821	clpC Clp protease ATP binding subunit	99.52
PRK12422		445	chromosomal replication initiation protein; Provis	99.52
PRK14949		944	DNA polymerase III subunits gamma and tau; Provisi	99.52
KOG2004		906	consensus Mitochondrial ATP-dependent protease PIM	99.51
PRK14088		440	dnaA chromosomal replication initiation protein; P	99.5
PRK14086		617	dnaA chromosomal replication initiation protein; P	99.5
COG2256		436	MGS1 ATPase related to the helicase subunit of the	99.5
PRK06645		507	DNA polymerase III subunits gamma and tau; Validat	99.49
PRK07994		647	DNA polymerase III subunits gamma and tau; Validat	99.49
PF05673		249	DUF815: Protein of unknown function (DUF815); Inte	99.49
PTZ00112		1164	origin recognition complex 1 protein; Provisional	99.49
PRK14958		509	DNA polymerase III subunits gamma and tau; Provisi	99.48
PRK05563		559	DNA polymerase III subunits gamma and tau; Validat	99.48
PRK13341		725	recombination factor protein RarA/unknown domain f	99.47
PRK12402		337	replication factor C small subunit 2; Reviewed	99.46
PRK08691		709	DNA polymerase III subunits gamma and tau; Validat	99.46
PRK14959		624	DNA polymerase III subunits gamma and tau; Provisi	99.45
PRK14964		491	DNA polymerase III subunits gamma and tau; Provisi	99.45
PLN03025		319	replication factor C subunit; Provisional	99.45
PRK14963		504	DNA polymerase III subunits gamma and tau; Provisi	99.45
TIGR02903		615	spore_lon_C ATP-dependent protease, Lon family. Me	99.45
PRK07764		824	DNA polymerase III subunits gamma and tau; Validat	99.45
PRK14952		584	DNA polymerase III subunits gamma and tau; Provisi	99.44
PRK06893		229	DNA replication initiation factor; Validated	99.44
TIGR02397		355	dnaX_nterm DNA polymerase III, subunit gamma and t	99.44
PRK14951		618	DNA polymerase III subunits gamma and tau; Provisi	99.44
PHA02544		316	44 clamp loader, small subunit; Provisional	99.43
COG0466		782	Lon ATP-dependent Lon protease, bacterial type [Po	99.42
KOG0989		346	consensus Replication factor C, subunit RFC4 [Repl	99.42
PRK14087		450	dnaA chromosomal replication initiation protein; P	99.42
PRK14957		546	DNA polymerase III subunits gamma and tau; Provisi	99.41
PRK07133		725	DNA polymerase III subunits gamma and tau; Validat	99.4
PRK05896		605	DNA polymerase III subunits gamma and tau; Validat	99.4
PRK14969		527	DNA polymerase III subunits gamma and tau; Provisi	99.4
COG1474		366	CDC6 Cdc6-related protein, AAA superfamily ATPase	99.39
PRK14953		486	DNA polymerase III subunits gamma and tau; Provisi	99.38
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	99.38
PRK14956		484	DNA polymerase III subunits gamma and tau; Provisi	99.38
PRK10787		784	DNA-binding ATP-dependent protease La; Provisional	99.38
PRK07003		830	DNA polymerase III subunits gamma and tau; Validat	99.37
PRK14965		576	DNA polymerase III subunits gamma and tau; Provisi	99.37
PRK08903		227	DnaA regulatory inactivator Hda; Validated	99.36
PRK14970		367	DNA polymerase III subunits gamma and tau; Provisi	99.36
PRK06305		451	DNA polymerase III subunits gamma and tau; Validat	99.36
PRK08084		235	DNA replication initiation factor; Provisional	99.35
PRK04195		482	replication factor C large subunit; Provisional	99.35
PRK12323		700	DNA polymerase III subunits gamma and tau; Provisi	99.35
KOG2028		554	consensus ATPase related to the helicase subunit o	99.35
PRK05642		234	DNA replication initiation factor; Validated	99.35
COG1224		450	TIP49 DNA helicase TIP49, TBP-interacting protein	99.34
PRK06647		563	DNA polymerase III subunits gamma and tau; Validat	99.34
PRK09111		598	DNA polymerase III subunits gamma and tau; Validat	99.33
PRK14962		472	DNA polymerase III subunits gamma and tau; Provisi	99.33
COG0593		408	DnaA ATPase involved in DNA replication initiation	99.33
PRK08451		535	DNA polymerase III subunits gamma and tau; Validat	99.33
PRK07940		394	DNA polymerase III subunit delta'; Validated	99.33
PRK08727		233	hypothetical protein; Validated	99.32
TIGR02928		365	orc1/cdc6 family replication initiation protein. M	99.32
PF00308		219	Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013	99.32
TIGR02902		531	spore_lonB ATP-dependent protease LonB. Members of	99.31
PRK13342		413	recombination factor protein RarA; Reviewed	99.3
PRK14948		620	DNA polymerase III subunits gamma and tau; Provisi	99.3
PRK14954		620	DNA polymerase III subunits gamma and tau; Provisi	99.3
TIGR02640		262	gas_vesic_GvpN gas vesicle protein GvpN. Members o	99.3
PRK00411		394	cdc6 cell division control protein 6; Reviewed	99.3
COG1219		408	ClpX ATP-dependent protease Clp, ATPase subunit [P	99.29
TIGR00390		441	hslU ATP-dependent protease HslVU, ATPase subunit.	99.29
TIGR01650		327	PD_CobS cobaltochelatase, CobS subunit. This model	99.28
PRK14955		397	DNA polymerase III subunits gamma and tau; Provisi	99.28
PRK00440		319	rfc replication factor C small subunit; Reviewed	99.28
PRK00149		450	dnaA chromosomal replication initiation protein; R	99.28
PRK06620		214	hypothetical protein; Validated	99.28
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	99.28
PRK14960		702	DNA polymerase III subunits gamma and tau; Provisi	99.27
PRK14949		944	DNA polymerase III subunits gamma and tau; Provisi	99.27
PRK05201		443	hslU ATP-dependent protease ATP-binding subunit Hs	99.26
PRK07994		647	DNA polymerase III subunits gamma and tau; Validat	99.26
PF05673		249	DUF815: Protein of unknown function (DUF815); Inte	99.26
PRK05342		412	clpX ATP-dependent protease ATP-binding subunit Cl	99.26
cd00009		151	AAA The AAA+ (ATPases Associated with a wide varie	99.26
PLN03025		319	replication factor C subunit; Provisional	99.26
PRK06645		507	DNA polymerase III subunits gamma and tau; Validat	99.24
TIGR00362		405	DnaA chromosomal replication initiator protein Dna	99.24
PHA02544		316	44 clamp loader, small subunit; Provisional	99.24
PRK14961		363	DNA polymerase III subunits gamma and tau; Provisi	99.24
PTZ00112		1164	origin recognition complex 1 protein; Provisional	99.24
PRK14950		585	DNA polymerase III subunits gamma and tau; Provisi	99.23
KOG2028		554	consensus ATPase related to the helicase subunit o	99.22
KOG1969		877	consensus DNA replication checkpoint protein CHL12	99.22
PRK14971		614	DNA polymerase III subunits gamma and tau; Provisi	99.21
PRK06893		229	DNA replication initiation factor; Validated	99.21
PRK14088		440	dnaA chromosomal replication initiation protein; P	99.2
PRK13407		334	bchI magnesium chelatase subunit I; Provisional	99.2
PRK14958		509	DNA polymerase III subunits gamma and tau; Provisi	99.2
COG2607		287	Predicted ATPase (AAA+ superfamily) [General funct	99.2
PRK14086		617	dnaA chromosomal replication initiation protein; P	99.2
PRK14964		491	DNA polymerase III subunits gamma and tau; Provisi	99.2
PRK08691		709	DNA polymerase III subunits gamma and tau; Validat	99.2
PRK14963		504	DNA polymerase III subunits gamma and tau; Provisi	99.19
PRK12402		337	replication factor C small subunit 2; Reviewed	99.19
COG2812		515	DnaX DNA polymerase III, gamma/tau subunits [DNA r	99.18
TIGR02640		262	gas_vesic_GvpN gas vesicle protein GvpN. Members o	99.18
cd00009		151	AAA The AAA+ (ATPases Associated with a wide varie	99.17
PRK14959		624	DNA polymerase III subunits gamma and tau; Provisi	99.17
PRK08084		235	DNA replication initiation factor; Provisional	99.17
TIGR00678		188	holB DNA polymerase III, delta' subunit. At positi	99.16
PRK07764		824	DNA polymerase III subunits gamma and tau; Validat	99.16
PHA02244		383	ATPase-like protein	99.16
PF00308		219	Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013	99.16
PRK14957		546	DNA polymerase III subunits gamma and tau; Provisi	99.15
PRK08727		233	hypothetical protein; Validated	99.15
PRK08903		227	DnaA regulatory inactivator Hda; Validated	99.15
PRK14952		584	DNA polymerase III subunits gamma and tau; Provisi	99.15
PRK12422		445	chromosomal replication initiation protein; Provis	99.14
TIGR00382		413	clpX endopeptidase Clp ATP-binding regulatory subu	99.14
PRK05896		605	DNA polymerase III subunits gamma and tau; Validat	99.14
PRK14951		618	DNA polymerase III subunits gamma and tau; Provisi	99.14
PRK09087		226	hypothetical protein; Validated	99.14
PRK09112		351	DNA polymerase III subunit delta'; Validated	99.13
KOG0989		346	consensus Replication factor C, subunit RFC4 [Repl	99.13
PRK14969		527	DNA polymerase III subunits gamma and tau; Provisi	99.13
PF07728		139	AAA_5: AAA domain (dynein-related subfamily); Inte	99.13
PF07724		171	AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR	99.12
PRK13341		725	recombination factor protein RarA/unknown domain f	99.12
COG0714		329	MoxR-like ATPases [General function prediction onl	99.12
PRK05563		559	DNA polymerase III subunits gamma and tau; Validat	99.12
PRK07133		725	DNA polymerase III subunits gamma and tau; Validat	99.12
CHL00081		350	chlI Mg-protoporyphyrin IX chelatase	99.11
smart00382		148	AAA ATPases associated with a variety of cellular	99.11
PRK11331		459	5-methylcytosine-specific restriction enzyme subun	99.11
COG0542		786	clpA ATP-binding subunits of Clp protease and DnaK	99.1
TIGR02397		355	dnaX_nterm DNA polymerase III, subunit gamma and t	99.09
TIGR02030		337	BchI-ChlI magnesium chelatase ATPase subunit I. Th	99.09
KOG0745		564	consensus Putative ATP-dependent Clp-type protease	99.09
PRK14953		486	DNA polymerase III subunits gamma and tau; Provisi	99.08
PRK05642		234	DNA replication initiation factor; Validated	99.08
PRK07471		365	DNA polymerase III subunit delta'; Validated	99.08
PRK14970		367	DNA polymerase III subunits gamma and tau; Provisi	99.08
PRK05564		313	DNA polymerase III subunit delta'; Validated	99.07
TIGR00764		608	lon_rel lon-related putative ATP-dependent proteas	99.06
PRK06647		563	DNA polymerase III subunits gamma and tau; Validat	99.06
PRK14965		576	DNA polymerase III subunits gamma and tau; Provisi	99.05
TIGR01650		327	PD_CobS cobaltochelatase, CobS subunit. This model	99.05
PRK06305		451	DNA polymerase III subunits gamma and tau; Validat	99.05
COG1474		366	CDC6 Cdc6-related protein, AAA superfamily ATPase	99.04
PHA02244		383	ATPase-like protein	99.04
PRK14087		450	dnaA chromosomal replication initiation protein; P	99.04
COG5271		4600	MDN1 AAA ATPase containing von Willebrand factor t	99.03
TIGR02442		633	Cob-chelat-sub cobaltochelatase subunit. A number	99.03
TIGR03015		269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	99.03
COG0488		530	Uup ATPase components of ABC transporters with dup	99.03
PF06068		398	TIP49: TIP49 C-terminus; InterPro: IPR010339 This	99.02
TIGR02903		615	spore_lon_C ATP-dependent protease, Lon family. Me	99.02
PRK00440		319	rfc replication factor C small subunit; Reviewed	99.02
PRK14948		620	DNA polymerase III subunits gamma and tau; Provisi	99.01
PRK09111		598	DNA polymerase III subunits gamma and tau; Validat	99.01
PRK08451		535	DNA polymerase III subunits gamma and tau; Validat	98.99
KOG1969		877	consensus DNA replication checkpoint protein CHL12	98.99
PRK07399		314	DNA polymerase III subunit delta'; Validated	98.98
PRK14954		620	DNA polymerase III subunits gamma and tau; Provisi	98.97
smart00382		148	AAA ATPases associated with a variety of cellular	98.97
PRK06620		214	hypothetical protein; Validated	98.96
PRK13407		334	bchI magnesium chelatase subunit I; Provisional	98.95
PRK04132		846	replication factor C small subunit; Provisional	98.95
PRK14955		397	DNA polymerase III subunits gamma and tau; Provisi	98.95
PRK05707		328	DNA polymerase III subunit delta'; Validated	98.94
PF07728		139	AAA_5: AAA domain (dynein-related subfamily); Inte	98.93
COG0470		325	HolB ATPase involved in DNA replication [DNA repli	98.93
COG1123		539	ATPase components of various ABC-type transport sy	98.92
PRK14950		585	DNA polymerase III subunits gamma and tau; Provisi	98.91
PRK09087		226	hypothetical protein; Validated	98.91
PF01078		206	Mg_chelatase: Magnesium chelatase, subunit ChlI; I	98.91
COG0593		408	DnaA ATPase involved in DNA replication initiation	98.9
TIGR00368		499	Mg chelatase-related protein. The N-terminal end m	98.9
smart00763		361	AAA_PrkA PrkA AAA domain. This is a family of PrkA	98.9
COG2812		515	DnaX DNA polymerase III, gamma/tau subunits [DNA r	98.89
PRK08058		329	DNA polymerase III subunit delta'; Validated	98.88
COG1220		444	HslU ATP-dependent protease HslVU (ClpYQ), ATPase	98.88
PRK13531		498	regulatory ATPase RavA; Provisional	98.86
KOG1514		767	consensus Origin recognition complex, subunit 1, a	98.85
PF07724		171	AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR	98.84
PRK09112		351	DNA polymerase III subunit delta'; Validated	98.84
KOG1942		456	consensus DNA helicase, TBP-interacting protein [R	98.83
COG5271		4600	MDN1 AAA ATPase containing von Willebrand factor t	98.83
smart00350		509	MCM minichromosome maintenance proteins.	98.83
COG0714		329	MoxR-like ATPases [General function prediction onl	98.82
PF05621		302	TniB: Bacterial TniB protein; InterPro: IPR008868	98.81
PRK11331		459	5-methylcytosine-specific restriction enzyme subun	98.81
PF07726		131	AAA_3: ATPase family associated with various cellu	98.8
CHL00081		350	chlI Mg-protoporyphyrin IX chelatase	98.8
PRK08116		268	hypothetical protein; Validated	98.8
PRK14971		614	DNA polymerase III subunits gamma and tau; Provisi	98.79
TIGR02030		337	BchI-ChlI magnesium chelatase ATPase subunit I. Th	98.79
PRK06964		342	DNA polymerase III subunit delta'; Validated	98.79
COG2607		287	Predicted ATPase (AAA+ superfamily) [General funct	98.78
TIGR00678		188	holB DNA polymerase III, delta' subunit. At positi	98.78
KOG0991		333	consensus Replication factor C, subunit RFC2 [Repl	98.77
TIGR02031		589	BchD-ChlD magnesium chelatase ATPase subunit D. Th	98.77
PRK11608		326	pspF phage shock protein operon transcriptional ac	98.77
TIGR00602		637	rad24 checkpoint protein rad24. This family is bas	98.76
TIGR02974		329	phageshock_pspF psp operon transcriptional activat	98.74
PRK05564		313	DNA polymerase III subunit delta'; Validated	98.73
COG1221		403	PspF Transcriptional regulators containing an AAA-	98.72
KOG2227		529	consensus Pre-initiation complex, subunit CDC6, AA	98.72
PF13177		162	DNA_pol3_delta2: DNA polymerase III, delta subunit	98.71
PRK07471		365	DNA polymerase III subunit delta'; Validated	98.7
TIGR01817		534	nifA Nif-specific regulatory protein. This model r	98.7
TIGR00602		637	rad24 checkpoint protein rad24. This family is bas	98.69
COG1220		444	HslU ATP-dependent protease HslVU (ClpYQ), ATPase	98.69
PF07726		131	AAA_3: ATPase family associated with various cellu	98.68
KOG0927		614	consensus Predicted transporter (ABC superfamily)	98.68
PRK13531		498	regulatory ATPase RavA; Provisional	98.68
TIGR02329		526	propionate_PrpR propionate catabolism operon regul	98.68
COG1219		408	ClpX ATP-dependent protease Clp, ATPase subunit [P	98.67
TIGR02655		484	circ_KaiC circadian clock protein KaiC. Members of	98.66
KOG0991		333	consensus Replication factor C, subunit RFC2 [Repl	98.66
COG3829		560	RocR Transcriptional regulator containing PAS, AAA	98.66
PF01078		206	Mg_chelatase: Magnesium chelatase, subunit ChlI; I	98.66
COG1224		450	TIP49 DNA helicase TIP49, TBP-interacting protein	98.65
PRK09862		506	putative ATP-dependent protease; Provisional	98.65
PRK15424		538	propionate catabolism operon regulatory protein Pr	98.64
PRK06871		325	DNA polymerase III subunit delta'; Validated	98.64
KOG2680		454	consensus DNA helicase TIP49, TBP-interacting prot	98.62
PRK05707		328	DNA polymerase III subunit delta'; Validated	98.61
PF05621		302	TniB: Bacterial TniB protein; InterPro: IPR008868	98.61
TIGR02442		633	Cob-chelat-sub cobaltochelatase subunit. A number	98.61
COG0470		325	HolB ATPase involved in DNA replication [DNA repli	98.6
PRK05022		509	anaerobic nitric oxide reductase transcription reg	98.59
PRK11388		638	DNA-binding transcriptional regulator DhaR; Provis	98.59
PRK15429		686	formate hydrogenlyase transcriptional activator Fh	98.59
PRK08769		319	DNA polymerase III subunit delta'; Validated	98.58
TIGR03015		269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	98.57
PRK07993		334	DNA polymerase III subunit delta'; Validated	98.57
PRK13765		637	ATP-dependent protease Lon; Provisional	98.56
PRK10820		520	DNA-binding transcriptional regulator TyrR; Provis	98.55
PF00158		168	Sigma54_activat: Sigma-54 interaction domain; Inte	98.55
PRK04132		846	replication factor C small subunit; Provisional	98.54
PRK07399		314	DNA polymerase III subunit delta'; Validated	98.54
COG2204		464	AtoC Response regulator containing CheY-like recei	98.54
PRK08116		268	hypothetical protein; Validated	98.54
COG1239		423	ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis	98.53
PRK06090		319	DNA polymerase III subunit delta'; Validated	98.52
PRK08181		269	transposase; Validated	98.51
PRK13409		590	putative ATPase RIL; Provisional	98.51
PRK08058		329	DNA polymerase III subunit delta'; Validated	98.51
COG3604		550	FhlA Transcriptional regulator containing GAF, AAA	98.51
KOG0745		564	consensus Putative ATP-dependent Clp-type protease	98.5
PRK08181		269	transposase; Validated	98.49
PRK08699		325	DNA polymerase III subunit delta'; Validated	98.49
PF00158		168	Sigma54_activat: Sigma-54 interaction domain; Inte	98.48
PRK13549		506	xylose transporter ATP-binding subunit; Provisiona	98.48
PF13173		128	AAA_14: AAA domain	98.48
PRK10636		638	putative ABC transporter ATP-binding protein; Prov	98.48
PRK09183		259	transposase/IS protein; Provisional	98.46
PRK07952		244	DNA replication protein DnaC; Validated	98.45
PRK11147		635	ABC transporter ATPase component; Reviewed	98.45
PRK15439		510	autoinducer 2 ABC transporter ATP-binding protein	98.44
PRK06526		254	transposase; Provisional	98.43
PF03215		519	Rad17: Rad17 cell cycle checkpoint protein	98.42
PF13173		128	AAA_14: AAA domain	98.42
PRK06526		254	transposase; Provisional	98.41
COG4172		534	ABC-type uncharacterized transport system, duplica	98.41
PRK09183		259	transposase/IS protein; Provisional	98.41
PRK10982		491	galactose/methyl galaxtoside transporter ATP-bindi	98.41
PRK10762		501	D-ribose transporter ATP binding protein; Provisio	98.4
PRK08939		306	primosomal protein DnaI; Reviewed	98.4
PRK10938		490	putative molybdenum transport ATP-binding protein	98.4
PRK12377		248	putative replication protein; Provisional	98.39
PRK09700		510	D-allose transporter ATP-binding protein; Provisio	98.39
PRK09302		509	circadian clock protein KaiC; Reviewed	98.38
TIGR03269		520	met_CoM_red_A2 methyl coenzyme M reductase system,	98.37
PF01695		178	IstB_IS21: IstB-like ATP binding protein; InterPro	98.37
TIGR00368		499	Mg chelatase-related protein. The N-terminal end m	98.37
PRK06835		329	DNA replication protein DnaC; Validated	98.37
KOG0062		582	consensus ATPase component of ABC transporters wit	98.36
COG0606		490	Predicted ATPase with chaperone activity [Posttran	98.36
COG1221		403	PspF Transcriptional regulators containing an AAA-	98.35
KOG0066		807	consensus eIF2-interacting protein ABC50 (ABC supe	98.35
smart00350		509	MCM minichromosome maintenance proteins.	98.34
PRK15424		538	propionate catabolism operon regulatory protein Pr	98.34
COG1484		254	DnaC DNA replication protein [DNA replication, rec	98.34
PF13401		131	AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S	98.34
PRK15064		530	ABC transporter ATP-binding protein; Provisional	98.33
PRK11288		501	araG L-arabinose transporter ATP-binding protein;	98.33
COG3829		560	RocR Transcriptional regulator containing PAS, AAA	98.33
PF13401		131	AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S	98.32
TIGR02974		329	phageshock_pspF psp operon transcriptional activat	98.32
COG1116		248	TauB ABC-type nitrate/sulfonate/bicarbonate transp	98.32
PRK11608		326	pspF phage shock protein operon transcriptional ac	98.32
COG1484		254	DnaC DNA replication protein [DNA replication, rec	98.31
PF13177		162	DNA_pol3_delta2: DNA polymerase III, delta subunit	98.31
PF01637		234	Arch_ATPase: Archaeal ATPase; InterPro: IPR011579	98.31
PRK06921		266	hypothetical protein; Provisional	98.31
TIGR02031		589	BchD-ChlD magnesium chelatase ATPase subunit D. Th	98.3
PRK06964		342	DNA polymerase III subunit delta'; Validated	98.3
PRK15134		529	microcin C ABC transporter ATP-binding protein Yej	98.29
TIGR02633		500	xylG D-xylose ABC transporter, ATP-binding protein	98.28
PRK06871		325	DNA polymerase III subunit delta'; Validated	98.27
PF01637		234	Arch_ATPase: Archaeal ATPase; InterPro: IPR011579	98.27
PRK06921		266	hypothetical protein; Provisional	98.27
PRK12377		248	putative replication protein; Provisional	98.26
PTZ00111		915	DNA replication licensing factor MCM4; Provisional	98.25
PRK15429		686	formate hydrogenlyase transcriptional activator Fh	98.24
COG4619		223	ABC-type uncharacterized transport system, ATPase	98.24
PRK06835		329	DNA replication protein DnaC; Validated	98.24
TIGR02329		526	propionate_PrpR propionate catabolism operon regul	98.24
PRK05022		509	anaerobic nitric oxide reductase transcription reg	98.23
KOG0990		360	consensus Replication factor C, subunit RFC5 [Repl	98.23
PLN03073		718	ABC transporter F family; Provisional	98.23
COG1239		423	ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis	98.23
PF01695		178	IstB_IS21: IstB-like ATP binding protein; InterPro	98.23
COG1120		258	FepC ABC-type cobalamin/Fe3+-siderophores transpor	98.22
PRK07952		244	DNA replication protein DnaC; Validated	98.21
TIGR02915		445	PEP_resp_reg putative PEP-CTERM system response re	98.2
TIGR01817		534	nifA Nif-specific regulatory protein. This model r	98.2
PRK07993		334	DNA polymerase III subunit delta'; Validated	98.2
cd01120		165	RecA-like_NTPases RecA-like NTPases. This family i	98.19
COG2204		464	AtoC Response regulator containing CheY-like recei	98.18
PF12775		272	AAA_7: P-loop containing dynein motor region D3; P	98.18
PF05729		166	NACHT: NACHT domain	98.17
PF14532		138	Sigma54_activ_2: Sigma-54 interaction domain; PDB:	98.16
PRK10820		520	DNA-binding transcriptional regulator TyrR; Provis	98.15
PRK11388		638	DNA-binding transcriptional regulator DhaR; Provis	98.14
PRK08699		325	DNA polymerase III subunit delta'; Validated	98.14
PF03215		519	Rad17: Rad17 cell cycle checkpoint protein	98.14
COG3842		352	PotA ABC-type spermidine/putrescine transport syst	98.14
PF14532		138	Sigma54_activ_2: Sigma-54 interaction domain; PDB:	98.14
COG1126		240	GlnQ ABC-type polar amino acid transport system, A	98.13
PRK06090		319	DNA polymerase III subunit delta'; Validated	98.13
PRK10923		469	glnG nitrogen regulation protein NR(I); Provisiona	98.12
PRK08769		319	DNA polymerase III subunit delta'; Validated	98.12
cd03216		163	ABC_Carb_Monos_I This family represents the domain	98.11
PRK09862		506	putative ATP-dependent protease; Provisional	98.1
TIGR02237		209	recomb_radB DNA repair and recombination protein R	98.1
PRK08939		306	primosomal protein DnaI; Reviewed	98.1
PRK15115		444	response regulator GlrR; Provisional	98.09
COG1118		345	CysA ABC-type sulfate/molybdate transport systems,	98.09
smart00763		361	AAA_PrkA PrkA AAA domain. This is a family of PrkA	98.08
KOG2035		351	consensus Replication factor C, subunit RFC3 [Cell	98.07
TIGR01818		463	ntrC nitrogen regulation protein NR(I). This model	98.05
PRK10365		441	transcriptional regulatory protein ZraR; Provision	98.05
PF09336		62	Vps4_C: Vps4 C terminal oligomerisation domain; In	98.04
COG3839		338	MalK ABC-type sugar transport systems, ATPase comp	98.04
cd03222		177	ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi	98.03
COG1125		309	OpuBA ABC-type proline/glycine betaine transport s	98.03
PF12775		272	AAA_7: P-loop containing dynein motor region D3; P	98.03
cd01120		165	RecA-like_NTPases RecA-like NTPases. This family i	98.03
COG1121		254	ZnuC ABC-type Mn/Zn transport systems, ATPase comp	98.02
KOG2035		351	consensus Replication factor C, subunit RFC3 [Cell	98.02
PF05729		166	NACHT: NACHT domain	98.02
KOG1968		871	consensus Replication factor C, subunit RFC1 (larg	98.01
COG0606		490	Predicted ATPase with chaperone activity [Posttran	98.01
PRK05917		290	DNA polymerase III subunit delta'; Validated	98.01
PF00910		107	RNA_helicase: RNA helicase; InterPro: IPR000605 He	98.0
PRK11361		457	acetoacetate metabolism regulatory protein AtoC; P	98.0
PF12774		231	AAA_6: Hydrolytic ATP binding site of dynein motor	97.99
PRK06851		367	hypothetical protein; Provisional	97.99
COG1136		226	SalX ABC-type antimicrobial peptide transport syst	97.99
PRK13406		584	bchD magnesium chelatase subunit D; Provisional	97.98
KOG1970		634	consensus Checkpoint RAD17-RFC complex, RAD17/RAD2	97.97
COG1126		240	GlnQ ABC-type polar amino acid transport system, A	97.96
cd03214		180	ABC_Iron-Siderophores_B12_Hemin ABC transporters,	97.96
KOG1942		456	consensus DNA helicase, TBP-interacting protein [R	97.95
COG2884		223	FtsE Predicted ATPase involved in cell division [C	97.94
COG1373		398	Predicted ATPase (AAA+ superfamily) [General funct	97.93
COG1124		252	DppF ABC-type dipeptide/oligopeptide/nickel transp	97.93
KOG1514		767	consensus Origin recognition complex, subunit 1, a	97.92
TIGR02012		321	tigrfam_recA protein RecA. This model describes or	97.92
COG1618		179	Predicted nucleotide kinase [Nucleotide transport	97.92
cd03221		144	ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is	97.9
cd03228		171	ABCC_MRP_Like The MRP (Mutidrug Resistance Protein	97.9
KOG1051		898	consensus Chaperone HSP104 and related ATP-depende	97.9
TIGR02012		321	tigrfam_recA protein RecA. This model describes or	97.89

>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

Probab=100.00  E-value=1.1e-114  Score=912.19  Aligned_cols=555  Identities=49%  Similarity=0.855  Sum_probs=509.7

Q ss_pred             CCCccccccchHHHHHHHHHHHHcccCChhhHhhhCCCCCceEEEECCCCCChHHHHHHHHHHhCCeEEEEechhhhhhc
Q 005014          115 DEVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANETGAFFFCINGPEIMSKL  194 (719)
Q Consensus       115 ~~~~~~~i~G~~~~~~~l~~~~~~~l~~~~~~~~l~~~~~~~vLL~GppGtGKTtla~~la~~l~~~~i~v~~~~l~~~~  194 (719)
                      .+++|.||||+++.+.+|.+++.. ++||+.|..+|+.|++|||||||||||||+||+++|++++.+|+.|+++++++.+
T Consensus       185 snv~f~diGG~d~~~~el~~li~~-i~~Pe~~~~lGv~PprGvLlHGPPGCGKT~lA~AiAgel~vPf~~isApeivSGv  263 (802)
T KOG0733|consen  185 SNVSFSDIGGLDKTLAELCELIIH-IKHPEVFSSLGVRPPRGVLLHGPPGCGKTSLANAIAGELGVPFLSISAPEIVSGV  263 (802)
T ss_pred             CCcchhhccChHHHHHHHHHHHHH-hcCchhHhhcCCCCCCceeeeCCCCccHHHHHHHHhhhcCCceEeecchhhhccc
Confidence            467999999999999999999988 9999999999999999999999999999999999999999999999999999999


Q ss_pred             ccchHHHHHHHHHHHHhcCCcEEEEccccccCCCCCCCchHHHHHHHHHHHHHhhcccCC----CcEEEEEecCCCCCCC
Q 005014          195 AGESESNLRKAFEEAEKNAPSIIFIDEIDSIAPKREKTHGEVERRIVSQLLTLMDGLKSR----AHVIVIGATNRPNSID  270 (719)
Q Consensus       195 ~g~~~~~l~~vf~~a~~~~p~iL~iDEid~l~~~~~~~~~~~~~~v~~~L~~~l~~~~~~----~~vivI~atn~~~~ld  270 (719)
                      .|+++++++.+|+.|....|||+||||||++.++++..+.++++|++.||++.||++...    ..|+||||||+|+.+|
T Consensus       264 SGESEkkiRelF~~A~~~aPcivFiDeIDAI~pkRe~aqreMErRiVaQLlt~mD~l~~~~~~g~~VlVIgATnRPDslD  343 (802)
T KOG0733|consen  264 SGESEKKIRELFDQAKSNAPCIVFIDEIDAITPKREEAQREMERRIVAQLLTSMDELSNEKTKGDPVLVIGATNRPDSLD  343 (802)
T ss_pred             CcccHHHHHHHHHHHhccCCeEEEeecccccccchhhHHHHHHHHHHHHHHHhhhcccccccCCCCeEEEecCCCCcccC
Confidence            999999999999999999999999999999999999999999999999999999998654    5799999999999999


Q ss_pred             HHhhccCCCceEEEeCCCChHHHHHHHHHHhcCCCCCCcccHHHHHHHhCCCccccHHHHHHHHHHHHHHhhcccccc--
Q 005014          271 PALRRFGRFDREIDIGVPDEVGRLEVLRIHTKNMKLSDDVDLERIAKDTHGYVGADLAALCTEAALQCIREKMDVIDL--  348 (719)
Q Consensus       271 ~al~r~~Rf~~~i~i~~P~~~~R~~il~~~~~~~~l~~~~~l~~la~~t~g~~~~dl~~l~~~a~~~~~~~~~~~~~~--  348 (719)
                      |+|||.|||+++|.+..|++.+|.+||+..++++.+..+.++.++|+.|+||+|+||.+||.+|+..++++..+...-  
T Consensus       344 paLRRaGRFdrEI~l~vP~e~aR~~IL~~~~~~lrl~g~~d~~qlA~lTPGfVGADL~AL~~~Aa~vAikR~ld~~~~p~  423 (802)
T KOG0733|consen  344 PALRRAGRFDREICLGVPSETAREEILRIICRGLRLSGDFDFKQLAKLTPGFVGADLMALCREAAFVAIKRILDQSSSPL  423 (802)
T ss_pred             HHHhccccccceeeecCCchHHHHHHHHHHHhhCCCCCCcCHHHHHhcCCCccchhHHHHHHHHHHHHHHHHhhcccCcc
Confidence            999999999999999999999999999999999999999999999999999999999999999999999887652220  


Q ss_pred             -----ccc---------h--h---------------------------hHhHhhccccchHHHHHhhccCCCCcccceee
Q 005014          349 -----EDE---------T--I---------------------------DAEILNSMAVTDEHFKTALGTSNPSALRETVV  385 (719)
Q Consensus       349 -----~~~---------~--~---------------------------~~~~~~~~~v~~~~~~~al~~~~ps~~~~~~~  385 (719)
                           .+.         .  +                           ..+..+.+.+..+||..|+..++|++.|+.+.
T Consensus       424 ~~~~~~ed~~~~~~~~d~S~i~~~~~~~~~~~ld~v~~~~i~~~~d~~S~E~~~~L~i~~eDF~~Al~~iQPSakREGF~  503 (802)
T KOG0733|consen  424 TKVPISEDSSNKDAEEDQSSIKITSNAERPLELDRVVQDAILNNPDPLSKELLEGLSIKFEDFEEALSKIQPSAKREGFA  503 (802)
T ss_pred             ccCCccccccCCCccchhhhhhcCCcccccccHHHHHHHHHHhCCCCcChHHhccceecHHHHHHHHHhcCcchhcccce
Confidence                 000         0  0                           01223345688999999999999999999999


Q ss_pred             ccCCCccccccccHHHHHHhhhccccCCCChhhhhhhcCCCCcceeeecCCCCchhHHHHHHHHHhCCeEEEEeccchhh
Q 005014          386 EVPNVNWEDIGGLENVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLT  465 (719)
Q Consensus       386 ~~~~~~~~~i~g~~~~k~~l~~~i~~~~~~~~~~~~~~~~~~~gill~GppGtGKT~la~~la~~~~~~~i~v~~~~l~~  465 (719)
                      .+|+++|+|||++++++.+|...|.||+++++.|+.+|+..|.|+||+||||||||+||||+|++.+.+|++|+|++|++
T Consensus       504 tVPdVtW~dIGaL~~vR~eL~~aI~~PiK~pd~~k~lGi~~PsGvLL~GPPGCGKTLlAKAVANEag~NFisVKGPELlN  583 (802)
T KOG0733|consen  504 TVPDVTWDDIGALEEVRLELNMAILAPIKRPDLFKALGIDAPSGVLLCGPPGCGKTLLAKAVANEAGANFISVKGPELLN  583 (802)
T ss_pred             ecCCCChhhcccHHHHHHHHHHHHhhhccCHHHHHHhCCCCCCceEEeCCCCccHHHHHHHHhhhccCceEeecCHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hccCCchhhHHHHHHHHHhCCCEEEEEeccchhhcccCCCCCCCCCchHHHHHHHHHHhcCCCCCCcEEEEEecCCCCCC
Q 005014          466 MWFGESEANVREIFDKARQSAPCVLFFDELDSIATQRGSSVGDAGGAADRVLNQLLTEMDGMSAKKTVFIIGATNRPDII  545 (719)
Q Consensus       466 ~~~g~se~~i~~~f~~a~~~~p~il~iDEid~l~~~r~~~~~~~~~~~~~~~~~ll~~ld~~~~~~~v~vi~atn~~~~l  545 (719)
                      +|||+||+.||.+|++||.++||||||||+|+|+++|+...   ..++.|++||||+||||+..+.+|+||+|||||+.|
T Consensus       584 kYVGESErAVR~vFqRAR~saPCVIFFDEiDaL~p~R~~~~---s~~s~RvvNqLLtElDGl~~R~gV~viaATNRPDiI  660 (802)
T KOG0733|consen  584 KYVGESERAVRQVFQRARASAPCVIFFDEIDALVPRRSDEG---SSVSSRVVNQLLTELDGLEERRGVYVIAATNRPDII  660 (802)
T ss_pred             HHhhhHHHHHHHHHHHhhcCCCeEEEecchhhcCcccCCCC---chhHHHHHHHHHHHhcccccccceEEEeecCCCccc
Confidence            99999999999999999999999999999999999998753   567899999999999999999999999999999999


Q ss_pred             CcccCCCCCcceEEEeCCCCHHHHHHHHHHHhc--cCCCCCccCHHHHHHHcc--CCCHHHHHHHHHHHHHHHHHHHHHH
Q 005014          546 DPALLRPGRLDQLIYIPLPDEESRLQIFKACLR--KSPVSKDVDLRALAKYTQ--GFSGADITEICQRACKYAIRENIEK  621 (719)
Q Consensus       546 d~allrpgRf~~~i~~~~p~~~~r~~Il~~~~~--~~~~~~~~d~~~la~~~~--~~sg~di~~~~~~A~~~a~~~~~~~  621 (719)
                      |||+|||||||+.+|+++|+.++|..||+...+  +.+++.|+|+++||+.+.  |||||||..+|++|.+.|+++.+..
T Consensus       661 DpAiLRPGRlDk~LyV~lPn~~eR~~ILK~~tkn~k~pl~~dVdl~eia~~~~c~gftGADLaaLvreAsi~AL~~~~~~  740 (802)
T KOG0733|consen  661 DPAILRPGRLDKLLYVGLPNAEERVAILKTITKNTKPPLSSDVDLDEIARNTKCEGFTGADLAALVREASILALRESLFE  740 (802)
T ss_pred             chhhcCCCccCceeeecCCCHHHHHHHHHHHhccCCCCCCcccCHHHHhhcccccCCchhhHHHHHHHHHHHHHHHHHhh
Confidence            999999999999999999999999999999999  788999999999999886  9999999999999999999998752


Q ss_pred             HHHHHhhhcCCCcccccccccccccccHHHHHHHHhhcCCCCCHHHHHHHHHHHHHHhhcc
Q 005014          622 DIERERRRSENPEAMEEDVEDEVAEIKAVHFEESMKYARRSVSDADIRKYQAFAQTLQQSR  682 (719)
Q Consensus       622 ~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~a~~~~~~sv~~~~~~~~~~~~~~~~~~~  682 (719)
                      ..       .+.....-  ......+++.||++|++.++||+++.+-+.|+...+.++-+.
T Consensus       741 ~~-------~~~~~~~~--~~~~~~~t~~hF~eA~~~i~pSv~~~dr~~Yd~l~k~~~L~~  792 (802)
T KOG0733|consen  741 ID-------SSEDDVTV--RSSTIIVTYKHFEEAFQRIRPSVSERDRKKYDRLNKSRSLST  792 (802)
T ss_pred             cc-------ccCcccce--eeeeeeecHHHHHHHHHhcCCCccHHHHHHHHHHhhhhcccc
Confidence            21       00000000  001235889999999999999999999999999998876443

>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>CHL00195 ycf46 Ycf46; Provisional	Back alignment and domain information

>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional	Back alignment and domain information

>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK03992 proteasome-activating nucleotidase; Provisional	Back alignment and domain information

>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional	Back alignment and domain information

>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH	Back alignment and domain information

>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR03689 pup_AAA proteasome ATPase	Back alignment and domain information

>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01242 26Sp45 26S proteasome subunit P45 family	Back alignment and domain information

>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>CHL00176 ftsH cell division protein; Validated	Back alignment and domain information

>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK10733 hflB ATP-dependent metalloprotease; Reviewed	Back alignment and domain information

>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional	Back alignment and domain information

>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>CHL00206 ycf2 Ycf2; Provisional	Back alignment and domain information

>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional	Back alignment and domain information

>PRK03992 proteasome-activating nucleotidase; Provisional	Back alignment and domain information

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional	Back alignment and domain information

>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>CHL00195 ycf46 Ycf46; Provisional	Back alignment and domain information

>TIGR01242 26Sp45 26S proteasome subunit P45 family	Back alignment and domain information

>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH	Back alignment and domain information

>TIGR03689 pup_AAA proteasome ATPase	Back alignment and domain information

>CHL00176 ftsH cell division protein; Validated	Back alignment and domain information

>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family	Back alignment and domain information

>CHL00095 clpC Clp protease ATP binding subunit	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB	Back alignment and domain information

>PRK10733 hflB ATP-dependent metalloprotease; Reviewed	Back alignment and domain information

>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional	Back alignment and domain information

>CHL00206 ycf2 Ycf2; Provisional	Back alignment and domain information

>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>CHL00181 cbbX CbbX; Provisional	Back alignment and domain information

>TIGR02881 spore_V_K stage V sporulation protein K	Back alignment and domain information

>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX	Back alignment and domain information

>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport	Back alignment and domain information

>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport	Back alignment and domain information

>CHL00181 cbbX CbbX; Provisional	Back alignment and domain information

>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX	Back alignment and domain information

>TIGR00763 lon ATP-dependent protease La	Back alignment and domain information

>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair	Back alignment and domain information

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>TIGR02881 spore_V_K stage V sporulation protein K	Back alignment and domain information

>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit	Back alignment and domain information

>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed	Back alignment and domain information

>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]	Back alignment and domain information

>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair	Back alignment and domain information

>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional	Back alignment and domain information

>PRK10787 DNA-binding ATP-dependent protease La; Provisional	Back alignment and domain information

>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit	Back alignment and domain information

>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX)	Back alignment and domain information

>TIGR00763 lon ATP-dependent protease La	Back alignment and domain information

>PRK07003 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK12323 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR02902 spore_lonB ATP-dependent protease LonB	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family	Back alignment and domain information

>PRK13342 recombination factor protein RarA; Reviewed	Back alignment and domain information

>PRK14962 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR02928 orc1/cdc6 family replication initiation protein	Back alignment and domain information

>TIGR00362 DnaA chromosomal replication initiator protein DnaA	Back alignment and domain information

>PRK00149 dnaA chromosomal replication initiation protein; Reviewed	Back alignment and domain information

>PRK14956 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK00411 cdc6 cell division control protein 6; Reviewed	Back alignment and domain information

>PRK04195 replication factor C large subunit; Provisional	Back alignment and domain information

>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional	Back alignment and domain information

>PRK07940 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed	Back alignment and domain information

>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit	Back alignment and domain information

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB	Back alignment and domain information

>PRK14960 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14961 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>CHL00095 clpC Clp protease ATP binding subunit	Back alignment and domain information

>PRK12422 chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK14949 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14088 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK14086 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK06645 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK07994 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function	Back alignment and domain information

>PTZ00112 origin recognition complex 1 protein; Provisional	Back alignment and domain information

>PRK14958 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK05563 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed	Back alignment and domain information

>PRK12402 replication factor C small subunit 2; Reviewed	Back alignment and domain information

>PRK08691 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14959 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14964 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PLN03025 replication factor C subunit; Provisional	Back alignment and domain information

>PRK14963 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR02903 spore_lon_C ATP-dependent protease, Lon family	Back alignment and domain information

>PRK07764 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14952 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau	Back alignment and domain information

>PRK14951 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PHA02544 44 clamp loader, small subunit; Provisional	Back alignment and domain information

>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair]	Back alignment and domain information

>PRK14087 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK14957 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK07133 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK05896 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14969 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14953 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>PRK14956 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK10787 DNA-binding ATP-dependent protease La; Provisional	Back alignment and domain information

>PRK07003 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14965 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK08903 DnaA regulatory inactivator Hda; Validated	Back alignment and domain information

>PRK14970 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK06305 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK08084 DNA replication initiation factor; Provisional	Back alignment and domain information

>PRK04195 replication factor C large subunit; Provisional	Back alignment and domain information

>PRK12323 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair]	Back alignment and domain information

>PRK05642 DNA replication initiation factor; Validated	Back alignment and domain information

>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription]	Back alignment and domain information

>PRK06647 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK09111 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14962 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK08451 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK07940 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>TIGR02928 orc1/cdc6 family replication initiation protein	Back alignment and domain information

>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication	Back alignment and domain information

>TIGR02902 spore_lonB ATP-dependent protease LonB	Back alignment and domain information

>PRK13342 recombination factor protein RarA; Reviewed	Back alignment and domain information

>PRK14948 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14954 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN	Back alignment and domain information

>PRK00411 cdc6 cell division control protein 6; Reviewed	Back alignment and domain information

>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit	Back alignment and domain information

>TIGR01650 PD_CobS cobaltochelatase, CobS subunit	Back alignment and domain information

>PRK14955 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK00440 rfc replication factor C small subunit; Reviewed	Back alignment and domain information

>PRK00149 dnaA chromosomal replication initiation protein; Reviewed	Back alignment and domain information

>PRK06620 hypothetical protein; Validated	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>PRK14960 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14949 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional	Back alignment and domain information

>PRK07994 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function	Back alignment and domain information

>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional	Back alignment and domain information

>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>PLN03025 replication factor C subunit; Provisional	Back alignment and domain information

>PRK06645 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>TIGR00362 DnaA chromosomal replication initiator protein DnaA	Back alignment and domain information

>PHA02544 44 clamp loader, small subunit; Provisional	Back alignment and domain information

>PRK14961 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PTZ00112 origin recognition complex 1 protein; Provisional	Back alignment and domain information

>PRK14950 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair]	Back alignment and domain information

>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>PRK14971 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>PRK14088 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK13407 bchI magnesium chelatase subunit I; Provisional	Back alignment and domain information

>PRK14958 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>PRK14086 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK14964 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK08691 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14963 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK12402 replication factor C small subunit 2; Reviewed	Back alignment and domain information

>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN	Back alignment and domain information

>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>PRK14959 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK08084 DNA replication initiation factor; Provisional	Back alignment and domain information

>TIGR00678 holB DNA polymerase III, delta' subunit	Back alignment and domain information

>PRK07764 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PHA02244 ATPase-like protein	Back alignment and domain information

>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication	Back alignment and domain information

>PRK14957 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>PRK08903 DnaA regulatory inactivator Hda; Validated	Back alignment and domain information

>PRK14952 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK12422 chromosomal replication initiation protein; Provisional	Back alignment and domain information

>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX)	Back alignment and domain information

>PRK05896 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14951 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK09087 hypothetical protein; Validated	Back alignment and domain information

>PRK09112 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair]	Back alignment and domain information

>PRK14969 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed	Back alignment and domain information

>COG0714 MoxR-like ATPases [General function prediction only]	Back alignment and domain information

>PRK05563 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK07133 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>CHL00081 chlI Mg-protoporyphyrin IX chelatase	Back alignment and domain information

>smart00382 AAA ATPases associated with a variety of cellular activities	Back alignment and domain information

>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional	Back alignment and domain information

>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau	Back alignment and domain information

>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I	Back alignment and domain information

>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14953 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK05642 DNA replication initiation factor; Validated	Back alignment and domain information

>PRK07471 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK14970 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK05564 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR00764 lon_rel lon-related putative ATP-dependent protease	Back alignment and domain information

>PRK06647 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14965 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR01650 PD_CobS cobaltochelatase, CobS subunit	Back alignment and domain information

>PRK06305 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PHA02244 ATPase-like protein	Back alignment and domain information

>PRK14087 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only]	Back alignment and domain information

>TIGR02442 Cob-chelat-sub cobaltochelatase subunit	Back alignment and domain information

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily	Back alignment and domain information

>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only]	Back alignment and domain information

>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins	Back alignment and domain information

>TIGR02903 spore_lon_C ATP-dependent protease, Lon family	Back alignment and domain information

>PRK00440 rfc replication factor C small subunit; Reviewed	Back alignment and domain information

>PRK14948 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK09111 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK08451 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>PRK07399 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK14954 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>smart00382 AAA ATPases associated with a variety of cellular activities	Back alignment and domain information

>PRK06620 hypothetical protein; Validated	Back alignment and domain information

>PRK13407 bchI magnesium chelatase subunit I; Provisional	Back alignment and domain information

>PRK04132 replication factor C small subunit; Provisional	Back alignment and domain information

>PRK14955 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK05707 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair]	Back alignment and domain information

>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only]	Back alignment and domain information

>PRK14950 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK09087 hypothetical protein; Validated	Back alignment and domain information

>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX	Back alignment and domain information

>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR00368 Mg chelatase-related protein	Back alignment and domain information

>smart00763 AAA_PrkA PrkA AAA domain	Back alignment and domain information

>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK08058 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK13531 regulatory ATPase RavA; Provisional	Back alignment and domain information

>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair]	Back alignment and domain information

>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>PRK09112 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair]	Back alignment and domain information

>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only]	Back alignment and domain information

>smart00350 MCM minichromosome maintenance proteins	Back alignment and domain information

>COG0714 MoxR-like ATPases [General function prediction only]	Back alignment and domain information

>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins	Back alignment and domain information

>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional	Back alignment and domain information

>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model	Back alignment and domain information

>CHL00081 chlI Mg-protoporyphyrin IX chelatase	Back alignment and domain information

>PRK08116 hypothetical protein; Validated	Back alignment and domain information

>PRK14971 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I	Back alignment and domain information

>PRK06964 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>TIGR00678 holB DNA polymerase III, delta' subunit	Back alignment and domain information

>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair]	Back alignment and domain information

>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D	Back alignment and domain information

>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional	Back alignment and domain information

>TIGR00602 rad24 checkpoint protein rad24	Back alignment and domain information

>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF	Back alignment and domain information

>PRK05564 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A	Back alignment and domain information

>PRK07471 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR01817 nifA Nif-specific regulatory protein	Back alignment and domain information

>TIGR00602 rad24 checkpoint protein rad24	Back alignment and domain information

>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model	Back alignment and domain information

>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only]	Back alignment and domain information

>PRK13531 regulatory ATPase RavA; Provisional	Back alignment and domain information

>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR	Back alignment and domain information

>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02655 circ_KaiC circadian clock protein KaiC	Back alignment and domain information

>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair]	Back alignment and domain information

>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX	Back alignment and domain information

>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription]	Back alignment and domain information

>PRK09862 putative ATP-dependent protease; Provisional	Back alignment and domain information

>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional	Back alignment and domain information

>PRK06871 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription]	Back alignment and domain information

>PRK05707 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins	Back alignment and domain information

>TIGR02442 Cob-chelat-sub cobaltochelatase subunit	Back alignment and domain information

>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional	Back alignment and domain information

>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional	Back alignment and domain information

>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional	Back alignment and domain information

>PRK08769 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily	Back alignment and domain information

>PRK07993 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK13765 ATP-dependent protease Lon; Provisional	Back alignment and domain information

>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional	Back alignment and domain information

>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor	Back alignment and domain information

>PRK04132 replication factor C small subunit; Provisional	Back alignment and domain information

>PRK07399 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms]	Back alignment and domain information

>PRK08116 hypothetical protein; Validated	Back alignment and domain information

>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism]	Back alignment and domain information

>PRK06090 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK08181 transposase; Validated	Back alignment and domain information

>PRK13409 putative ATPase RIL; Provisional	Back alignment and domain information

>PRK08058 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK08181 transposase; Validated	Back alignment and domain information

>PRK08699 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor	Back alignment and domain information

>PRK13549 xylose transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PF13173 AAA_14: AAA domain	Back alignment and domain information

>PRK10636 putative ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK09183 transposase/IS protein; Provisional	Back alignment and domain information

>PRK07952 DNA replication protein DnaC; Validated	Back alignment and domain information

>PRK11147 ABC transporter ATPase component; Reviewed	Back alignment and domain information

>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional	Back alignment and domain information

>PRK06526 transposase; Provisional	Back alignment and domain information

>PF03215 Rad17: Rad17 cell cycle checkpoint protein	Back alignment and domain information

>PF13173 AAA_14: AAA domain	Back alignment and domain information

>PRK06526 transposase; Provisional	Back alignment and domain information

>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only]	Back alignment and domain information

>PRK09183 transposase/IS protein; Provisional	Back alignment and domain information

>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK10762 D-ribose transporter ATP binding protein; Provisional	Back alignment and domain information

>PRK08939 primosomal protein DnaI; Reviewed	Back alignment and domain information

>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional	Back alignment and domain information

>PRK12377 putative replication protein; Provisional	Back alignment and domain information

>PRK09700 D-allose transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK09302 circadian clock protein KaiC; Reviewed	Back alignment and domain information

>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2	Back alignment and domain information

>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif	Back alignment and domain information

>TIGR00368 Mg chelatase-related protein	Back alignment and domain information

>PRK06835 DNA replication protein DnaC; Validated	Back alignment and domain information

>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>smart00350 MCM minichromosome maintenance proteins	Back alignment and domain information

>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional	Back alignment and domain information

>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]	Back alignment and domain information

>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B	Back alignment and domain information

>PRK15064 ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional	Back alignment and domain information

>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B	Back alignment and domain information

>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF	Back alignment and domain information

>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional	Back alignment and domain information

>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]	Back alignment and domain information

>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A	Back alignment and domain information

>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP	Back alignment and domain information

>PRK06921 hypothetical protein; Provisional	Back alignment and domain information

>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D	Back alignment and domain information

>PRK06964 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional	Back alignment and domain information

>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK06871 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP	Back alignment and domain information

>PRK06921 hypothetical protein; Provisional	Back alignment and domain information

>PRK12377 putative replication protein; Provisional	Back alignment and domain information

>PTZ00111 DNA replication licensing factor MCM4; Provisional	Back alignment and domain information

>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional	Back alignment and domain information

>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>PRK06835 DNA replication protein DnaC; Validated	Back alignment and domain information

>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR	Back alignment and domain information

>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional	Back alignment and domain information

>KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair]	Back alignment and domain information

>PLN03073 ABC transporter F family; Provisional	Back alignment and domain information

>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism]	Back alignment and domain information

>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif	Back alignment and domain information

>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism]	Back alignment and domain information

>PRK07952 DNA replication protein DnaC; Validated	Back alignment and domain information

>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator	Back alignment and domain information

>TIGR01817 nifA Nif-specific regulatory protein	Back alignment and domain information

>PRK07993 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>cd01120 RecA-like_NTPases RecA-like NTPases	Back alignment and domain information

>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms]	Back alignment and domain information

>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A	Back alignment and domain information

>PF05729 NACHT: NACHT domain	Back alignment and domain information

>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H	Back alignment and domain information

>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional	Back alignment and domain information

>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional	Back alignment and domain information

>PRK08699 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF03215 Rad17: Rad17 cell cycle checkpoint protein	Back alignment and domain information

>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism]	Back alignment and domain information

>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H	Back alignment and domain information

>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>PRK06090 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK10923 glnG nitrogen regulation protein NR(I); Provisional	Back alignment and domain information

>PRK08769 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos)	Back alignment and domain information

>PRK09862 putative ATP-dependent protease; Provisional	Back alignment and domain information

>TIGR02237 recomb_radB DNA repair and recombination protein RadB	Back alignment and domain information

>PRK08939 primosomal protein DnaI; Reviewed	Back alignment and domain information

>PRK15115 response regulator GlrR; Provisional	Back alignment and domain information

>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>smart00763 AAA_PrkA PrkA AAA domain	Back alignment and domain information

>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>TIGR01818 ntrC nitrogen regulation protein NR(I)	Back alignment and domain information

>PRK10365 transcriptional regulatory protein ZraR; Provisional	Back alignment and domain information

>PF09336 Vps4_C: Vps4 C terminal oligomerisation domain; InterPro: IPR015415 This domain is found at the C-terminal of ATPase proteins involved in vacuolar sorting	Back alignment and domain information

>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism]	Back alignment and domain information

>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids	Back alignment and domain information

>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism]	Back alignment and domain information

>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A	Back alignment and domain information

>cd01120 RecA-like_NTPases RecA-like NTPases	Back alignment and domain information

>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>PF05729 NACHT: NACHT domain	Back alignment and domain information

>KOG1968 consensus Replication factor C, subunit RFC1 (large subunit) [Replication, recombination and repair]	Back alignment and domain information

>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK05917 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5)	Back alignment and domain information

>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional	Back alignment and domain information

>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A	Back alignment and domain information

>PRK06851 hypothetical protein; Provisional	Back alignment and domain information

>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]	Back alignment and domain information

>PRK13406 bchD magnesium chelatase subunit D; Provisional	Back alignment and domain information

>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea	Back alignment and domain information

>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair]	Back alignment and domain information

>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning]	Back alignment and domain information

>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair]	Back alignment and domain information

>TIGR02012 tigrfam_recA protein RecA	Back alignment and domain information

>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth	Back alignment and domain information

>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export	Back alignment and domain information

>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02012 tigrfam_recA protein RecA	Back alignment and domain information

Homologous Structure Templates