Citrus Sinensis ID: 005023

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------72

MGRRSFCGGTKTRRTHFLINTCHWCHVMEVESFEDEGVAKLLNDWFVSIKVDREERPDVDKVYMTYVQALYGGGGWPLSVFLSPDLKPLMGGTYFPPEDKYGRPGFKTILRKVKDAWDKKRDMLAQSGAFAIEQLSEALSASASSNKLPDELPQNALRLCAEQLSKSYDSRFGGFGSAPKFPRPVEIQMMLYHSKKLEDTGKSGEASEGQKMVLFTLQCMAKGGIHDHVGGGFHRYSVDERWHVPHFEKMLYDQGQLANVYLDAFSLTKDVFYSYICRDILDYLRRDMIGPGGEIFSAEDADSAETEGATRKKEGAFYVWTSKEVEDILGEHAILFKEHYYLKPTGNCDLSRMSDPHNEFKGKNVLIELNDSSASASKLGMPLEKYLNILGECRRKLFDVRSKRPRPHLDDKVIVSWNGLVISSFARASKILKSEAESAMFNFPVVGSDRKEYMEVAESAASFIRRHLYDEQTHRLQHSFRNGPSKAPGFLDDYAFLISGLLDLYEFGSGTKWLVWAIELQNTQDELFLDREGGGYFNTTGEDPSVLLRVKEDHDGAEPSGNSVSVINLVRLASIVAGSKSDYYRQNAEHSLAVFETRLKDMAMAVPLMCCAADMLSVPSRKHVVLVGHKSSVDFENMLAAAHASYDLNKTVIHIDPADTEEMDFWEEHNSNNASMARNNFSADKVVALVCQNFSCSPPVTDPISLENLLLEKPSSTA

ccHHHHHHHHHccccEEEEccccHHHHHHHcccccHHHHHHHHcccEEEEEcccccccHHHHHHHHHHHHccccccccEEEEccccccEEEEEccccccccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHccccccccccEEEEEccccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccEEEEcHHHHHHHHcHHHHHHHHHHccccccccccccccccccccccccEEEcccccHHHHHHccccHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHccccccccEEEEEccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccccEEEEcccccccccccccccccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEcccccHHHHHHHHHHHHcccccEEEEEEccccccHHHHHHHccccccccccccccccccEEEEccccccccccccHHHHHHHHHccccccc

ccHHHHHHHHHccccEEEEEcccHHHHEcccccccHHHHHHHHHccEEEEEcccccccHHHHHHHHHHHHcccccccEEEEEccccccEEEEcccccccccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHccHHccccccccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHccccccccccccEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccEEEccccccccccccccccccEEEEEcHHHHHHHHccHHHHHHHHccccccccEccccccccccccccccEcEccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHccccccccHHHHHHHHHHHHHHHHHHccccccccEEEEccccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccccEEEcccccccEEEEccccccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHccccHHHHccccccccEEEEEEEccccccccccHHHHHHHHHccccccc

mgrrsfcggtktrrTHFLINTCHWCHVMEVESFEDEGVAKLLNDWFVSIkvdreerpdvdkVYMTYVQALyggggwplsvflspdlkplmggtyfppedkygrpgfKTILRKVKDAWDKKRDMLAQSGAFAIEQLSEALSasassnklpdelpQNALRLCAEQLSKSydsrfggfgsapkfprpvEIQMMLYHSKkledtgksgeasegQKMVLFTLQCMakggihdhvgggfhrysvderwhvphfekmlYDQGQLANVYLDAFSLTKDVFYSYICRDILDYLRrdmigpggeifsaedadsaetegatrkkegaFYVWTSKEVEDILGEHAILFKEhyylkptgncdlsrmsdphnefkgknVLIELndssasasklgmPLEKYLNILGECRRKLfdvrskrprphlddkvivSWNGLVISSFARASKILKSEAesamfnfpvvgsdrkEYMEVAESAASFIRRHLYDEQTHRLqhsfrngpskapgfldDYAFLISGLLDLYEFGSGTKWLVWAIELQNTQDelfldregggyfnttgedpsvllrvkedhdgaepsgnsvSVINLVRLASIvagsksdyyrqNAEHSLAVFETRLKDMAMAVPLMCCAAdmlsvpsrkHVVLVGHKSSVDFENMLAAAHAsydlnktvihidpadteemdfweehnsnnasmarnnfSADKVVALVCQnfscsppvtdpislenlllekpssta

mgrrsfcggtktrrthflINTCHWCHVMEVESFEDEGVAKLLNDWFVSikvdreerpdvdkVYMTYVQALYGGGGWPLSVFLSPDLKPLMGGtyfppedkygrpgFKTILRKVKDAWDKKRDMLAQSGAFAIEQLSEALSASASSNKLPDELPQNALRLCAEQLSKSYDSRFGGFGSAPKFPRPVEIQMMLYHSKKLEDTGKSGEASEGQKMVLFTLQCMAKGGIHDHVGGGFHRYSVDERWHVPHFEKMLYDQGQLANVYLDAFSLTKDVFYSYICRDILDYLRRDMIGPGGeifsaedadsaetegatrkkegafyvWTSKEVEDILGEHAILFKEHYYLKPTGNCDLSRMSDPHNEFKGKNVLIELNDSSASASKLGMPLEKYLNILGECRRKLfdvrskrprphlddkvivswNGLVISSFARASKILKSEAESAMFNFPVVGSDRKEYMEVAESAASFIRRHLYDEQTHRLQHSFRNGPSKAPGFLDDYAFLISGLLDLYEFGSGTKWLVWAIELQNTQDELFLDREGGGYFNTTGEDPSVLLRVKEDHDgaepsgnsvsvinLVRLASIVAGSKSDYYRQNAEHSLAVFETRLKDMAMAVPLMCCAADMLSVPSRKHVVLVGHKSSVDFENMLAAAHASYDLNKTVIHIDPADTEEMDFWEEHNSNNASMARNNFSADKVVALVCQNFScsppvtdpislenlllekpssta

MGRRSFCGGTKTRRTHFLINTCHWCHVMEVESFEDEGVAKLLNDWFVSIKVDREERPDVDKVYMTYVQALYGGGGWPLSVFLSPDLKPLMGGTYFPPEDKYGRPGFKTILRKVKDAWDKKRDMLAQSGAFAIEQlsealsasassNKLPDELPQNALRLCAEQLSKSYDSRFGGFGSAPKFPRPVEIQMMLYHSKKLEDTGKSGEASEGQKMVLFTLQCMAKGGIHDHVGGGFHRYSVDERWHVPHFEKMLYDQGQLANVYLDAFSLTKDVFYSYICRDILDYLRRDMIGPGGEIFSAEDADSAETEGATRKKEGAFYVWTSKEVEDILGEHAILFKEHYYLKPTGNCDLSRMSDPHNEFKGKNVLIELNDSSASASKLGMPLEKYLNILGECRRKLFDVRSKRPRPHLDDKVIVSWNGLVISSFARASKILKSEAESAMFNFPVVGSDRKEYMEVAESAASFIRRHLYDEQTHRLQHSFRNGPSKAPGFLDDYAFLISGLLDLYEFGSGTKWLVWAIELQNTQDELFLDREGGGYFNTTGEDPSVLLRVKEDHDGAEPSGNSVSVINLVRLASIVAGSKSDYYRQNAEHSLAVFETRLKDMAMAVPLMCCAADMLSVPSRKHVVLVGHKSSVDFENMLAAAHASYDLNKTVIHIDPADTEEMDFWEEHNSNNASMARNNFSADKVVALVCQNFSCSPPVTDPISLENLLLEKPSSTA

******CGGTKTRRTHFLINTCHWCHVMEVESFEDEGVAKLLNDWFVSIKVDREERPDVDKVYMTYVQALYGGGGWPLSVFLSPDLKPLMGGTYFPPEDKYGRPGFKTILRKVKDAWDKKRDMLA***AF********************************************************IQMML********************MVLFTLQCMAKGGIHDHVGGGFHRYSVDERWHVPHFEKMLYDQGQLANVYLDAFSLTKDVFYSYICRDILDYLRRDMIGPGGEIF******************GAFYVWTSKEVEDILGEHAILFKEHYYLKPTGNCDL**************VLI************GMPLEKYLNILGECRRKLFDVRSKRPRPHLDDKVIVSWNGLVISSFARASKILKSEAESAMFNFPVVGSDRKEYMEVAESAASFIRRHLYDEQTHRL**********APGFLDDYAFLISGLLDLYEFGSGTKWLVWAIELQNTQDELFLDREGGGYFNTTG****VLL***************VSVINLVRLASIVAGSKSDYYRQNAEHSLAVFETRLKDMAMAVPLMCCAADMLSVPSRKHVVLVGHKSSVDFENMLAAAHASYDLNKTVIHIDPADTEEMDFW*************NFSADKVVALVCQNFSCSPPVTDPI**************

MGRRSFCGGTKTRRTHFLINTCHWCHVMEVESFEDEGVAKLLNDWFVSIKVDREERPDVDKVYMTYVQALYGGGGWPLSVFLSPDLKPLMGGTYFPPEDKYGRPGFKTILRKVKDAWDKKRDMLA***AF************************NALRLCAEQLSKSYDSRFGGFGSAPKFPRPVEIQMMLYHSKKLEDTGKSGEASEGQKMVLFTLQCMAKGGIHDHVGGGFHRYSVDERWHVPHFEKMLYDQGQLANVYLDAFSLTKDVFYSYICRDILDYLRRDMIGPGGEIFSAEDADSAETEGATRKKEGAFYVWTSKEVEDILGEHAILFKEHYYLKPTGNCDLSRMSDPHNEFKGKNVLIELNDSSASASKLGMPLEKYLNILGECRRKLFDVRSKRPRPHLDDKVIVSWNGLVISSFARASKILKSEAESAMFNFPVVGSDRKEYMEVAESAASFIRRHLYDEQTHRLQHSFRNGPSKAPGFLDDYAFLISGLLDLYEFGSGTKWLVWAIELQNTQDELFLDREGGGYFNTTGEDPSVLLRVKEDHDGAEPSGNSVSVINLVRLASIVAGSKSDYYRQNAEHSLAVFETRLKDMAMAVPLMCCAADMLSVPSRKHVVLVGHKSSVDFENMLAAAHASYDLNKTVIHIDPADTEEMDFWEEHNSNNASMARNNFSADKVVALVCQNFSCSPPVTDPISLEN***E******

MGRRSFCGGTKTRRTHFLINTCHWCHVMEVESFEDEGVAKLLNDWFVSIKVDREERPDVDKVYMTYVQALYGGGGWPLSVFLSPDLKPLMGGTYFPPEDKYGRPGFKTILRKVKDAWDKKRDMLAQSGAFAIEQLSEA**********PDELPQNALRLCAEQLSKSYDSRFGGFGSAPKFPRPVEIQMMLYHSKKL**********EGQKMVLFTLQCMAKGGIHDHVGGGFHRYSVDERWHVPHFEKMLYDQGQLANVYLDAFSLTKDVFYSYICRDILDYLRRDMIGPGGEIFSA************RKKEGAFYVWTSKEVEDILGEHAILFKEHYYLKPTGNCDLSRMSDPHNEFKGKNVLIELNDSSASASKLGMPLEKYLNILGECRRKLFDVRSKRPRPHLDDKVIVSWNGLVISSFARASKILKSEAESAMFNFPVVGSDRKEYMEVAESAASFIRRHLYDEQTHRLQHSFRNGPSKAPGFLDDYAFLISGLLDLYEFGSGTKWLVWAIELQNTQDELFLDREGGGYFNTTGEDPSVLLRVKEDHDGAEPSGNSVSVINLVRLASIVAGSKSDYYRQNAEHSLAVFETRLKDMAMAVPLMCCAADMLSVPSRKHVVLVGHKSSVDFENMLAAAHASYDLNKTVIHIDPADTEEMDFWEEHNSNNASMARNNFSADKVVALVCQNFSCSPPVTDPISLENLLLEKPSSTA

*****FCGGTKTRRTHFLINTCHWCHVMEVESFEDEGVAKLLNDWFVSIKVDREERPDVDKVYMTYVQALYGGGGWPLSVFLSPDLKPLMGGTYFPPEDKYGRPGFKTILRKVKDAWDKKRDMLAQSGAFAIEQLSEALSASAS****PDELPQNALRLCAEQLSKSYDSRFGGFGSAPKFPRPVEIQMMLYHSKKLEDTGKSGEASEGQKMVLFTLQCMAKGGIHDHVGGGFHRYSVDERWHVPHFEKMLYDQGQLANVYLDAFSLTKDVFYSYICRDILDYLRRDMIGPGGEIFSAEDADSAETEGATRKKEGAFYVWTSKEVEDILGEHAILFKEHYYLKPTGNCDLSRMSDPHNEFKGKNVLIELNDSSASASKLGMPLEKYLNILGECRRKLFDVRSKRPRPHLDDKVIVSWNGLVISSFARASKILKSEAESAMFNFPVVGSDRKEYMEVAESAASFIRRHLYDEQTHRLQHSFRNGPSKAPGFLDDYAFLISGLLDLYEFGSGTKWLVWAIELQNTQDELFLDREGGGYFNTTGEDPSVLLRVKEDHDGAEPSGNSVSVINLVRLASIVAGSKSDYYRQNAEHSLAVFETRLKDMAMAVPLMCCAADMLSVPSRKHVVLVGHKSSVDFENMLAAAHASYDLNKTVIHIDPADTEEMDFWEEHNSNNASMARNNFSADKVVALVCQNFSCSPPVTDPISLENLLLE******

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		718	2.2.26 [Sep-21-2011]
Q8TB22		786	Spermatogenesis-associate	yes	no	0.934	0.853	0.410	1e-150
Q80YT5		790	Spermatogenesis-associate	yes	no	0.931	0.846	0.399	1e-144
Q6T393		789	Spermatogenesis-associate	yes	no	0.934	0.850	0.391	1e-141
Q09214		729	Uncharacterized protein B	yes	no	0.927	0.913	0.365	1e-120
P37512		689	Uncharacterized protein Y	yes	no	0.864	0.901	0.351	1e-110

>sp\|Q8TB22\|SPT20_HUMAN Spermatogenesis-associated protein 20 OS=Homo sapiens GN=SPATA20 PE=2 SV=3	Back alignment and function desciption

 Score =  534 bits (1375), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 302/736 (41%), Positives = 425/736 (57%), Gaps = 65/736 (8%)

Query: 2   GRRSFCGGTKTRRTHFL---INTCHWCHVMEVESFEDEGVAKLLNDWFVSIKVDREERPD 58
           G+ +F    K  +  FL    +TCHWCH+ME ESF++E + +LL++ FVS+KVDREERPD
Sbjct: 87  GQEAFDKARKENKPIFLSVGYSTCHWCHMMEEESFQNEEIGRLLSEDFVSVKVDREERPD 146

Query: 59  VDKVYMTYVQALYGGGGWPLSVFLSPDLKPLMGGTYFPPEDKYGRPGFKTILRKVKDAWD 118
           VDKVYMT+VQA   GGGWP++V+L+P+L+P +GGTYFPPED   R GF+T+L ++++ W 
Sbjct: 147 VDKVYMTFVQATSSGGGWPMNVWLTPNLQPFVGGTYFPPEDGLTRVGFRTVLLRIREQWK 206

Query: 119 KKRDMLAQSGAFAIEQLSEALSASASSNKLPDELPQNALRL---CAEQLSKSYDSRFGGF 175
           + ++ L ++     ++++ AL A +  +    +LP +A  +   C +QL + YD  +GGF
Sbjct: 207 QNKNTLLENS----QRVTTALLARSEISVGDRQLPPSAATVNNRCFQQLDEGYDEEYGGF 262

Query: 176 GSAPKFPRPVEIQMML--YHSKKLEDTGKSGEASEGQKMVLFTLQCMAKGGIHDHVGGGF 233
             APKFP PV +  +   + S +L   G     S  Q+M L TL+ MA GGI DHVG GF
Sbjct: 263 AEAPKFPTPVILSFLFSYWLSHRLTQDG-----SRAQQMALHTLKMMANGGIRDHVGQGF 317

Query: 234 HRYSVDERWHVPHFEKMLYDQGQLANVYLDAFSLTKDVFYSYICRDILDYLRRDMIGPGG 293
           HRYS D +WHVPHFEKMLYDQ QLA  Y  AF L+ D FYS + + IL Y+ R +    G
Sbjct: 318 HRYSTDRQWHVPHFEKMLYDQAQLAVAYSQAFQLSGDEFYSDVAKGILQYVARSLSHRSG 377

Query: 294 EIFSAEDADSAETEGATRKKEGAFYVWTSKEVEDILGEHAI----------LFKEHYYLK 343
             +SAEDADS    G  R KEGA+YVWT KEV+ +L E  +          L  +HY L 
Sbjct: 378 GFYSAEDADSPPERG-QRPKEGAYYVWTVKEVQQLLPEPVLGATEPLTSGQLLMKHYGLT 436

Query: 344 PTGNCDLSRMSDPHNEFKGKNVLIELNDSSASASKLGMPLEKYLNILGECRRKLFDVRSK 403
             GN  +S   DP  E +G+NVL        +A++ G+ +E    +L     KLF  R  
Sbjct: 437 EAGN--ISPSQDPKGELQGQNVLTVRYSLELTAARFGLDVEAVRTLLNSGLEKLFQARKH 494

Query: 404 RPRPHLDDKVIVSWNGLVISSFARASKILKSEAESAMFNFPVVGSDRKEYMEVAESAASF 463
           RP+PHLD K++ +WNGL++S +A    +L              G DR   +  A + A F
Sbjct: 495 RPKPHLDSKMLAAWNGLMVSGYAVTGAVL--------------GQDR--LINYATNGAKF 538

Query: 464 IRRHLYDEQTHRLQHSFRNGP------SKAP--GFLDDYAFLISGLLDLYEFGSGTKWLV 515
           ++RH++D  + RL  +   GP      S  P  GFL+DYAF++ GLLDLYE    + WL 
Sbjct: 539 LKRHMFDVASGRLMRTCYTGPGGTVEHSNPPCWGFLEDYAFVVRGLLDLYEASQESAWLE 598

Query: 516 WAIELQNTQDELFLDREGGGYFNTTGEDPSVL-LRVKEDHDGAEPSGNSVSVINLVRLAS 574
           WA+ LQ+TQD+LF D +GGGYF +  E  + L LR+K+D DGAEPS NSVS  NL+RL  
Sbjct: 599 WALRLQDTQDKLFWDSQGGGYFCSEAELGAGLPLRLKDDQDGAEPSANSVSAHNLLRLHG 658

Query: 575 IVAGSKSDYYRQNAEHSLAVFETRLKDMAMAVPLMCCAADMLSVPSRKHVVLVGHKSSVD 634
              G K   +       L  F  R++ + +A+P M  A       + K +V+ G + + D
Sbjct: 659 FT-GHKD--WMDKCVCLLTAFSERMRRVPVALPEMVRALSA-QQQTLKQIVICGDRQAKD 714

Query: 635 FENMLAAAHASYDLNKTVIHIDPADTEEMDFWEEHNSNNASMARNNFSADKVVALVCQNF 694
            + ++   H+ Y  NK +I    AD +   F        +++ R     D+  A VC+N 
Sbjct: 715 TKALVQCVHSVYIPNKVLIL---ADGDPSSFLSRQLPFLSTLRRLE---DQATAYVCENQ 768

Query: 695 SCSPPVTDPISLENLL 710
           +CS P+TDP  L  LL
Sbjct: 769 ACSVPITDPCELRKLL 784

May play a role in fertility regulation.
Homo sapiens (taxid: 9606)

>sp\|Q80YT5\|SPT20_MOUSE Spermatogenesis-associated protein 20 OS=Mus musculus GN=Spata20 PE=2 SV=1	Back alignment and function description

>sp\|Q6T393\|SPT20_RAT Spermatogenesis-associated protein 20 OS=Rattus norvegicus GN=Spata20 PE=1 SV=1	Back alignment and function description

>sp\|Q09214\|YP65_CAEEL Uncharacterized protein B0495.5 OS=Caenorhabditis elegans GN=B0495.5 PE=4 SV=2	Back alignment and function description

>sp\|P37512\|YYAL_BACSU Uncharacterized protein YyaL OS=Bacillus subtilis (strain 168) GN=yyaL PE=4 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		718
359479833		819	PREDICTED: spermatogenesis-associated pr	0.972	0.852	0.833	0.0
296086616		754	unnamed protein product [Vitis vinifera]	0.972	0.925	0.833	0.0
255559290		874	conserved hypothetical protein [Ricinus	0.972	0.798	0.828	0.0
449436537		855	PREDICTED: spermatogenesis-associated pr	0.994	0.835	0.782	0.0
449498445		855	PREDICTED: LOW QUALITY PROTEIN: spermato	0.994	0.835	0.776	0.0
356570951		755	PREDICTED: spermatogenesis-associated pr	0.958	0.911	0.802	0.0
115432144		839	cold-induced thioredoxin domain-containi	0.987	0.845	0.796	0.0
356505532		809	PREDICTED: spermatogenesis-associated pr	0.972	0.862	0.802	0.0
224132400		756	predicted protein [Populus trichocarpa]	0.951	0.903	0.830	0.0
357511183		809	Spermatogenesis-associated protein [Medi	0.970	0.861	0.792	0.0

>gi\|359479833\|ref\|XP_002267103.2\| PREDICTED: spermatogenesis-associated protein 20-like [Vitis vinifera]	Back alignment and taxonomy information

 Score = 1225 bits (3169), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 582/698 (83%), Positives = 633/698 (90%)

Query: 20  NTCHWCHVMEVESFEDEGVAKLLNDWFVSIKVDREERPDVDKVYMTYVQALYGGGGWPLS 79
           +TCHWCHVMEVESFE+EGVAKLLNDWFVSIKVDREERPDVDKVYMTYVQALYGGGGWPLS
Sbjct: 122 STCHWCHVMEVESFENEGVAKLLNDWFVSIKVDREERPDVDKVYMTYVQALYGGGGWPLS 181

Query: 80  VFLSPDLKPLMGGTYFPPEDKYGRPGFKTILRKVKDAWDKKRDMLAQSGAFAIEQLSEAL 139
           VFLSPDLKPLMGGTYFPP+DKYGRPGFKT+LRKVKDAW+ KRD+L +SGAFAIEQLSEAL
Sbjct: 182 VFLSPDLKPLMGGTYFPPDDKYGRPGFKTVLRKVKDAWENKRDVLVKSGAFAIEQLSEAL 241

Query: 140 SASASSNKLPDELPQNALRLCAEQLSKSYDSRFGGFGSAPKFPRPVEIQMMLYHSKKLED 199
           SA+ASSNKL D +PQ AL LCAEQL+ +YD  +GGFGSAPKFPRPVEIQ+MLYH KKLE+
Sbjct: 242 SATASSNKLADGIPQQALHLCAEQLAGNYDPEYGGFGSAPKFPRPVEIQLMLYHYKKLEE 301

Query: 200 TGKSGEASEGQKMVLFTLQCMAKGGIHDHVGGGFHRYSVDERWHVPHFEKMLYDQGQLAN 259
           +GKSGEA+E  KMV F+LQCMA+GG+HDH+GGGFHRYSVDE WHVPHFEKMLYDQGQLAN
Sbjct: 302 SGKSGEANEVLKMVAFSLQCMARGGVHDHIGGGFHRYSVDECWHVPHFEKMLYDQGQLAN 361

Query: 260 VYLDAFSLTKDVFYSYICRDILDYLRRDMIGPGGEIFSAEDADSAETEGATRKKEGAFYV 319
            YLD FS+TKDVFYS + RDILDYLRRDMIGP GEIFSAEDADSAE+E A RKKEGAFY+
Sbjct: 362 AYLDVFSITKDVFYSCVSRDILDYLRRDMIGPEGEIFSAEDADSAESEDAARKKEGAFYI 421

Query: 320 WTSKEVEDILGEHAILFKEHYYLKPTGNCDLSRMSDPHNEFKGKNVLIELNDSSASASKL 379
           WTSKEVED++GEHA LFK+HYY+KP+GNCDLSRMSDPHNEFKGKNVLIE N +SA ASKL
Sbjct: 422 WTSKEVEDVIGEHASLFKDHYYIKPSGNCDLSRMSDPHNEFKGKNVLIERNCASAMASKL 481

Query: 380 GMPLEKYLNILGECRRKLFDVRSKRPRPHLDDKVIVSWNGLVISSFARASKILKSEAESA 439
           GMP+EKYL+ILG CRRKLFDVR  RPRPHLDDKVIVSWNGL ISSFARASKILKSEAE  
Sbjct: 482 GMPVEKYLDILGTCRRKLFDVRLNRPRPHLDDKVIVSWNGLAISSFARASKILKSEAEGT 541

Query: 440 MFNFPVVGSDRKEYMEVAESAASFIRRHLYDEQTHRLQHSFRNGPSKAPGFLDDYAFLIS 499
            F FPVVG D KEYMEVAE AASFIR+ LYDEQT RL+HSFRNGPSKAPGFLDDYAFLIS
Sbjct: 542 KFRFPVVGCDPKEYMEVAEKAASFIRKWLYDEQTRRLRHSFRNGPSKAPGFLDDYAFLIS 601

Query: 500 GLLDLYEFGSGTKWLVWAIELQNTQDELFLDREGGGYFNTTGEDPSVLLRVKEDHDGAEP 559
           GLLD+YEFG  T WLVWAIELQ+TQDELFLD+EGGGYFNT GEDPSVLLRVKEDHDGAEP
Sbjct: 602 GLLDIYEFGGNTNWLVWAIELQDTQDELFLDKEGGGYFNTPGEDPSVLLRVKEDHDGAEP 661

Query: 560 SGNSVSVINLVRLASIVAGSKSDYYRQNAEHSLAVFETRLKDMAMAVPLMCCAADMLSVP 619
           SGNSVSVINLVRL S+VAGS  + +R+NAEH LAVFETRLKDMAMAVPLMCC ADM SVP
Sbjct: 662 SGNSVSVINLVRLTSMVAGSWFERHRRNAEHLLAVFETRLKDMAMAVPLMCCGADMFSVP 721

Query: 620 SRKHVVLVGHKSSVDFENMLAAAHASYDLNKTVIHIDPADTEEMDFWEEHNSNNASMARN 679
           SRK VVLVGHKSSV+FE+MLAAAHA YD N+TVIHIDP +TE+M+FWE  NSN A MA+N
Sbjct: 722 SRKQVVLVGHKSSVEFEDMLAAAHAQYDPNRTVIHIDPTETEQMEFWEAMNSNIALMAKN 781

Query: 680 NFSADKVVALVCQNFSCSPPVTDPISLENLLLEKPSST 717
           NF+ DKVVALVCQNF+CS PVTD  SL+ LL  KPSS 
Sbjct: 782 NFAPDKVVALVCQNFTCSSPVTDSTSLKALLCLKPSSA 819

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|296086616\|emb\|CBI32251.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255559290\|ref\|XP_002520665.1\| conserved hypothetical protein [Ricinus communis] gi\|223540050\|gb\|EEF41627.1\| conserved hypothetical protein [Ricinus communis]	Back alignment and taxonomy information

>gi\|449436537\|ref\|XP_004136049.1\| PREDICTED: spermatogenesis-associated protein 20-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449498445\|ref\|XP_004160539.1\| PREDICTED: LOW QUALITY PROTEIN: spermatogenesis-associated protein 20-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|356570951\|ref\|XP_003553646.1\| PREDICTED: spermatogenesis-associated protein 20-like [Glycine max]	Back alignment and taxonomy information

>gi\|115432144\|gb\|ABI97349.1\| cold-induced thioredoxin domain-containing protein [Ammopiptanthus mongolicus]	Back alignment and taxonomy information

>gi\|356505532\|ref\|XP_003521544.1\| PREDICTED: spermatogenesis-associated protein 20-like [Glycine max]	Back alignment and taxonomy information

>gi\|224132400\|ref\|XP_002321330.1\| predicted protein [Populus trichocarpa] gi\|222862103\|gb\|EEE99645.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|357511183\|ref\|XP_003625880.1\| Spermatogenesis-associated protein [Medicago truncatula] gi\|355500895\|gb\|AES82098.1\| Spermatogenesis-associated protein [Medicago truncatula]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		718
TAIR\|locus:2125541		818	AT4G03200 [Arabidopsis thalian	0.962	0.844	0.740	3.6e-286
ZFIN\|ZDB-GENE-030131-7269		818	spata20 "spermatogenesis assoc	0.920	0.808	0.424	6.1e-142
UNIPROTKB\|F1NIQ1		685	SPATA20 "Uncharacterized prote	0.867	0.909	0.438	1.3e-137
UNIPROTKB\|Q8TB22		786	SPATA20 "Spermatogenesis-assoc	0.938	0.857	0.407	4.6e-137
UNIPROTKB\|A4FV36		789	SPATA20 "Uncharacterized prote	0.948	0.863	0.410	6.7e-136
UNIPROTKB\|F1RT97		789	LOC100738512 "Uncharacterized	0.948	0.863	0.407	3.7e-135
UNIPROTKB\|I3LGI2		773	LOC100738512 "Uncharacterized	0.948	0.880	0.407	3.7e-135
UNIPROTKB\|E2QU41		789	SPATA20 "Uncharacterized prote	0.938	0.854	0.398	1.6e-134
UNIPROTKB\|F1PTK3		789	MYCBPAP "Uncharacterized prote	0.938	0.854	0.398	1.6e-134
UNIPROTKB\|F6UYN9		821	MYCBPAP "Uncharacterized prote	0.938	0.820	0.398	1.6e-134

TAIR\|locus:2125541 AT4G03200 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 2749 (972.8 bits), Expect = 3.6e-286, P = 3.6e-286
 Identities = 512/691 (74%), Positives = 587/691 (84%)

Query:    20 NTCHWCHVMEVESFEDEGVAKLLNDWFVSIKVDREERPDVDKVYMTYVQALYGGGGWPLS 79
             +TCHWCHVMEVESFEDE VAKLLN+ FVSIKVDREERPDVDKVYM++VQALYGGGGWPLS
Sbjct:   126 STCHWCHVMEVESFEDEEVAKLLNNSFVSIKVDREERPDVDKVYMSFVQALYGGGGWPLS 185

Query:    80 VFLSPDLKPLMGGTYFPPEDKYGRPGFKTILRKVKDAWDKKRDMLAQSGAFAIEQXXXXX 139
             VFLSPDLKPLMGGTYFPP D YGRPGFKT+L+KVKDAW+ KRD L +SG +AIE+     
Sbjct:   186 VFLSPDLKPLMGGTYFPPNDNYGRPGFKTLLKKVKDAWNSKRDTLVKSGTYAIEELSKAL 245

Query:   140 XXXXXXNKLPDELPQNALRLCAEQLSKSYDSRFGGFGSAPKFPRPVEIQMMLYHSKKLED 199
                   +KL D + + A+  CA+QLS+SYDS FGGFGSAPKFPRPVEIQ+MLYH KKL++
Sbjct:   246 SASTGADKLSDGISREAVSTCAKQLSRSYDSEFGGFGSAPKFPRPVEIQLMLYHYKKLKE 305

Query:   200 TGKSGEASEGQKMVLFTLQCMAKGGIHDHVGGGFHRYSVDERWHVPHFEKMLYDQGQLAN 259
             +GK+ EA E + MVLF+LQ MA GG+HDH+GGGFHRYSVDE WHVPHFEKMLYDQGQLAN
Sbjct:   306 SGKTSEADEEKSMVLFSLQGMANGGMHDHIGGGFHRYSVDECWHVPHFEKMLYDQGQLAN 365

Query:   260 VYLDAFSLTKDVFYSYICRDILDYLRRDMIGPGGEIFSAEDADSAETEGATRKKEGAFYV 319
             VYLD FS+TKDV YSY+ RDILDYLRRDMI P G IFSAEDADS E EGA RKKEGAFY+
Sbjct:   366 VYLDGFSITKDVMYSYVARDILDYLRRDMIAPEGGIFSAEDADSFEFEGAKRKKEGAFYI 425

Query:   320 WTSKEVEDILGEHAILFKEHYYLKPTGNCDLSRMSDPHNEFKGKNVLIELNDSSASASKL 379
             WTS E++++LGE+A LFKEHYY+K +GNCDLS  SDPHNEF GKNVLIE N++SA ASK 
Sbjct:   426 WTSDEIDEVLGENADLFKEHYYVKKSGNCDLSSRSDPHNEFAGKNVLIERNETSAMASKF 485

Query:   380 GMPLEKYLNILGECRRKLFDVRSKRPRPHLDDKVIVSWNGLVISSFARASKILKSEAESA 439
              + +EKY  ILGECRRKLFDVR KRP+PHLDDK+IVSWNGLVISSFARASKILK+E ES 
Sbjct:   486 SLSVEKYQEILGECRRKLFDVRLKRPKPHLDDKIIVSWNGLVISSFARASKILKAEPEST 545

Query:   440 MFNFPVVGSDRKEYMEVAESAASFIRRHLYDEQTHRLQHSFRNGPSKAPGFLDDYAFLIS 499
              + FPVV S  ++Y+EVAE AA FIR +LYDEQ+ RLQHS+R GPSKAP FLDDYAFLIS
Sbjct:   546 KYYFPVVNSQPEDYIEVAEKAALFIRGNLYDEQSRRLQHSYRQGPSKAPAFLDDYAFLIS 605

Query:   500 GLLDLYEFGSGTKWLVWAIELQNTQDELFLDREGGGYFNTTGEDPSVLLRVKEDHDGAEP 559
             GLLDLYE G G +WL WAI+LQ TQDEL+LDREGG YFNT G+DPSVLLRVKEDHDGAEP
Sbjct:   606 GLLDLYENGGGIEWLKWAIKLQETQDELYLDREGGAYFNTEGQDPSVLLRVKEDHDGAEP 665

Query:   560 SGNSVSVINLVRLASIVAGSKSDYYRQNAEHSLAVFETRLKDMAMAVPLMCCAADMLSVP 619
             SGNSVS INLVRLASIVAG K++ Y   A   LAVFE RL+++A+AVPLMCC+ADM+SVP
Sbjct:   666 SGNSVSAINLVRLASIVAGEKAESYLNTAHRLLAVFELRLRELAVAVPLMCCSADMISVP 725

Query:   620 SRKHVVLVGHKSSVDFENMLAAAHASYDLNKTVIHIDPADTEEMDFWEEHNSNNASMARN 679
             SRK VVLVG KSS +  NML+AAH+ YD NKTVIHIDP+ ++E++FWEEHNSN A MA+ 
Sbjct:   726 SRKQVVLVGSKSSPELTNMLSAAHSVYDPNKTVIHIDPSSSDEIEFWEEHNSNVAEMAKK 785

Query:   680 NFSADKVVALVCQNFSCSPPVTDPISLENLL 710
             N +++KVVALVCQ+F+CSPPV D  SL  LL
Sbjct:   786 NRNSEKVVALVCQHFTCSPPVFDSSSLTRLL 816

GO:0003824 "catalytic activity" evidence=IEA

GO:0005576 "extracellular region" evidence=ISM

GO:0009507 "chloroplast" evidence=IDA

ZFIN\|ZDB-GENE-030131-7269 spata20 "spermatogenesis associated 20" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NIQ1 SPATA20 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|Q8TB22 SPATA20 "Spermatogenesis-associated protein 20" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|A4FV36 SPATA20 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|F1RT97 LOC100738512 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|I3LGI2 LOC100738512 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|E2QU41 SPATA20 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|F1PTK3 MYCBPAP "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|F6UYN9 MYCBPAP "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q6T393	SPT20_RAT	No assigned EC number	0.3913	0.9345	0.8504	yes	no
P37512	YYAL_BACSU	No assigned EC number	0.3513	0.8649	0.9013	yes	no
Q8TB22	SPT20_HUMAN	No assigned EC number	0.4103	0.9345	0.8536	yes	no
Q80YT5	SPT20_MOUSE	No assigned EC number	0.3997	0.9317	0.8468	yes	no
Q09214	YP65_CAEEL	No assigned EC number	0.3658	0.9275	0.9135	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		718
COG1331		667	COG1331, COG1331, Highly conserved protein contain	0.0
pfam03190		163	pfam03190, DUF255, Protein of unknown function, DU	9e-68
cd02955		124	cd02955, SSP411, TRX domain, SSP411 protein family	2e-63
pfam13098		105	pfam13098, Thioredoxin_2, Thioredoxin-like domain	0.003

>gnl\|CDD\|224250 COG1331, COG1331, Highly conserved protein containing a thioredoxin domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

 Score =  600 bits (1548), Expect = 0.0
 Identities = 267/693 (38%), Positives = 360/693 (51%), Gaps = 80/693 (11%)

Query: 21  TCHWCHVMEVESFEDEGVAKLLNDWFVSIKVDREERPDVDKVYMTYVQALYGGGGWPLSV 80
           TCHWCHVM  ESFED  +A +LN+ FV +KVDREERPDVD +YM   QA+ G GGWPL+V
Sbjct: 54  TCHWCHVMAHESFEDPEIAAILNENFVPVKVDREERPDVDSLYMNASQAITGQGGWPLTV 113

Query: 81  FLSPDLKPLMGGTYFPPEDKYGRPGFKTILRKVKDAWDKKRDMLAQSGAFAIEQLSEALS 140
           FL+PD KP   GTYFP ED+YGRPGFK +L  +++ W + R+ L QS     E++ EAL 
Sbjct: 114 FLTPDGKPFFAGTYFPKEDRYGRPGFKQLLEAIRETWREDREELLQSA----ERVLEALE 169

Query: 141 ASASSNKLPDELPQNALRLCAEQLSKSYDSRFGGFGSAPKFPRPVEIQMMLYHSKKLEDT 200
             A  +   +EL +  L   AE L++S+D  +GGFGSAPKFP P  +  +L +S +  D 
Sbjct: 170 GLARPSA-GEELDEEVLDRAAEALARSFDREYGGFGSAPKFPPPHLLLFLLRYSLRTGD- 227

Query: 201 GKSGEASEGQKMVLFTLQCMAKGGIHDHVGGGFHRYSVDERWHVPHFEKMLYDQGQLANV 260
                      MVL TL  MA+GGI+DH+GGGF RYS D  W VPHFEKMLYD   L   
Sbjct: 228 ------ERALDMVLRTLDAMARGGIYDHLGGGFFRYSTDREWLVPHFEKMLYDNALLLRA 281

Query: 261 YLDAFSLTKDVFYSYICRDILDYLRRDMIGPGGEIFSAEDADSAETEGATRKKEGAFYVW 320
           Y +A+  T D  Y      ILDYL R++  P G  +S+ DADS + E      EG +Y W
Sbjct: 282 YAEAYRATGDDLYRRAAEGILDYLLRELYSPEGGFYSSLDADS-DGE------EGKYYTW 334

Query: 321 TSKEVEDILGEHAILFKEHYYLKPTGNCDLSRMSDPHNEFKGKNVLIELNDSSASASKLG 380
           + +E++++LGE A L  +++ +   GN            F+G+NVL        +  +  
Sbjct: 335 SVEELKEVLGEDAELACKYFDVSEEGN------------FEGRNVLHVPGPLEEAIEEAE 382

Query: 381 MPLEKYLNILGECRRKLFDVRSKRPRPHLDDKVIVSWNGLVISSFARASKILKSEAESAM 440
             LE         R KL   R KR +P  DDKV+  WNGL+I++ A A ++L        
Sbjct: 383 EKLE-------RAREKLLAAREKRKQPSRDDKVLTDWNGLMIAALAEAGRVL-------- 427

Query: 441 FNFPVVGSDRKEYMEVAESAASFIRRHLYDEQTHRLQHSFRNGPSKAPGFLDDYAFLISG 500
                      EY+E AE AA FI  +LY     RL   +R G +   G L+DYAFLI G
Sbjct: 428 --------GDPEYLEAAERAADFILDNLYV---DRLLRRYRGGEAAVAGLLEDYAFLILG 476

Query: 501 LLDLYEFGSGTKWLVWAIELQNTQDELFLDREGGGYFNTTGEDPSVLLRVKEDHDGAEPS 560
           LL LYE      +L  AIEL +     F D + GG+++T  +   +L+R KE  DGA PS
Sbjct: 477 LLALYEATGDLAYLEKAIELADEAIADFWD-DEGGFYDTPSDSEDLLIRPKEPTDGATPS 535

Query: 561 GNSVSVINLVRLASIVAGSKSDYYRQNAEHSLAVFETRLKDMAMAVPLMCCAADMLSVPS 620
           GN+V+   L+RL+ +   ++   Y + AE  L  F    +    A   +  AA+ L +  
Sbjct: 536 GNAVAAQALLRLSLLTGDAR---YLEAAEDILQAFAGLAERAPFAHAGLLLAAEFL-ISG 591

Query: 621 RKHVVLVGHKSSVDFENMLAAAHASYDLNKTVIHIDPADTEEMDFWEEHNSNNASMARNN 680
              +V+ G   S     +L AA   Y   K ++             E + S         
Sbjct: 592 PLVIVVAGDPRS----ELLRAALRLYLPEKVLVVGT----------EGYVSLLVDGMLGG 637

Query: 681 FSADKVVALVCQNFSCSPPVTDPISLENLLLEK 713
                  A VC   +C PPVT P  L  LL   
Sbjct: 638 GKT----AYVCTGDACLPPVTSPEELAELLAVL 666

Length = 667

>gnl\|CDD\|202571 pfam03190, DUF255, Protein of unknown function, DUF255	Back alignment and domain information

>gnl\|CDD\|239253 cd02955, SSP411, TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif	Back alignment and domain information

>gnl\|CDD\|221921 pfam13098, Thioredoxin_2, Thioredoxin-like domain	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		718
COG1331		667	Highly conserved protein containing a thioredoxin	100.0
KOG2244		786	consensus Highly conserved protein containing a th	100.0
PF03190		163	Thioredox_DsbH: Protein of unknown function, DUF25	100.0
cd02955		124	SSP411 TRX domain, SSP411 protein family; members	99.96
cd00249		384	AGE AGE domain; N-acyl-D-glucosamine 2-epimerase d	99.93
cd00249		384	AGE AGE domain; N-acyl-D-glucosamine 2-epimerase d	99.91
PF07221		346	GlcNAc_2-epim: N-acylglucosamine 2-epimerase (GlcN	99.73
PF07221		346	GlcNAc_2-epim: N-acylglucosamine 2-epimerase (GlcN	99.69
cd02960		130	AGR Anterior Gradient (AGR) family; members of thi	99.65
cd02958		114	UAS UAS family; UAS is a domain of unknown functio	99.65
PF13899		82	Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_	99.57
COG2942		388	N-acyl-D-glucosamine 2-epimerase [Carbohydrate tra	99.51
PF03663		370	Glyco_hydro_76: Glycosyl hydrolase family 76 ; Int	99.49
cd02951		125	SoxW SoxW family; SoxW is a bacterial periplasmic	99.4
cd02959		117	ERp19 Endoplasmic reticulum protein 19 (ERp19) fam	99.39
smart00594		122	UAS UAS domain.	99.39
COG1331		667	Highly conserved protein containing a thioredoxin	99.37
cd02953		104	DsbDgamma DsbD gamma family; DsbD gamma is the C-t	99.31
PF03663		370	Glyco_hydro_76: Glycosyl hydrolase family 76 ; Int	99.09
PRK00293		571	dipZ thiol:disulfide interchange protein precursor	99.07
PF13098		112	Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_	99.01
cd02991		116	UAS_ETEA UAS family, ETEA subfamily; composed of p	98.99
cd04791		321	LanC_SerThrkinase Lanthionine synthetase C-like do	98.97
COG2143		182	Thioredoxin-related protein [Posttranslational mod	98.8
KOG2244		786	consensus Highly conserved protein containing a th	98.75
PF07470		336	Glyco_hydro_88: Glycosyl Hydrolase Family 88; Inte	98.61
COG2942		388	N-acyl-D-glucosamine 2-epimerase [Carbohydrate tra	98.55
cd02950		142	TxlA TRX-like protein A (TxlA) family; TxlA was or	98.54
cd02949		97	TRX_NTR TRX domain, novel NADPH thioredoxin reduct	98.4
COG4232		569	Thiol:disulfide interchange protein [Posttranslati	98.4
PRK10996		139	thioredoxin 2; Provisional	98.25
cd04791		321	LanC_SerThrkinase Lanthionine synthetase C-like do	98.19
cd02954		114	DIM1 Dim1 family; Dim1 is also referred to as U5 s	98.18
PF07944		520	DUF1680: Putative glycosyl hydrolase of unknown fu	98.14
cd02956		96	ybbN ybbN protein family; ybbN is a hypothetical p	98.05
cd02984		97	TRX_PICOT TRX domain, PICOT (for PKC-interacting c	97.95
COG4225		357	Predicted unsaturated glucuronyl hydrolase involve	97.95
PLN00410		142	U5 snRNP protein, DIM1 family; Provisional	97.93
cd02986		114	DLP Dim1 family, Dim1-like protein (DLP) subfamily	97.86
TIGR01126		102	pdi_dom protein disulfide-isomerase domain. This m	97.85
TIGR01068		101	thioredoxin thioredoxin. Several proteins, such as	97.84
cd03000		104	PDI_a_TMX3 PDIa family, TMX3 subfamily; composed o	97.81
cd02948		102	TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fus	97.77
cd02997		104	PDI_a_PDIR PDIa family, PDIR subfamily; composed o	97.74
cd02961		101	PDI_a_family Protein Disulfide Isomerase (PDIa) fa	97.73
PF06662		189	C5-epim_C: D-glucuronyl C5-epimerase C-terminus; I	97.7
PF07470		336	Glyco_hydro_88: Glycosyl Hydrolase Family 88; Inte	97.68
cd02985		103	TRX_CDSP32 TRX family, chloroplastic drought-induc	97.66
cd03003		101	PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam	97.65
cd02993		109	PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfat	97.62
cd04792		825	LanM-like LanM-like proteins. LanM is a bifunction	97.62
cd02996		108	PDI_a_ERp44 PDIa family, endoplasmic reticulum pro	97.61
cd02963		111	TRX_DnaJ TRX domain, DnaJ domain containing protei	97.61
cd02947		93	TRX_family TRX family; composed of two groups: Gro	97.6
PHA02278		103	thioredoxin-like protein	97.55
TIGR01295		122	PedC_BrcD bacteriocin transport accessory protein,	97.54
cd04434		343	LanC_like LanC-like proteins. LanC is the cyclase	97.54
TIGR00411		82	redox_disulf_1 small redox-active disulfide protei	97.53
PRK09381		109	trxA thioredoxin; Provisional	97.48
TIGR00385		173	dsbE periplasmic protein thiol:disulfide oxidoredu	97.47
PF07944		520	DUF1680: Putative glycosyl hydrolase of unknown fu	97.4
cd02962		152	TMX2 TMX2 family; composed of proteins similar to	97.39
PTZ00051		98	thioredoxin; Provisional	97.39
cd03004		104	PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam	97.33
PRK15412		185	thiol:disulfide interchange protein DsbE; Provisio	97.33
cd02994		101	PDI_a_TMX PDIa family, TMX subfamily; composed of	97.31
cd02975		113	PfPDO_like_N Pyrococcus furiosus protein disulfide	97.3
cd02995		104	PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain	97.3
cd03065		120	PDI_b_Calsequestrin_N PDIb family, Calsequestrin s	97.27
PF00085		103	Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio	97.27
PF06662		189	C5-epim_C: D-glucuronyl C5-epimerase C-terminus; I	97.25
cd02998		105	PDI_a_ERp38 PDIa family, endoplasmic reticulum pro	97.24
cd03002		109	PDI_a_MPD1_like PDI family, MPD1-like subfamily; c	97.23
cd03005		102	PDI_a_ERp46 PDIa family, endoplasmic reticulum pro	97.21
cd04793		382	LanC LanC is the cyclase enzyme of the lanthionine	97.18
cd03006		113	PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamil	97.16
PTZ00443		224	Thioredoxin domain-containing protein; Provisional	97.11
cd02989		113	Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior	97.1
cd03009		131	TryX_like_TryX_NRX Tryparedoxin (TryX)-like family	97.09
KOG0910		150	consensus Thioredoxin-like protein [Posttranslatio	97.06
COG3533		589	Uncharacterized protein conserved in bacteria [Fun	97.06
PLN02266		510	endoglucanase	97.06
PHA02125		75	thioredoxin-like protein	97.06
PRK14018		521	trifunctional thioredoxin/methionine sulfoxide red	97.05
cd02999		100	PDI_a_ERp44_like PDIa family, endoplasmic reticulu	97.04
PLN02340		614	endoglucanase	97.04
cd03001		103	PDI_a_P5 PDIa family, P5 subfamily; composed of eu	97.04
COG4225		357	Predicted unsaturated glucuronyl hydrolase involve	97.01
PLN02171		629	endoglucanase	97.0
PF00759		444	Glyco_hydro_9: Glycosyl hydrolase family 9; InterP	97.0
KOG0907		106	consensus Thioredoxin [Posttranslational modificat	96.98
cd02973		67	TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-	96.97
PLN03009		495	cellulase	96.94
COG3118		304	Thioredoxin domain-containing protein [Posttransla	96.94
PLN02308		492	endoglucanase	96.93
TIGR02738		153	TrbB type-F conjugative transfer system pilin asse	96.87
PLN02345		469	endoglucanase	96.84
PTZ00470		522	glycoside hydrolase family 47 protein; Provisional	96.84
cd02889		348	SQCY Squalene cyclase (SQCY) domain; found in clas	96.81
cd03026		89	AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid	96.8
PTZ00102		477	disulphide isomerase; Provisional	96.79
PLN02420		525	endoglucanase	96.76
PLN02909		486	Endoglucanase	96.76
cd02952		119	TRP14_like Human TRX-related protein 14 (TRP14)-li	96.75
cd03011		123	TlpA_like_ScsD_MtbDsbE TlpA-like family, suppresso	96.74
cd02992		114	PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidas	96.73
cd02964		132	TryX_like_family Tryparedoxin (TryX)-like family;	96.7
PLN00119		489	endoglucanase	96.66
PLN02613		498	endoglucanase	96.62
cd03010		127	TlpA_like_DsbE TlpA-like family, DsbE (also known	96.61
cd02967		114	mauD Methylamine utilization (mau) D family; mauD	96.58
cd02965		111	HyaE HyaE family; HyaE is also called HupG and Hox	96.56
KOG2787		403	consensus Lanthionine synthetase C-like protein 1	96.5
cd04794		343	euk_LANCL eukaryotic Lanthionine synthetase C-like	96.46
TIGR01577		616	oligosac_amyl oligosaccharide amylase. The name of	96.4
TIGR01130		462	ER_PDI_fam protein disulfide isomerases, eukaryoti	96.26
PTZ00102		477	disulphide isomerase; Provisional	96.23
cd03008		146	TryX_like_RdCVF Tryparedoxin (TryX)-like family, R	96.21
cd04434		343	LanC_like LanC-like proteins. LanC is the cyclase	96.16
PTZ00470		522	glycoside hydrolase family 47 protein; Provisional	96.16
cd04792		825	LanM-like LanM-like proteins. LanM is a bifunction	96.13
TIGR00412		76	redox_disulf_2 small redox-active disulfide protei	96.11
cd02957		113	Phd_like Phosducin (Phd)-like family; composed of	96.1
TIGR01626		184	ytfJ_HI0045 conserved hypothetical protein YtfJ-fa	96.04
TIGR02740		271	TraF-like TraF-like protein. This protein is relat	96.01
TIGR02187		215	GlrX_arch Glutaredoxin-like domain protein. This f	95.98
PF06917		557	Pectate_lyase_2: Periplasmic pectate lyase; InterP	95.92
TIGR02187		215	GlrX_arch Glutaredoxin-like domain protein. This f	95.86
PLN02309		457	5'-adenylylsulfate reductase	95.84
PLN02175		484	endoglucanase	95.75
PRK13728		181	conjugal transfer protein TrbB; Provisional	95.75
PRK03147		173	thiol-disulfide oxidoreductase; Provisional	95.7
cd02982		103	PDI_b'_family Protein Disulfide Isomerase (PDIb')	95.69
cd02990		136	UAS_FAF1 UAS family, FAS-associated factor 1 (FAF1	95.67
COG4403		963	LcnDR2 Lantibiotic modifying enzyme [Defense mecha	95.62
PF14595		129	Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A.	95.61
PF01532		452	Glyco_hydro_47: Glycosyl hydrolase family 47; Inte	95.6
cd01659		69	TRX_superfamily Thioredoxin (TRX) superfamily; a l	95.56
KOG1752		104	consensus Glutaredoxin and related proteins [Postt	95.53
TIGR00424		463	APS_reduc 5'-adenylylsulfate reductase, thioredoxi	95.44
cd02966		116	TlpA_like_family TlpA-like family; composed of Tlp	95.44
cd02987		175	Phd_like_Phd Phosducin (Phd)-like family, Phd subf	95.36
PF05147		355	LANC_like: Lanthionine synthetase C-like protein;	95.36
TIGR02180		84	GRX_euk Glutaredoxin. This model represents eukary	95.29
PLN02919		1057	haloacid dehalogenase-like hydrolase family protei	95.21
cd04794		343	euk_LANCL eukaryotic Lanthionine synthetase C-like	95.11
PRK11509		132	hydrogenase-1 operon protein HyaE; Provisional	95.06
PF01532		452	Glyco_hydro_47: Glycosyl hydrolase family 47; Inte	94.99
PF13905		95	Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_	94.84
cd04793		382	LanC LanC is the cyclase enzyme of the lanthionine	94.69
KOG2507		506	consensus Ubiquitin regulatory protein UBXD2, cont	94.59
cd02896		297	complement_C3_C4_C5 Proteins similar to C3, C4 and	94.52
TIGR02189		99	GlrX-like_plant Glutaredoxin-like family. This fam	94.39
cd03012		126	TlpA_like_DipZ_like TlpA-like family, DipZ-like su	94.38
TIGR02196		74	GlrX_YruB Glutaredoxin-like protein, YruB-family.	94.18
PF08534		146	Redoxin: Redoxin; InterPro: IPR013740 This redoxin	93.97
COG4833		377	Predicted glycosyl hydrolase [Carbohydrate transpo	93.95
KOG0908		288	consensus Thioredoxin-like protein [Posttranslatio	93.86
cd03419		82	GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h	93.85
PF06917		557	Pectate_lyase_2: Periplasmic pectate lyase; InterP	93.8
PHA03050		108	glutaredoxin; Provisional	93.65
cd02892		634	SQCY_1 Squalene cyclase (SQCY) domain subgroup 1;	93.45
TIGR02661		189	MauD methylamine dehydrogenase accessory protein M	93.3
TIGR02200		77	GlrX_actino Glutaredoxin-like protein. This family	93.28
cd02892		634	SQCY_1 Squalene cyclase (SQCY) domain subgroup 1;	93.26
TIGR01507		635	hopene_cyclase squalene-hopene cyclase. SHC is an	93.16
TIGR01130		462	ER_PDI_fam protein disulfide isomerases, eukaryoti	93.1
COG3533		589	Uncharacterized protein conserved in bacteria [Fun	93.01
TIGR02190		79	GlrX-dom Glutaredoxin-family domain. This C-termin	92.79
TIGR00365		97	monothiol glutaredoxin, Grx4 family. The gene for	92.66
TIGR01577		616	oligosac_amyl oligosaccharide amylase. The name of	92.17
cd03017		140	PRX_BCP Peroxiredoxin (PRX) family, Bacterioferrit	92.04
PRK10638		83	glutaredoxin 3; Provisional	91.8
cd02976		73	NrdH NrdH-redoxin (NrdH) family; NrdH is a small m	91.8
TIGR02194		72	GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red	91.64
PTZ00062		204	glutaredoxin; Provisional	91.49
PTZ00056		199	glutathione peroxidase; Provisional	91.31
KOG2204		625	consensus Mannosyl-oligosaccharide alpha-1,2-manno	91.23
PLN02399		236	phospholipid hydroperoxide glutathione peroxidase	91.15
cd02969		171	PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypot	91.1
PLN03009		495	cellulase	90.92
cd02066		72	GRX_family Glutaredoxin (GRX) family; composed of	90.87
PRK11657		251	dsbG disulfide isomerase/thiol-disulfide oxidase;	90.81
PRK09437		154	bcp thioredoxin-dependent thiol peroxidase; Review	90.26
cd03027		73	GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg	90.15
cd03028		90	GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte	89.86
COG4403		963	LcnDR2 Lantibiotic modifying enzyme [Defense mecha	89.45
cd02889		348	SQCY Squalene cyclase (SQCY) domain; found in clas	89.34
PF05147		355	LANC_like: Lanthionine synthetase C-like protein;	88.85
PF00462		60	Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl	88.76
TIGR02181		79	GRX_bact Glutaredoxin, GrxC family. This family of	88.74
PF06202		370	GDE_C: Amylo-alpha-1,6-glucosidase ; InterPro: IPR	88.53
PLN03012		759	Camelliol C synthase	88.45
TIGR02474		290	pec_lyase pectate lyase, PelA/Pel-15E family. Memb	88.21
TIGR02540		153	gpx7 putative glutathione peroxidase Gpx7. This mo	88.1
TIGR01535		648	glucan_glucosid glucan 1,4-alpha-glucosidase. Gluc	88.08
PRK11200		85	grxA glutaredoxin 1; Provisional	87.92
PLN02340		614	endoglucanase	87.9
PRK15317		517	alkyl hydroperoxide reductase subunit F; Provision	87.69
cd03418		75	GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b	87.56
PLN02993		763	lupeol synthase	87.47
KOG2429		622	consensus Glycosyl hydrolase, family 47 [Carbohydr	87.32
PRK12759		410	bifunctional gluaredoxin/ribonucleoside-diphosphat	87.12
cd03007		116	PDI_a_ERp29_N PDIa family, endoplasmic reticulum p	87.0
PF13728		215	TraF: F plasmid transfer operon protein	86.97
PRK10329		81	glutaredoxin-like protein; Provisional	86.9
TIGR03463		634	osq_cycl 2,3-oxidosqualene cyclase. This model ide	86.68
PF05592		509	Bac_rhamnosid: Bacterial alpha-L-rhamnosidase; Int	86.32
PTZ00256		183	glutathione peroxidase; Provisional	85.93
KOG0191		383	consensus Thioredoxin/protein disulfide isomerase	85.87
cd03014		143	PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical	85.81
TIGR03143		555	AhpF_homolog putative alkyl hydroperoxide reductas	85.73
PF06110		119	DUF953: Eukaryotic protein of unknown function (DU	85.68
TIGR01507		635	hopene_cyclase squalene-hopene cyclase. SHC is an	85.57
cd00688		300	ISOPREN_C2_like This group contains class II terpe	85.28
PF06202		370	GDE_C: Amylo-alpha-1,6-glucosidase ; InterPro: IPR	84.74
TIGR02183		86	GRXA Glutaredoxin, GrxA family. This model include	84.7
TIGR01787		621	squalene_cyclas squalene/oxidosqualene cyclases. T	84.69
PRK11097		376	endo-1,4-D-glucanase; Provisional	84.69
KOG2431		546	consensus 1, 2-alpha-mannosidase [Carbohydrate tra	84.6
cd02968		142	SCO SCO (an acronym for Synthesis of Cytochrome c	84.58
PRK13703		248	conjugal pilus assembly protein TraF; Provisional	84.35
PF07678		246	A2M_comp: A-macroglobulin complement component; In	84.11
PRK10877		232	protein disulfide isomerase II DsbC; Provisional	83.87
TIGR02739		256	TraF type-F conjugative transfer system pilin asse	83.09
KOG2431		546	consensus 1, 2-alpha-mannosidase [Carbohydrate tra	82.9
TIGR03140		515	AhpF alkyl hydroperoxide reductase, F subunit. Thi	82.75
cd03015		173	PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-	82.56
PF09492		289	Pec_lyase: Pectic acid lyase; InterPro: IPR012669	82.52
PF00578		124	AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Per	82.18
cd03029		72	GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb	82.15
PRK13190		202	putative peroxiredoxin; Provisional	81.95
PLN02308		492	endoglucanase	81.53
TIGR02474		290	pec_lyase pectate lyase, PelA/Pel-15E family. Memb	80.74
TIGR03463		634	osq_cycl 2,3-oxidosqualene cyclase. This model ide	80.28
KOG4277		468	consensus Uncharacterized conserved protein, conta	80.1

>COG1331 Highly conserved protein containing a thioredoxin domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

Probab=100.00  E-value=3.4e-169  Score=1409.38  Aligned_cols=631  Identities=42%  Similarity=0.715  Sum_probs=589.8

Q ss_pred             chhHHhhhhhcCCcE---EEEcCCchhhhhhccccCcHHHHHHhhcccEEEEecCCCCcchHHHHHHHHHHhcCCCCCCc
Q 005023            2 GRRSFCGGTKTRRTH---FLINTCHWCHVMEVESFEDEGVAKLLNDWFVSIKVDREERPDVDKVYMTYVQALYGGGGWPL   78 (718)
Q Consensus         2 ~~~a~~~Ak~e~K~i---i~y~~C~wChvM~~esf~d~~va~~ln~~Fv~vkvD~ee~pd~d~~y~~~~q~~~g~~GwP~   78 (718)
                      |++|+++|++|+|||   |||+||||||||++|||+||+||++||++|||||||||||||||++||++||+|+|+||||+
T Consensus        32 ~~eAf~~A~~edkPIflSIGys~CHWChVM~~ESf~d~eiA~~lN~~FV~IKVDREERPDvD~~Ym~~~q~~tG~GGWPL  111 (667)
T COG1331          32 GEEAFAKAKEEDKPILLSIGYSTCHWCHVMAHESFEDPEIAAILNENFVPVKVDREERPDVDSLYMNASQAITGQGGWPL  111 (667)
T ss_pred             CHHHHHHHHHhCCCEEEEeccccccchHHHhhhcCCCHHHHHHHHhCceeeeEChhhccCHHHHHHHHHHHhccCCCCce
Confidence            789999999999999   57999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEeCCCCceeecccccCCCCCCCcccHHHHHHHHHHHHhhcHHHHHHHHHHHHHHHHHHhhcccCCCCCCCCCCHHHHH
Q 005023           79 SVFLSPDLKPLMGGTYFPPEDKYGRPGFKTILRKVKDAWDKKRDMLAQSGAFAIEQLSEALSASASSNKLPDELPQNALR  158 (718)
Q Consensus        79 ~vfl~p~g~p~~~~~y~p~~~~~~~~~f~~~L~~i~~~w~~~~~~~~~~a~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~  158 (718)
                      ||||||||+|||++||||+++++|+|||+++|++|.+.|+++|++++++|+.+.+.++....+.     .+..++.+.++
T Consensus       112 tVfLTPd~kPFfagTY~P~e~r~g~pGf~~lL~~i~~~W~edr~~~~~~a~~~~~~l~~~~~~~-----~~~~l~~~~l~  186 (667)
T COG1331         112 TVFLTPDGKPFFAGTYFPKEDRYGRPGFKQLLEAIRETWREDREELLQSAERVLEALEGLARPS-----AGEELDEEVLD  186 (667)
T ss_pred             eEEECCCCceeeeeeecCCcccCCCcCHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHhccCCC-----ccccCChHHHH
Confidence            9999999999999999999999999999999999999999999999999999999998755221     12346778899


Q ss_pred             HHHHHHHhcccccCCCCCCCCCCCChhHHHHHHHhhhhhcccCCCCCCHHHHHHHHHHHHHHHhCCCcccCCCcEEEEec
Q 005023          159 LCAEQLSKSYDSRFGGFGSAPKFPRPVEIQMMLYHSKKLEDTGKSGEASEGQKMVLFTLQCMAKGGIHDHVGGGFHRYSV  238 (718)
Q Consensus       159 ~~~~~l~~~~D~~~GGfg~apKFP~~~~l~~Ll~~~~~~~~~~~~~~~~~~~~~~~~TL~~m~~gGi~D~v~GGF~RYsv  238 (718)
                      +++.++.+.||++|||||++||||+|+.+.|||+++.+++       ++++++|+.+||++|+.||||||||||||||||
T Consensus       187 ~~~~~l~~~~D~~~GGfg~~pKFP~~~~l~~Llr~~~~~~-------d~~~~~~~~~TL~~ma~GGIyDhlgGGF~RYSt  259 (667)
T COG1331         187 RAAEALARSFDREYGGFGSAPKFPPPHLLLFLLRYSLRTG-------DERALDMVLRTLDAMARGGIYDHLGGGFFRYST  259 (667)
T ss_pred             HHHHHHHHhcchhhCCcCCCCCCCChHHHHHHHHHHHhhC-------CHHHHHHHHHHHHHHHccCCccccCCceeeeec
Confidence            9999999999999999999999999999999999998753       589999999999999999999999999999999


Q ss_pred             CCCCCCCCCcchHHHHHHHHHHHHHHHHccCChHHHHHHHHHHHHHHHhccCCCCceeeeccCCcccccCcccccCCceE
Q 005023          239 DERWHVPHFEKMLYDQGQLANVYLDAFSLTKDVFYSYICRDILDYLRRDMIGPGGEIFSAEDADSAETEGATRKKEGAFY  318 (718)
Q Consensus       239 D~~W~vPHFEKmLyDnA~ll~~ya~Ay~~t~~~~y~~~A~~~~~~l~~~m~~p~Ggf~sa~DADs~~~~~~~~~~EG~yY  318 (718)
                      |++|.||||||||||||+|+.+|++||++|||++|+++|++|++||+|+|++|+||||+|+||||+       ++||+||
T Consensus       260 D~~WlvPHFEKMLyDnA~l~~~y~~ay~~tgd~~y~~~a~~i~~~l~rel~sp~ggFyss~DAD~~-------g~EG~~Y  332 (667)
T COG1331         260 DREWLVPHFEKMLYDNALLLRAYAEAYRATGDDLYRRAAEGILDYLLRELYSPEGGFYSSLDADSD-------GEEGKYY  332 (667)
T ss_pred             CCceechhHHHHHHHHHHHHHHHHHHHHHhCCHHHHHHHHHHHHHHHHHhcCCCCceeecccccCc-------ccCCCee
Confidence            999999999999999999999999999999999999999999999999999999999999999994       6999999


Q ss_pred             eechHHHHHHhchhHHHHHHHhcccCCCCcCCCCCCCCCCccCCcceeeccCCchHHHHhcCCCHHHHHHHHHHHHHHHH
Q 005023          319 VWTSKEVEDILGEHAILFKEHYYLKPTGNCDLSRMSDPHNEFKGKNVLIELNDSSASASKLGMPLEKYLNILGECRRKLF  398 (718)
Q Consensus       319 ~Wt~~Ei~~~L~~~~~~~~~~~~v~~~Gn~~~~~~~dp~~~~eg~nvL~~~~~~~~~a~~~g~~~~~~~~~l~~~r~~L~  398 (718)
                      +||.+||+++||+++++||++|+|+++||            |+|+||||+..+.++ +      +++..+.++.+|+||+
T Consensus       333 ~Ws~eEi~~~Lg~d~~~~~~~f~vs~~Gn------------feGrnvL~~~~~~~~-~------~~~~~~~l~~~r~kL~  393 (667)
T COG1331         333 TWSVEELKEVLGEDAELACKYFDVSEEGN------------FEGRNVLHVPGPLEE-A------IEEAEEKLERAREKLL  393 (667)
T ss_pred             ecCHHHHHHHhcccHHHHHHHcccCCCCC------------cCCceeecccCchhh-h------hhhhHHHHHHHHHHHH
Confidence            99999999999999999999999999999            789999999988776 2      7889999999999999


Q ss_pred             hhhccCCCCCCCchhhhchHHHHHHHHHHHHHHhhhhhhhhcccCCCCCCChHHHHHHHHHHHHHHHHhccccCCCeEEE
Q 005023          399 DVRSKRPRPHLDDKVIVSWNGLVISSFARASKILKSEAESAMFNFPVVGSDRKEYMEVAESAASFIRRHLYDEQTHRLQH  478 (718)
Q Consensus       399 ~~R~~R~~P~~Ddkilt~WNgl~I~ALa~A~~~~~d~~~~~~~~~~~~~~~~~~~l~~A~~~~~~l~~~~~d~~~g~l~~  478 (718)
                      .+|++|++|++||||||+||||||.||++|++++++                ++|++.|+++++||.+++++   ++|.|
T Consensus       394 ~~R~~R~~P~~Ddkvlt~wNglmi~aLa~a~~~~~d----------------~~~l~~A~~~~~fi~~~l~~---~rl~~  454 (667)
T COG1331         394 AAREKRKQPSRDDKVLTDWNGLMIAALAEAGRVLGD----------------PEYLEAAERAADFILDNLYV---DRLLR  454 (667)
T ss_pred             HHHHhCCCCCCCcceeeccHHHHHHHHHHHHHHcCC----------------hHHHHHHHHHHHHHHHhhcc---cchhe
Confidence            999999999999999999999999999999999998                89999999999999999997   38999


Q ss_pred             eecCCCCCCCCCcccHHHHHHHHHHHHHHcCChHHHHHHHHHHHHHHHhcccccCCccccCCCCCCccccccccCCCCCC
Q 005023          479 SFRNGPSKAPGFLDDYAFLISGLLDLYEFGSGTKWLVWAIELQNTQDELFLDREGGGYFNTTGEDPSVLLRVKEDHDGAE  558 (718)
Q Consensus       479 ~~~~g~~~~~~~l~DyA~li~all~LYeaTgd~~~L~~A~~L~~~~~~~F~D~~~Gg~f~t~~~~~~l~~r~k~~~D~a~  558 (718)
                      ++++|.+...++++|||++|.|+|+||++|+|.+||+.|++|++.++++|||++ ||||+++.+++.+++|+++.+|+++
T Consensus       455 ~~~~G~a~~~g~leDYA~~i~gll~lye~t~d~~yL~~A~~L~~~~i~~f~d~~-gGf~~t~~~~~~l~ir~~~~~D~a~  533 (667)
T COG1331         455 RYRGGEAAVAGLLEDYAFLILGLLALYEATGDLAYLEKAIELADEAIADFWDDE-GGFYDTPSDSEDLLIRPKEPTDGAT  533 (667)
T ss_pred             eeecCcccccccchhHHHHHHHHHHHHHhhCcHHHHHHHHHHHHHHHHHhcCCC-CCcccCCCcccccccCCCCCCCCCC
Confidence            999999999999999999999999999999999999999999999999999998 7799999999999999999999999


Q ss_pred             CChHHHHHHHHHHHHHHhCCCCchHHHHHHHHHHHHHHHHHHhhhhhHHHHHHHHHHhcCCCccEEEEecCCCChhHHHH
Q 005023          559 PSGNSVSVINLVRLASIVAGSKSDYYRQNAEHSLAVFETRLKDMAMAVPLMCCAADMLSVPSRKHVVLVGHKSSVDFENM  638 (718)
Q Consensus       559 PS~ns~~a~~LlrL~~lt~~~~~~~y~e~a~~~l~~~~~~i~~~p~~~~~~l~a~~~~~~~~~~~ivi~g~~~~~~~~~l  638 (718)
                      ||+||+++.+|++|+.+||+   ..|.+.|+++|++|++.+.++|.++++++.|++++..+ ..+|||+|.    ...++
T Consensus       534 ~S~na~~~~~L~~Ls~ltg~---~~y~e~A~~~L~a~~~~~~~~p~~~~~~~~a~~~~~~~-~~~ivvv~~----~~~~~  605 (667)
T COG1331         534 PSGNAVAAQALLRLSLLTGD---ARYLEAAEDILQAFAGLAERAPFAHAGLLLAAEFLISG-PLVIVVAGD----PRSEL  605 (667)
T ss_pred             CCHHHHHHHHHHHHHhhcCc---hhHHHHHHHHHHHHHHHHHhCCccchHHHHHHHHHcCC-ceEEEEeCC----CcHHH
Confidence            99999999999999999996   88999999999999999999999999999999998766 588888882    34579


Q ss_pred             HHHHHhcCCCCeEEEEeCCCCcchhhhhhhccccchhhhcccCCCCccEEEEecCCccCCCCCCHHHHHHHhhc
Q 005023          639 LAAAHASYDLNKTVIHIDPADTEEMDFWEEHNSNNASMARNNFSADKVVALVCQNFSCSPPVTDPISLENLLLE  712 (718)
Q Consensus       639 ~~~~~~~~~P~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ayvC~~~~C~~Pv~~~~~l~~~l~~  712 (718)
                      ++++.+.|+|.+++++...+.             +.++.+...++++ ++|||++++|++||+++++|.++|..
T Consensus       606 ~~~~~~~~~P~~~l~~~~~~~-------------~~~~~~~~l~~g~-~ayvC~~~~C~~P~~~~e~l~~~l~~  665 (667)
T COG1331         606 LRAALRLYLPEKVLVVGTEGY-------------VSLLVDGMLGGGK-TAYVCTGDACLPPVTSPEELAELLAV  665 (667)
T ss_pred             HHHHHhcCCcceEEEEecccc-------------cCcchhhccCCCC-eEEEecCCccCCCcCCHHHHHHHHhh
Confidence            999999999999999864331             1111111112455 99999999999999999999999964

>KOG2244 consensus Highly conserved protein containing a thioredoxin domain [General function prediction only]	Back alignment and domain information

>PF03190 Thioredox_DsbH: Protein of unknown function, DUF255; InterPro: IPR004879 This is a group of uncharacterised proteins	Back alignment and domain information

>cd02955 SSP411 TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif	Back alignment and domain information

>cd00249 AGE AGE domain; N-acyl-D-glucosamine 2-epimerase domain; Responsible for intermediate epimerization during biosynthesis of N-acetylneuraminic acid	Back alignment and domain information

>cd00249 AGE AGE domain; N-acyl-D-glucosamine 2-epimerase domain; Responsible for intermediate epimerization during biosynthesis of N-acetylneuraminic acid	Back alignment and domain information

>PF07221 GlcNAc_2-epim: N-acylglucosamine 2-epimerase (GlcNAc 2-epimerase); InterPro: IPR010819 N-acylglucosamine 2-epimerase (AGE, 5	Back alignment and domain information

>PF07221 GlcNAc_2-epim: N-acylglucosamine 2-epimerase (GlcNAc 2-epimerase); InterPro: IPR010819 N-acylglucosamine 2-epimerase (AGE, 5	Back alignment and domain information

>cd02960 AGR Anterior Gradient (AGR) family; members of this family are similar to secreted proteins encoded by the cement gland-specific genes XAG-1 and XAG-2, expressed in the anterior region of dorsal ectoderm of Xenopus	Back alignment and domain information

>cd02958 UAS UAS family; UAS is a domain of unknown function	Back alignment and domain information

>PF13899 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_A 1UC7_A 2JU5_A 1VRS_D 2FWG_A 2FWF_A 2FWH_A 2FWE_A 3FK8_A	Back alignment and domain information

>COG2942 N-acyl-D-glucosamine 2-epimerase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PF03663 Glyco_hydro_76: Glycosyl hydrolase family 76 ; InterPro: IPR005198 O-Glycosyl hydrolases 3	Back alignment and domain information

>cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation	Back alignment and domain information

>cd02959 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; ERp19 is also known as ERp18, a protein located in the ER containing one redox active TRX domain	Back alignment and domain information

>smart00594 UAS UAS domain	Back alignment and domain information

>COG1331 Highly conserved protein containing a thioredoxin domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD	Back alignment and domain information

>PF03663 Glyco_hydro_76: Glycosyl hydrolase family 76 ; InterPro: IPR005198 O-Glycosyl hydrolases 3	Back alignment and domain information

>PRK00293 dipZ thiol:disulfide interchange protein precursor; Provisional	Back alignment and domain information

>PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A	Back alignment and domain information

>cd02991 UAS_ETEA UAS family, ETEA subfamily; composed of proteins similar to human ETEA protein, the translation product of a highly expressed gene in the T-cells and eosinophils of atopic dermatitis patients compared with those of normal individuals	Back alignment and domain information

>cd04791 LanC_SerThrkinase Lanthionine synthetase C-like domain associated with serine threonine kinases	Back alignment and domain information

>COG2143 Thioredoxin-related protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2244 consensus Highly conserved protein containing a thioredoxin domain [General function prediction only]	Back alignment and domain information

>PF07470 Glyco_hydro_88: Glycosyl Hydrolase Family 88; InterPro: IPR010905 Unsaturated glucuronyl hydrolase catalyses the hydrolytic release of unsaturated glucuronic acids from oligosaccharides produced by the reactions of polysaccharide lyases []	Back alignment and domain information

>COG2942 N-acyl-D-glucosamine 2-epimerase [Carbohydrate transport and metabolism]	Back alignment and domain information

>cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus	Back alignment and domain information

>cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains	Back alignment and domain information

>COG4232 Thiol:disulfide interchange protein [Posttranslational modification, protein turnover, chaperones / Energy production and conversion]	Back alignment and domain information

>PRK10996 thioredoxin 2; Provisional	Back alignment and domain information

>cd04791 LanC_SerThrkinase Lanthionine synthetase C-like domain associated with serine threonine kinases	Back alignment and domain information

>cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein	Back alignment and domain information

>PF07944 DUF1680: Putative glycosyl hydrolase of unknown function (DUF1680); InterPro: IPR012878 The members of this family are sequences derived from hypothetical bacterial and eukaryotic proteins of unknown function	Back alignment and domain information

>cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain	Back alignment and domain information

>cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes	Back alignment and domain information

>COG4225 Predicted unsaturated glucuronyl hydrolase involved in regulation of bacterial surface properties, and related proteins [General function prediction only]	Back alignment and domain information

>PLN00410 U5 snRNP protein, DIM1 family; Provisional	Back alignment and domain information

>cd02986 DLP Dim1 family, Dim1-like protein (DLP) subfamily; DLP is a novel protein which shares 38% sequence identity to Dim1	Back alignment and domain information

>TIGR01126 pdi_dom protein disulfide-isomerase domain	Back alignment and domain information

>TIGR01068 thioredoxin thioredoxin	Back alignment and domain information

>cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus	Back alignment and domain information

>cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein	Back alignment and domain information

>cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related)	Back alignment and domain information

>cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants	Back alignment and domain information

>PF06662 C5-epim_C: D-glucuronyl C5-epimerase C-terminus; InterPro: IPR010598 This entry consists of known or predicted D-glucuronyl C5-epimerases which share a common C-terminal region	Back alignment and domain information

>PF07470 Glyco_hydro_88: Glycosyl Hydrolase Family 88; InterPro: IPR010905 Unsaturated glucuronyl hydrolase catalyses the hydrolytic release of unsaturated glucuronic acids from oligosaccharides produced by the reactions of polysaccharide lyases []	Back alignment and domain information

>cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif	Back alignment and domain information

>cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains	Back alignment and domain information

>cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases	Back alignment and domain information

>cd04792 LanM-like LanM-like proteins	Back alignment and domain information

>cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention	Back alignment and domain information

>cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain	Back alignment and domain information

>cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains	Back alignment and domain information

>PHA02278 thioredoxin-like protein	Back alignment and domain information

>TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative	Back alignment and domain information

>cd04434 LanC_like LanC-like proteins	Back alignment and domain information

>TIGR00411 redox_disulf_1 small redox-active disulfide protein 1	Back alignment and domain information

>PRK09381 trxA thioredoxin; Provisional	Back alignment and domain information

>TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily	Back alignment and domain information

>PF07944 DUF1680: Putative glycosyl hydrolase of unknown function (DUF1680); InterPro: IPR012878 The members of this family are sequences derived from hypothetical bacterial and eukaryotic proteins of unknown function	Back alignment and domain information

>cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library	Back alignment and domain information

>PTZ00051 thioredoxin; Provisional	Back alignment and domain information

>cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains	Back alignment and domain information

>PRK15412 thiol:disulfide interchange protein DsbE; Provisional	Back alignment and domain information

>cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX	Back alignment and domain information

>cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding	Back alignment and domain information

>cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1	Back alignment and domain information

>cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle	Back alignment and domain information

>PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms	Back alignment and domain information

>PF06662 C5-epim_C: D-glucuronyl C5-epimerase C-terminus; InterPro: IPR010598 This entry consists of known or predicted D-glucuronyl C5-epimerases which share a common C-terminal region	Back alignment and domain information

>cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5	Back alignment and domain information

>cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein	Back alignment and domain information

>cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains	Back alignment and domain information

>cd04793 LanC LanC is the cyclase enzyme of the lanthionine synthetase	Back alignment and domain information

>cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox	Back alignment and domain information

>PTZ00443 Thioredoxin domain-containing protein; Provisional	Back alignment and domain information

>cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif	Back alignment and domain information

>cd03009 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, TryX and nucleoredoxin (NRX) subfamily; TryX and NRX are thioredoxin (TRX)-like protein disulfide oxidoreductases that alter the redox state of target proteins via the reversible oxidation of an active center CXXC motif	Back alignment and domain information

>KOG0910 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG3533 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PLN02266 endoglucanase	Back alignment and domain information

>PHA02125 thioredoxin-like protein	Back alignment and domain information

>PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional	Back alignment and domain information

>cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44	Back alignment and domain information

>PLN02340 endoglucanase	Back alignment and domain information

>cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain)	Back alignment and domain information

>COG4225 Predicted unsaturated glucuronyl hydrolase involved in regulation of bacterial surface properties, and related proteins [General function prediction only]	Back alignment and domain information

>PLN02171 endoglucanase	Back alignment and domain information

>PF00759 Glyco_hydro_9: Glycosyl hydrolase family 9; InterPro: IPR001701 O-Glycosyl hydrolases 3	Back alignment and domain information

>KOG0907 consensus Thioredoxin [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)	Back alignment and domain information

>PLN03009 cellulase	Back alignment and domain information

>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN02308 endoglucanase	Back alignment and domain information

>TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB	Back alignment and domain information

>PLN02345 endoglucanase	Back alignment and domain information

>PTZ00470 glycoside hydrolase family 47 protein; Provisional	Back alignment and domain information

>cd02889 SQCY Squalene cyclase (SQCY) domain; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold	Back alignment and domain information

>cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides	Back alignment and domain information

>PTZ00102 disulphide isomerase; Provisional	Back alignment and domain information

>PLN02420 endoglucanase	Back alignment and domain information

>PLN02909 Endoglucanase	Back alignment and domain information

>cd02952 TRP14_like Human TRX-related protein 14 (TRP14)-like family; composed of proteins similar to TRP14, a 14kD cytosolic protein that shows disulfide reductase activity in vitro with a different substrate specificity compared with another human cytosolic protein, TRX1	Back alignment and domain information

>cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif	Back alignment and domain information

>cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein	Back alignment and domain information

>cd02964 TryX_like_family Tryparedoxin (TryX)-like family; composed of TryX and related proteins including nucleoredoxin (NRX), rod-derived cone viability factor (RdCVF) and the nematode homolog described as a 16-kD class of TRX	Back alignment and domain information

>PLN00119 endoglucanase	Back alignment and domain information

>PLN02613 endoglucanase	Back alignment and domain information

>cd03010 TlpA_like_DsbE TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif	Back alignment and domain information

>cd02967 mauD Methylamine utilization (mau) D family; mauD protein is the translation product of the mauD gene found in methylotrophic bacteria, which are able to use methylamine as a sole carbon source and a nitrogen source	Back alignment and domain information

>cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO	Back alignment and domain information

>KOG2787 consensus Lanthionine synthetase C-like protein 1 [Defense mechanisms]	Back alignment and domain information

>cd04794 euk_LANCL eukaryotic Lanthionine synthetase C-like protein	Back alignment and domain information

>TIGR01577 oligosac_amyl oligosaccharide amylase	Back alignment and domain information

>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic	Back alignment and domain information

>PTZ00102 disulphide isomerase; Provisional	Back alignment and domain information

>cd03008 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors	Back alignment and domain information

>cd04434 LanC_like LanC-like proteins	Back alignment and domain information

>PTZ00470 glycoside hydrolase family 47 protein; Provisional	Back alignment and domain information

>cd04792 LanM-like LanM-like proteins	Back alignment and domain information

>TIGR00412 redox_disulf_2 small redox-active disulfide protein 2	Back alignment and domain information

>cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions	Back alignment and domain information

>TIGR01626 ytfJ_HI0045 conserved hypothetical protein YtfJ-family, TIGR01626	Back alignment and domain information

>TIGR02740 TraF-like TraF-like protein	Back alignment and domain information

>TIGR02187 GlrX_arch Glutaredoxin-like domain protein	Back alignment and domain information

>PF06917 Pectate_lyase_2: Periplasmic pectate lyase; InterPro: IPR010702 This family consists of several Enterobacterial periplasmic pectate lyase proteins	Back alignment and domain information

>TIGR02187 GlrX_arch Glutaredoxin-like domain protein	Back alignment and domain information

>PLN02309 5'-adenylylsulfate reductase	Back alignment and domain information

>PLN02175 endoglucanase	Back alignment and domain information

>PRK13728 conjugal transfer protein TrbB; Provisional	Back alignment and domain information

>PRK03147 thiol-disulfide oxidoreductase; Provisional	Back alignment and domain information

>cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants	Back alignment and domain information

>cd02990 UAS_FAF1 UAS family, FAS-associated factor 1 (FAF1) subfamily; FAF1 contains a UAS domain of unknown function N-terminal to a ubiquitin-associated UBX domain	Back alignment and domain information

>COG4403 LcnDR2 Lantibiotic modifying enzyme [Defense mechanisms]	Back alignment and domain information

>PF14595 Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A	Back alignment and domain information

>PF01532 Glyco_hydro_47: Glycosyl hydrolase family 47; InterPro: IPR001382 O-Glycosyl hydrolases 3	Back alignment and domain information

>cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold	Back alignment and domain information

>KOG1752 consensus Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00424 APS_reduc 5'-adenylylsulfate reductase, thioredoxin-independent	Back alignment and domain information

>cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins	Back alignment and domain information

>cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions	Back alignment and domain information

>PF05147 LANC_like: Lanthionine synthetase C-like protein; InterPro: IPR007822 The LanC-like protein superfamily encompasses a highly divergent group of peptide-modifying enzymes, including the eukaryotic and bacterial lanthionine synthetase C-like proteins (LanC) [, , ]; subtilin biosynthesis protein SpaC from Bacillus subtilis [, ]; epidermin biosynthesis protein EpiC from Staphylococcus epidermidis []; nisin biosynthesis protein NisC from Lactococcus lactis [, , ]; GCR2 from Arabidopsis thaliana []; and many others

Back alignment and domain information

>TIGR02180 GRX_euk Glutaredoxin	Back alignment and domain information

>PLN02919 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>cd04794 euk_LANCL eukaryotic Lanthionine synthetase C-like protein	Back alignment and domain information

>PRK11509 hydrogenase-1 operon protein HyaE; Provisional	Back alignment and domain information

>PF01532 Glyco_hydro_47: Glycosyl hydrolase family 47; InterPro: IPR001382 O-Glycosyl hydrolases 3	Back alignment and domain information

>PF13905 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_A 1OC8_B 1O6J_A 1OC9_B 1O81_A 3FKF_A 1O85_A 1O7U_A 1O8W_A	Back alignment and domain information

>cd04793 LanC LanC is the cyclase enzyme of the lanthionine synthetase	Back alignment and domain information

>KOG2507 consensus Ubiquitin regulatory protein UBXD2, contains UAS and UBX domains [General function prediction only]	Back alignment and domain information

>cd02896 complement_C3_C4_C5 Proteins similar to C3, C4 and C5 of vertebrate complement	Back alignment and domain information

>TIGR02189 GlrX-like_plant Glutaredoxin-like family	Back alignment and domain information

>cd03012 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain	Back alignment and domain information

>TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family	Back alignment and domain information

>PF08534 Redoxin: Redoxin; InterPro: IPR013740 This redoxin domain is found in peroxiredoxin, thioredoxin and glutaredoxin proteins	Back alignment and domain information

>COG4833 Predicted glycosyl hydrolase [Carbohydrate transport and metabolism]	Back alignment and domain information

>KOG0908 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain	Back alignment and domain information

>PF06917 Pectate_lyase_2: Periplasmic pectate lyase; InterPro: IPR010702 This family consists of several Enterobacterial periplasmic pectate lyase proteins	Back alignment and domain information

>PHA03050 glutaredoxin; Provisional	Back alignment and domain information

>cd02892 SQCY_1 Squalene cyclase (SQCY) domain subgroup 1; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold	Back alignment and domain information

>TIGR02661 MauD methylamine dehydrogenase accessory protein MauD	Back alignment and domain information

>TIGR02200 GlrX_actino Glutaredoxin-like protein	Back alignment and domain information

>cd02892 SQCY_1 Squalene cyclase (SQCY) domain subgroup 1; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold	Back alignment and domain information

>TIGR01507 hopene_cyclase squalene-hopene cyclase	Back alignment and domain information

>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic	Back alignment and domain information

>COG3533 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>TIGR02190 GlrX-dom Glutaredoxin-family domain	Back alignment and domain information

>TIGR00365 monothiol glutaredoxin, Grx4 family	Back alignment and domain information

>TIGR01577 oligosac_amyl oligosaccharide amylase	Back alignment and domain information

>cd03017 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides	Back alignment and domain information

>PRK10638 glutaredoxin 3; Provisional	Back alignment and domain information

>cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile	Back alignment and domain information

>TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH	Back alignment and domain information

>PTZ00062 glutaredoxin; Provisional	Back alignment and domain information

>PTZ00056 glutathione peroxidase; Provisional	Back alignment and domain information

>KOG2204 consensus Mannosyl-oligosaccharide alpha-1,2-mannosidase and related glycosyl hydrolases [Carbohydrate transport and metabolism]	Back alignment and domain information

>PLN02399 phospholipid hydroperoxide glutathione peroxidase	Back alignment and domain information

>cd02969 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs	Back alignment and domain information

>PLN03009 cellulase	Back alignment and domain information

>cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain	Back alignment and domain information

>PRK11657 dsbG disulfide isomerase/thiol-disulfide oxidase; Provisional	Back alignment and domain information

>PRK09437 bcp thioredoxin-dependent thiol peroxidase; Reviewed	Back alignment and domain information

>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions	Back alignment and domain information

>cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins	Back alignment and domain information

>COG4403 LcnDR2 Lantibiotic modifying enzyme [Defense mechanisms]	Back alignment and domain information

>cd02889 SQCY Squalene cyclase (SQCY) domain; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold	Back alignment and domain information

Back alignment and domain information

>PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors	Back alignment and domain information

>TIGR02181 GRX_bact Glutaredoxin, GrxC family	Back alignment and domain information

>PF06202 GDE_C: Amylo-alpha-1,6-glucosidase ; InterPro: IPR010401 This family includes human glycogen branching enzyme P35573 from SWISSPROT	Back alignment and domain information

>PLN03012 Camelliol C synthase	Back alignment and domain information

>TIGR02474 pec_lyase pectate lyase, PelA/Pel-15E family	Back alignment and domain information

>TIGR02540 gpx7 putative glutathione peroxidase Gpx7	Back alignment and domain information

>TIGR01535 glucan_glucosid glucan 1,4-alpha-glucosidase	Back alignment and domain information

>PRK11200 grxA glutaredoxin 1; Provisional	Back alignment and domain information

>PLN02340 endoglucanase	Back alignment and domain information

>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional	Back alignment and domain information

>cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain	Back alignment and domain information

>PLN02993 lupeol synthase	Back alignment and domain information

>KOG2429 consensus Glycosyl hydrolase, family 47 [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK12759 bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional	Back alignment and domain information

>cd03007 PDI_a_ERp29_N PDIa family, endoplasmic reticulum protein 29 (ERp29) subfamily; ERp29 is a ubiquitous ER-resident protein expressed in high levels in secretory cells	Back alignment and domain information

>PF13728 TraF: F plasmid transfer operon protein	Back alignment and domain information

>PRK10329 glutaredoxin-like protein; Provisional	Back alignment and domain information

>TIGR03463 osq_cycl 2,3-oxidosqualene cyclase	Back alignment and domain information

>PF05592 Bac_rhamnosid: Bacterial alpha-L-rhamnosidase; InterPro: IPR008902 This entry consists of bacterial rhamnosidase A and B enzymes	Back alignment and domain information

>PTZ00256 glutathione peroxidase; Provisional	Back alignment and domain information

>KOG0191 consensus Thioredoxin/protein disulfide isomerase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd03014 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 2-cys PRX subfamily; composed of PRXs containing peroxidatic and resolving cysteines, similar to the homodimeric thiol specific antioxidant (TSA) protein also known as TRX-dependent thiol peroxidase (Tpx)	Back alignment and domain information

>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit	Back alignment and domain information

>PF06110 DUF953: Eukaryotic protein of unknown function (DUF953); InterPro: IPR010357 This family consists of several hypothetical eukaryotic proteins of unknown function that are thioredoxin-like	Back alignment and domain information

>TIGR01507 hopene_cyclase squalene-hopene cyclase	Back alignment and domain information

>cd00688 ISOPREN_C2_like This group contains class II terpene cyclases, protein prenyltransferases beta subunit, two broadly specific proteinase inhibitors alpha2-macroglobulin (alpha (2)-M) and pregnancy zone protein (PZP) and, the C3 C4 and C5 components of vertebrate complement	Back alignment and domain information

>PF06202 GDE_C: Amylo-alpha-1,6-glucosidase ; InterPro: IPR010401 This family includes human glycogen branching enzyme P35573 from SWISSPROT	Back alignment and domain information

>TIGR02183 GRXA Glutaredoxin, GrxA family	Back alignment and domain information

>TIGR01787 squalene_cyclas squalene/oxidosqualene cyclases	Back alignment and domain information

>PRK11097 endo-1,4-D-glucanase; Provisional	Back alignment and domain information

>KOG2431 consensus 1, 2-alpha-mannosidase [Carbohydrate transport and metabolism]	Back alignment and domain information

>cd02968 SCO SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold	Back alignment and domain information

>PRK13703 conjugal pilus assembly protein TraF; Provisional	Back alignment and domain information

>PF07678 A2M_comp: A-macroglobulin complement component; InterPro: IPR011626 This domain covers the complement component region of the alpha-2-macroglobulin family	Back alignment and domain information

>PRK10877 protein disulfide isomerase II DsbC; Provisional	Back alignment and domain information

>TIGR02739 TraF type-F conjugative transfer system pilin assembly protein TraF	Back alignment and domain information

>KOG2431 consensus 1, 2-alpha-mannosidase [Carbohydrate transport and metabolism]	Back alignment and domain information

>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit	Back alignment and domain information

>cd03015 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides	Back alignment and domain information

>PF09492 Pec_lyase: Pectic acid lyase; InterPro: IPR012669 Members of this family are isozymes of pectate lyase (4	Back alignment and domain information

>PF00578 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Peroxiredoxins (Prxs) are a ubiquitous family of antioxidant enzymes that also control cytokine-induced peroxide levels which mediate signal transduction in mammalian cells	Back alignment and domain information

>cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria	Back alignment and domain information

>PRK13190 putative peroxiredoxin; Provisional	Back alignment and domain information

>PLN02308 endoglucanase	Back alignment and domain information

>TIGR02474 pec_lyase pectate lyase, PelA/Pel-15E family	Back alignment and domain information

>TIGR03463 osq_cycl 2,3-oxidosqualene cyclase	Back alignment and domain information

>KOG4277 consensus Uncharacterized conserved protein, contains thioredoxin domain [General function prediction only]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		718
3ira_A		173	The Crystal Structure Of One Domain Of The Conserve		5e-30

>pdb|3IRA|A Chain A, The Crystal Structure Of One Domain Of The Conserved Protein From Methanosarcina Mazei Go1 Length = 173

Back alignment and structure

Iteration: 1

Score = 129 bits (325), Expect = 5e-30, Method: Compositional matrix adjust. Identities = 57/130 (43%), Positives = 83/130 (63%), Gaps = 3/130 (2%) Query: 2 GRRSFCGGTKTRRTHFL---INTCHWCHVMEVESFEDEGVAKLLNDWFVSIKVDREERPD 58 G +F K + FL +TCHWCH+M ESFEDE VA L+N+ FVSIKVDREERPD Sbjct: 28 GEEAFEKARKENKPVFLSIGYSTCHWCHMMAHESFEDEEVAGLMNEAFVSIKVDREERPD 87 Query: 59 VDKVYMTYVQALYGGGGWPLSVFLSPDLKPLMGGTYFPPEDKYGRPGFKTILRKVKDAWD 118 +D +YMT Q + G GGWPL++ ++P KP GTY P ++ + G ++ ++K+ W+ Sbjct: 88 IDNIYMTVCQIILGRGGWPLNIIMTPGKKPFFAGTYIPKNTRFNQIGMLELVPRIKEIWE 147 Query: 119 KKRDMLAQSG 128 ++ + + S Sbjct: 148 QQHEEVLDSA 157

PyMOL of 3ira

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		718
3ira_A		173	Conserved protein; methanosarcina mazei,structural	2e-68
2ju5_A		154	Thioredoxin disulfide isomerase; protein, oxidored	5e-27
2gz6_A		388	N-acetyl-D-glucosamine 2-epimerase; anabaena SP. C	6e-21
3f9u_A		172	Putative exported cytochrome C biogenesis-related;	3e-19
1sen_A		164	Thioredoxin-like protein P19; endoplasmic reticulu	2e-18
3ph9_A		151	Anterior gradient protein 3 homolog; thioredoxin f	2e-17
3fk8_A		133	Disulphide isomerase; APC61824.1, xylella fastidio	7e-15
3gt5_A		402	N-acetylglucosamine 2-epimerase; structural genomi	4e-14
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	3e-11
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	5e-09
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-04
2lst_A		130	Thioredoxin; structural genomics, NEW YORK structu	6e-11
1fp3_A		402	N-acyl-D-glucosamine 2-epimerase; alpha/alpha-barr	1e-07
2fwh_A		134	Thiol:disulfide interchange protein DSBD; thioredo	1e-05
2dlx_A		153	UBX domain-containing protein 7; UAS domain, prote	5e-05

>3ira_A Conserved protein; methanosarcina mazei,structural genomics, MCSG, protein structure initiative, midwest center for STRU genomics; 2.10A {Methanosarcina mazei} Length = 173	Back alignment and structure

 Score =  221 bits (564), Expect = 2e-68
 Identities = 54/123 (43%), Positives = 80/123 (65%)

Query: 21  TCHWCHVMEVESFEDEGVAKLLNDWFVSIKVDREERPDVDKVYMTYVQALYGGGGWPLSV 80
           TCHWCH+M  ESFEDE VA L+N+ FVSIKVDREERPD+D +YMT  Q + G GGWPL++
Sbjct: 50  TCHWCHMMAHESFEDEEVAGLMNEAFVSIKVDREERPDIDNIYMTVCQIILGRGGWPLNI 109

Query: 81  FLSPDLKPLMGGTYFPPEDKYGRPGFKTILRKVKDAWDKKRDMLAQSGAFAIEQLSEALS 140
            ++P  KP   GTY P   ++ + G   ++ ++K+ W+++ + +  S       + E + 
Sbjct: 110 IMTPGKKPFFAGTYIPKNTRFNQIGMLELVPRIKEIWEQQHEEVLDSAEKITSTIQEMIK 169

Query: 141 ASA 143
            S+
Sbjct: 170 ESS 172

PyMOL of 3ira

>2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} Length = 154	Back alignment and structure

>2gz6_A N-acetyl-D-glucosamine 2-epimerase; anabaena SP. CH1, isomer; 2.00A {Anabaena SP} Length = 388	Back alignment and structure

>3f9u_A Putative exported cytochrome C biogenesis-related; exported cytochrome C biogenesis-related protein, bacteroide fragilis; 2.20A {Bacteroides fragilis nctc 9343} Length = 172	Back alignment and structure

>1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A Length = 164	Back alignment and structure

>3ph9_A Anterior gradient protein 3 homolog; thioredoxin fold, protein disulfide isomerase, endoplasmic R isomerase; 1.83A {Homo sapiens} Length = 151	Back alignment and structure

>3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} Length = 133	Back alignment and structure

>3gt5_A N-acetylglucosamine 2-epimerase; structural genomics, isomerase, PSI-2; 1.70A {Xylella fastidiosa} Length = 402	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} Length = 130	Back alignment and structure

>1fp3_A N-acyl-D-glucosamine 2-epimerase; alpha/alpha-barrel, isomer; 2.00A {Sus scrofa} SCOP: a.102.1.3 Length = 402	Back alignment and structure

>2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A Length = 134	Back alignment and structure

>2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24 Length = 153	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		718
1fp3_A		402	N-acyl-D-glucosamine 2-epimerase; alpha/alpha-barr	100.0
2gz6_A		388	N-acetyl-D-glucosamine 2-epimerase; anabaena SP. C	100.0
2zbl_A		421	Putative isomerase; N-acyl-D-glucosamine 2-epimera	100.0
3ira_A		173	Conserved protein; methanosarcina mazei,structural	100.0
3gt5_A		402	N-acetylglucosamine 2-epimerase; structural genomi	99.93
1fp3_A		402	N-acyl-D-glucosamine 2-epimerase; alpha/alpha-barr	99.91
3gt5_A		402	N-acetylglucosamine 2-epimerase; structural genomi	99.89
2gz6_A		388	N-acetyl-D-glucosamine 2-epimerase; anabaena SP. C	99.88
2zzr_A		397	Unsaturated glucuronyl hydrolase; alpha barrel; 1.	99.88
2zbl_A		421	Putative isomerase; N-acyl-D-glucosamine 2-epimera	99.87
2ahf_A		377	Unsaturated glucuronyl hydrolase; alpha6/alpha6 ba	99.84
2dlx_A		153	UBX domain-containing protein 7; UAS domain, prote	99.77
3k7x_A		349	LIN0763 protein; Q92DQ0, LKR23, NESG, structural g	99.74
3ph9_A		151	Anterior gradient protein 3 homolog; thioredoxin f	99.58
3h7l_A		586	Endoglucanase; dehydrogenase, PSI-2, NYSGXRC, stru	99.55
3f9u_A		172	Putative exported cytochrome C biogenesis-related;	99.45
3k7x_A		349	LIN0763 protein; Q92DQ0, LKR23, NESG, structural g	99.38
3pmm_A		382	Putative cytoplasmic protein; structural genomics,	99.32
2ahf_A		377	Unsaturated glucuronyl hydrolase; alpha6/alpha6 ba	99.26
2zzr_A		397	Unsaturated glucuronyl hydrolase; alpha barrel; 1.	99.23
3k11_A		445	Putative glycosyl hydrolase; structural genomics,	99.23
3fk8_A		133	Disulphide isomerase; APC61824.1, xylella fastidio	99.2
1nc5_A		373	Hypothetical protein YTER; structural genomics, he	99.13
2ju5_A		154	Thioredoxin disulfide isomerase; protein, oxidored	99.13
1nc5_A		373	Hypothetical protein YTER; structural genomics, he	99.11
3pmm_A		382	Putative cytoplasmic protein; structural genomics,	99.09
2kuc_A		130	Putative disulphide-isomerase; structural genomics	99.04
2ec4_A		178	FAS-associated factor 1; UAS domain, protein FAF1,	99.04
3k11_A		445	Putative glycosyl hydrolase; structural genomics,	99.0
2fwh_A		134	Thiol:disulfide interchange protein DSBD; thioredo	98.94
2lst_A		130	Thioredoxin; structural genomics, NEW YORK structu	98.45
3dml_A		116	Putative uncharacterized protein; thioredoxin, oxi	98.66
2l57_A		126	Uncharacterized protein; structural genomics, unkn	98.57
1nsw_A		105	Thioredoxin, TRX; thermostability, electron transp	98.54
3hxs_A		141	Thioredoxin, TRXP; electron transport; 2.00A {Bact	98.53
2l5l_A		136	Thioredoxin; structural genomics, electron transpo	98.52
3tco_A		109	Thioredoxin (TRXA-1); disulfide oxidoreductase, ox	98.52
1ep7_A		112	Thioredoxin CH1, H-type; electron transport; 2.10A	98.52
2trx_A		108	Thioredoxin; electron transport; 1.68A {Escherichi	98.48
1dby_A		107	Chloroplast thioredoxin M CH2; thioredoxin CH2, ch	98.47
2voc_A		112	Thioredoxin; electron transport, homodimer, disulf	98.46
1ti3_A		113	Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul	98.45
3ul3_B		128	Thioredoxin, thioredoxin-2; PTEX, oxidoreductase;	98.44
2i4a_A		107	Thioredoxin; acidophIle, disulfide exchange, oxido	98.44
2yzu_A		109	Thioredoxin; redox protein, electron transport, st	98.42
1oaz_A		123	Thioredoxin 1; immune system, antibody/complex, an	98.42
3f3q_A		109	Thioredoxin-1; His TAG, electron transport, cytopl	98.41
1sen_A		164	Thioredoxin-like protein P19; endoplasmic reticulu	98.41
3gnj_A		111	Thioredoxin domain protein; APC92103, STR genomics	98.41
1fb6_A		105	Thioredoxin M; electron transport; 2.10A {Spinacia	98.39
1xfl_A		124	Thioredoxin H1; AT3G51030, structural genomics, pr	98.38
1w4v_A		119	Thioredoxin, mitochondrial; antioxidant enzyme, mi	98.37
1t00_A		112	Thioredoxin, TRX; redox regulation, multifunction	98.36
3h7l_A		586	Endoglucanase; dehydrogenase, PSI-2, NYSGXRC, stru	98.36
2vlu_A		122	Thioredoxin, thioredoxin H isoform 2.; oxidoreduct	98.36
2dml_A		130	Protein disulfide-isomerase A6; thioredoxin domain	98.35
2vm1_A		118	Thioredoxin, thioredoxin H isoform 1.; oxidoreduct	98.34
2dj1_A		140	Protein disulfide-isomerase A4; protein ERP-72, ER	98.34
3zzx_A		105	Thioredoxin; oxidoreductase; 1.88A {Litopenaeus va	98.32
1thx_A		115	Thioredoxin, thioredoxin 2; oxido-reductase, elect	98.32
2o8v_B		128	Thioredoxin 1; disulfide crosslinked complex, oxid	98.32
2e0q_A		104	Thioredoxin; electron transport; 1.49A {Sulfolobus	98.31
3qfa_C		116	Thioredoxin; protein-protein complex, rossmann fol	98.3
3die_A		106	Thioredoxin, TRX; electron transport, SWAP domain,	98.3
1wmj_A		130	Thioredoxin H-type; structural genomics, program f	98.29
3d22_A		139	TRXH4, thioredoxin H-type; electron transport, cyt	98.28
3hz4_A		140	Thioredoxin; NYSGXRC, PSI-II, reduced form, protei	98.27
3p2a_A		148	Thioredoxin 2, putative thioredoxin-like protein;	98.27
3d6i_A		112	Monothiol glutaredoxin-3; thioredoxin-like, electr	98.27
4euy_A		105	Uncharacterized protein; structural genomics, PSI-	98.26
3aps_A		122	DNAJ homolog subfamily C member 10; thioredoxin fo	98.26
3m9j_A		105	Thioredoxin; oxidoreductase; 1.10A {Homo sapiens}	98.25
2ppt_A		155	Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc	98.23
2i1u_A		121	Thioredoxin, TRX, MPT46; redox protein, electron t	98.22
1x5d_A		133	Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC	98.22
2f51_A		118	Thioredoxin; electron transport; 1.90A {Trichomona	98.22
1gh2_A		107	Thioredoxin-like protein; redox-active center, ele	98.22
2oe3_A		114	Thioredoxin-3; electron transport, alpha/beta sand	98.21
1xwb_A		106	Thioredoxin; dimerization, redox regulation, THI X	98.21
2j23_A		121	Thioredoxin; immune protein, autoreactivity, cross	98.21
1mek_A		120	Protein disulfide isomerase; electron transport, r	98.19
2wz9_A		153	Glutaredoxin-3; protein binding; 1.55A {Homo sapie	98.18
3gix_A		149	Thioredoxin-like protein 4B; PRE-mRNA splicing, TX	98.17
1r26_A		125	Thioredoxin; redox-active disulfide, electron tran	98.15
2av4_A		160	Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI	98.13
2dj3_A		133	Protein disulfide-isomerase A4; protein ERP-72, ER	98.13
3apq_A		210	DNAJ homolog subfamily C member 10; thioredoxin fo	98.12
1syr_A		112	Thioredoxin; SGPP, structural genomics, PSI, prote	98.11
1qgv_A		142	Spliceosomal protein U5-15KD; snRNP, thioredoxin,	98.11
2vim_A		104	Thioredoxin, TRX; thioredoxin fold, oxidoreductase	98.11
2l6c_A		110	Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu	98.1
3qou_A		287	Protein YBBN; thioredoxin-like fold, tetratricopep	98.1
2xc2_A		117	Thioredoxinn; oxidoreductase, protein disulfide re	98.09
1nho_A		85	Probable thioredoxin; beta sheet, alpha helix, oxi	98.03
2pu9_C		111	TRX-F, thioredoxin F-type, chloroplast; protein-pr	98.03
2yj7_A		106	LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti	97.26
2djj_A		121	PDI, protein disulfide-isomerase; thioredoxin fold	98.0
3cxg_A		133	Putative thioredoxin; malaria, structural GEN oxid	97.99
1fo5_A		85	Thioredoxin; disulfide oxidoreductase, structural	97.98
3uvt_A		111	Thioredoxin domain-containing protein 5; thioredox	97.94
1x5e_A		126	Thioredoxin domain containing protein 1; TMX, TXND	97.94
3hcz_A		148	Possible thiol-disulfide isomerase; APC61559.2, cy	97.93
3dxb_A		222	Thioredoxin N-terminally fused to PUF60(UHM); spli	97.93
1faa_A		124	Thioredoxin F; electron transport; 1.85A {Spinacia	97.92
1v98_A		140	Thioredoxin; oxidoreductase, structural genomics,	97.91
1zma_A		118	Bacterocin transport accessory protein; alpha-beta	97.9
2dj0_A		137	Thioredoxin-related transmembrane protein 2; AVLA2	97.88
1ks8_A		433	Endo-B-1,4-glucanase; cellulase, endoglucanase, te	97.86
1z6n_A		167	Hypothetical protein PA1234; alpha-beta-alpha sand	97.83
2lja_A		152	Putative thiol-disulfide oxidoreductase; structura	97.83
3or5_A		165	Thiol:disulfide interchange protein, thioredoxin p	97.82
3gzk_A		537	Cellulase; fold from GH9 from CAZY database, glyco	97.81
2b1k_A		168	Thiol:disulfide interchange protein DSBE; C-termin	97.81
3raz_A		151	Thioredoxin-related protein; structural genomics,	97.8
3h79_A		127	Thioredoxin-like protein; thioredoxin fold, cataly	97.79
2b5x_A		148	YKUV protein, TRXY; thioredoxin-like, oxidoreducta	97.79
3ewl_A		142	Uncharacterized conserved protein BF1870; alpha-be	97.77
1lu4_A		136	Soluble secreted antigen MPT53; thioredoxin-like f	97.77
2f9s_A		151	Thiol-disulfide oxidoreductase RESA; thioredoxin-l	97.77
4evm_A		138	Thioredoxin family protein; structural genomics, n	97.76
3idv_A		241	Protein disulfide-isomerase A4; thioredoxin-like f	97.76
2qgv_A		140	Hydrogenase-1 operon protein HYAE; alpha-beta prot	97.75
3e6u_A		411	LANC-like protein 1; alpha barrel, cytoplasm, sign	97.74
3gl3_A		152	Putative thiol:disulfide interchange protein DSBE;	97.73
1zzo_A		136	RV1677; thioredoxin fold, structural genomics, PSI	97.72
1ia6_A		441	Cellulase CEL9M; cellullase, alpha barrel, hydrola	97.71
1wou_A		123	Thioredoxin -related protein, 14 kDa; electron tra	97.71
3kcm_A		154	Thioredoxin family protein; SGX, thioredoxin prote	97.68
3kh7_A		176	Thiol:disulfide interchange protein DSBE; TRX-like	97.67
1a8l_A		226	Protein disulfide oxidoreductase; PDI, thioredoxin	97.66
1kng_A		156	Thiol:disulfide interchange protein CYCY; thioredo	97.64
2h30_A		164	Thioredoxin, peptide methionine sulfoxide reductas	97.63
1ilo_A		77	Conserved hypothetical protein MTH895; beta-alpha-	97.6
3hdc_A		158	Thioredoxin family protein; ATCC53774, DSM 7210, ,	97.59
2lrn_A		152	Thiol:disulfide interchange protein; structural ge	97.58
3emx_A		135	Thioredoxin; structural genomics, oxidoreductase,	97.57
3erw_A		145	Sporulation thiol-disulfide oxidoreductase A; thio	97.57
1i5g_A		144	Tryparedoxin II; electron transport; HET: TS5; 1.4	97.56
3ha9_A		165	Uncharacterized thioredoxin-like protein; PSI, MCS	97.56
3fkf_A		148	Thiol-disulfide oxidoreductase; structural genomic	97.54
2qsi_A		137	Putative hydrogenase expression/formation protein;	97.5
3idv_A		241	Protein disulfide-isomerase A4; thioredoxin-like f	97.46
2ls5_A		159	Uncharacterized protein; structural genomics, unkn	96.58
1clc_A		639	Endoglucanase CELD; EC: 3.2.1.4; cellulase, glycos	97.45
1o8x_A		146	Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot	97.43
3eyt_A		158	Uncharacterized protein SPOA0173; thioredoxin-like	97.43
1o73_A		144	Tryparedoxin; electron transport, trypanosomatid,	97.4
2es7_A		142	Q8ZP25_salty, putative thiol-disulfide isomerase a	97.38
1tf4_A		605	T. fusca endo/EXO-cellulase E4 catalytic domain an	97.35
3eur_A		142	Uncharacterized protein; PSI2,MCSG, conserved prot	97.34
3lor_A		160	Thiol-disulfide isomerase and thioredoxins; PSI, M	97.33
3lwa_A		183	Secreted thiol-disulfide isomerase; thioredoxin, P	97.32
3s9f_A		165	Tryparedoxin; thioredoxin fold, disulfide reductas	97.31
1ttz_A		87	Conserved hypothetical protein; structural genomic	97.31
2e7p_A		116	Glutaredoxin; thioredoxin fold, poplar, electron t	97.31
3q6o_A		244	Sulfhydryl oxidase 1; protein disulfide isomerase,	97.3
3kp8_A		106	Vkorc1/thioredoxin domain protein; blood coagulati	97.27
1g87_A		614	Endocellulase 9G; endoglucanase, cellulose binding	97.25
2dbc_A		135	PDCL2, unnamed protein product; phosducin-like pro	97.24
2l5o_A		153	Putative thioredoxin; structural genomics, unknown	97.24
2ywm_A		229	Glutaredoxin-like protein; redox protein, structur	97.18
3f8u_A		481	Protein disulfide-isomerase A3ERP57; endoplasmic r	97.17
3ia1_A		154	THIO-disulfide isomerase/thioredoxin; oxidoreducta	97.15
2xfg_A		466	Endoglucanase 1; hydrolase-sugar binding protein c	97.15
2r2j_A		382	Thioredoxin domain-containing protein 4; CRFS moti	97.14
1jfu_A		186	Thiol:disulfide interchange protein TLPA; thioredo	97.14
1sji_A		350	Calsequestrin 2, calsequestrin, cardiac muscle iso	97.06
2k8s_A		80	Thioredoxin; dimer, structural genomics, PSI-2, pr	97.03
2lus_A		143	Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carci	96.07
3fw2_A		150	Thiol-disulfide oxidoreductase; structural genomic	96.99
2b5e_A		504	Protein disulfide-isomerase; 2.40A {Saccharomyces	96.97
3ga4_A		178	Dolichyl-diphosphooligosaccharide-protein glycosyl	96.93
4fo5_A		143	Thioredoxin-like protein; AHPC/TSA family protein,	96.92
2lrt_A		152	Uncharacterized protein; structural genomics, thio	96.86
2hze_A		114	Glutaredoxin-1; thioredoxin fold, arsenic, dimethy	96.79
2yik_A		611	Endoglucanase; hydrolase; 2.10A {Clostridium therm	96.76
2cvb_A		188	Probable thiol-disulfide isomerase/thioredoxin; re	96.73
2v8i_A		543	Pectate lyase; periplasm, beta-elimination, pectin	96.69
2ht9_A		146	Glutaredoxin-2; thioredoxin fold, iron-sulfur clus	96.68
3t58_A		519	Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.	96.68
2djk_A		133	PDI, protein disulfide-isomerase; thioredoxin fold	96.66
3ed3_A		298	Protein disulfide-isomerase MPD1; thioredoxin-like	96.59
3iv4_A		112	Putative oxidoreductase; APC23140, meticillin-resi	96.59
2b5e_A		504	Protein disulfide-isomerase; 2.40A {Saccharomyces	96.56
3f8u_A		481	Protein disulfide-isomerase A3ERP57; endoplasmic r	96.53
2cq9_A		130	GLRX2 protein, glutaredoxin 2; glutathione-S-trans	96.52
2ywi_A		196	Hypothetical conserved protein; uncharacterized co	96.51
2hyx_A		352	Protein DIPZ; thioredoxin fold, jelly-roll, struct	96.5
2hls_A		243	Protein disulfide oxidoreductase; thioredoxin fold	96.5
3qcp_A		470	QSOX from trypanosoma brucei (tbqsox); ERV fold, t	96.43
1kte_A		105	Thioltransferase; redox-active center, electron tr	96.39
3apo_A		780	DNAJ homolog subfamily C member 10; PDI family, th	96.35
2rli_A		171	SCO2 protein homolog, mitochondrial; copper protei	96.29
2c0g_A		248	ERP29 homolog, windbeutel protein; PDI-dbeta, PDI,	96.28
2fgx_A		107	Putative thioredoxin; NET3, NESG, GFT-glutaredoxin	96.25
2vup_A		190	Glutathione peroxidase-like protein; oxidoreductas	96.23
1a0r_P		245	Phosducin, MEKA, PP33; transducin, beta-gamma, sig	96.22
2p5q_A		170	Glutathione peroxidase 5; thioredoxin fold, oxidor	96.18
1a8l_A		226	Protein disulfide oxidoreductase; PDI, thioredoxin	96.14
2ywm_A		229	Glutaredoxin-like protein; redox protein, structur	96.14
3cmi_A		171	Peroxiredoxin HYR1; thioredoxin-like fold, oxidore	96.12
2ri9_A		475	Mannosyl-oligosaccharide alpha-1,2-mannosidase; al	96.09
3rhb_A		113	ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox	96.09
3uem_A		361	Protein disulfide-isomerase; thioredoxin-like doma	96.07
3apo_A		780	DNAJ homolog subfamily C member 10; PDI family, th	96.07
2ggt_A		164	SCO1 protein homolog, mitochondrial; copper chaper	96.06
3c1r_A		118	Glutaredoxin-1; oxidized form, oxidoreductase, cyt	96.02
2lqo_A		92	Putative glutaredoxin RV3198.1/MT3292; TRX fold, o	96.0
3us3_A		367	Calsequestrin-1; calcium-binding protein; 1.74A {O	95.92
1hyu_A		521	AHPF, alkyl hydroperoxide reductase subunit F; thi	95.83
3e6u_A		411	LANC-like protein 1; alpha barrel, cytoplasm, sign	95.81
3h8q_A		114	Thioredoxin reductase 3; oxidoreductase, structura	95.8
1x9d_A		538	Endoplasmic reticulum mannosyl-oligosaccharide 1,	95.79
1hcu_A		503	Alpha-1,2-mannosidase; glycosylation, glycosyl hyd	95.76
3kp9_A		291	Vkorc1/thioredoxin domain protein; warfarin, disul	95.66
1ia6_A		441	Cellulase CEL9M; cellullase, alpha barrel, hydrola	95.57
2trc_P		217	Phosducin, MEKA, PP33; transducin, beta-gamma, sig	95.53
1wjk_A		100	C330018D20RIK protein; glutaredoxin, thioredoxin f	95.49
1nxc_A		478	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA;	95.45
2yan_A		105	Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H	95.39
3u5r_E		218	Uncharacterized protein; structural genomics, PSI-	95.33
2k6v_A		172	Putative cytochrome C oxidase assembly protein; th	95.31
3nzn_A		103	Glutaredoxin; structural genomics, PSI2, MCSG, pro	95.21
1h75_A		81	Glutaredoxin-like protein NRDH; electron transport	95.02
3drn_A		161	Peroxiredoxin, bacterioferritin comigratory prote	94.94
1dl2_A		511	Class I alpha-1,2-mannosidase; alpha-alpha helix b	94.9
3dwv_A		187	Glutathione peroxidase-like protein; alpha beta, 3	94.83
3msz_A		89	Glutaredoxin 1; alpha-beta sandwich, center for st	94.65
1x9d_A		538	Endoplasmic reticulum mannosyl-oligosaccharide 1,	94.63
1eej_A		216	Thiol:disulfide interchange protein; oxidoreductas	94.63
3evi_A		118	Phosducin-like protein 2; alpha beta, 3-layer(ABA)	94.61
1fov_A		82	Glutaredoxin 3, GRX3; active site disulfide, CIS P	94.58
1xvq_A		175	Thiol peroxidase; thioredoxin fold, structural gen	94.54
1ks8_A		433	Endo-B-1,4-glucanase; cellulase, endoglucanase, te	94.51
1ego_A		85	Glutaredoxin; electron transport; NMR {Escherichia	94.49
4hde_A		170	SCO1/SENC family lipoprotein; structural genomics,	94.39
2v8i_A		543	Pectate lyase; periplasm, beta-elimination, pectin	94.38
2obi_A		183	PHGPX, GPX-4, phospholipid hydroperoxide glutathio	94.36
1nxc_A		478	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA;	94.36
2qc7_A		240	ERP31, ERP28, endoplasmic reticulum protein ERP29;	94.36
1xvw_A		160	Hypothetical protein RV2238C/MT2298; thioredoxin f	94.27
2bmx_A		195	Alkyl hydroperoxidase C; peroxiredoxin, antioxidan	94.25
3l4n_A		127	Monothiol glutaredoxin-6; C-terminal domain of GRX	94.24
1t3b_A		211	Thiol:disulfide interchange protein DSBC; oxidored	94.24
3ctg_A		129	Glutaredoxin-2; reduced form, electron transport,	94.2
2f8a_A		208	Glutathione peroxidase 1; thioredoxin fold, struct	94.14
3qmx_A		99	Glutaredoxin A, glutaredoxin 3; electron transport	94.06
3gyk_A		175	27KDA outer membrane protein; APC61738.2, siliciba	93.97
1dl2_A		511	Class I alpha-1,2-mannosidase; alpha-alpha helix b	93.94
1hcu_A		503	Alpha-1,2-mannosidase; glycosylation, glycosyl hyd	93.84
2g0d_A		409	Nisin biosynthesis protein NISC; alpha toroid, alp	93.81
1r7h_A		75	NRDH-redoxin; thioredoxin, glutaredoxin, redox pro	93.78
3kij_A		180	Probable glutathione peroxidase 8; human PDI-perox	93.77
1zye_A		220	Thioredoxin-dependent peroxide reductase; catenane	93.61
3hd5_A		195	Thiol:disulfide interchange protein DSBA; protein	93.54
3ic4_A		92	Glutaredoxin (GRX-1); structural genomics, PSI, MC	93.52
1wik_A		109	Thioredoxin-like protein 2; picot homology 2 domai	93.51
4gqc_A		164	Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, f	93.5
1xzo_A		174	BSSCO, hypothetical protein YPMQ; thioredoxin-like	93.46
2ri9_A		475	Mannosyl-oligosaccharide alpha-1,2-mannosidase; al	93.42
1v58_A		241	Thiol:disulfide interchange protein DSBG; reduced	93.22
2g0d_A		409	Nisin biosynthesis protein NISC; alpha toroid, alp	93.2
1we0_A		187	Alkyl hydroperoxide reductase C; peroxiredoxin, AH	93.13
1uul_A		202	Tryparedoxin peroxidase homologue; peroxiredoxin,	93.1
2h01_A		192	2-Cys peroxiredoxin; thioredoxin peroxidase, struc	93.06
3h93_A		192	Thiol:disulfide interchange protein DSBA; disulfid	93.03
2klx_A		89	Glutaredoxin; thioredoxin type domain, ssgcid, ele	92.98
2v1m_A		169	Glutathione peroxidase; selenium, selenocysteine,	92.87
1w6k_A		732	Lanosterol synthase; cyclase, cholesterol, monotop	92.76
2khp_A		92	Glutaredoxin; thioredoxin type domain, ssgcid, ele	92.58
1zof_A		198	Alkyl hydroperoxide-reductase; decamer, toroide-sh	92.48
1qmv_A		197	Human thioredoxin peroxidase-B; peroxiredoxin, sul	92.25
3ipz_A		109	Monothiol glutaredoxin-S14, chloroplastic; electro	92.21
2i81_A		213	2-Cys peroxiredoxin; structural genomics consortiu	92.1
2hls_A		243	Protein disulfide oxidoreductase; thioredoxin fold	91.58
2wci_A		135	Glutaredoxin-4; redox-active center, iron-sulfur c	91.54
3ztl_A		222	Thioredoxin peroxidase; oxidoreductase, reductase,	91.31
1ut9_A		609	Cellulose 1,4-beta-cellobiosidase; hydrolase, glyc	91.24
2p31_A		181	CL683, glutathione peroxidase 7; thioredoxin fold,	91.24
2jsy_A		167	Probable thiol peroxidase; solution structure, ant	91.23
2wem_A		118	Glutaredoxin-related protein 5; chromosome 14 open	91.1
3gkn_A		163	Bacterioferritin comigratory protein; BCP, PRX, at	91.08
3zyw_A		111	Glutaredoxin-3; metal binding protein; 1.84A {Homo	90.81
2gs3_A		185	PHGPX, GPX-4, phospholipid hydroperoxide glutathio	90.49
3gx8_A		121	Monothiol glutaredoxin-5, mitochondrial; TRX fold,	90.32
3a2v_A		249	Probable peroxiredoxin; thioredoxin peroxidase, hy	90.19
2b7k_A		200	SCO1 protein; metallochaperone, cytochrome C oxida	89.54
1wzz_A		334	Probable endoglucanase; glycoside hydrolase family	88.96
1aba_A		87	Glutaredoxin; electron transport; HET: MES; 1.45A	88.88
3me7_A		170	Putative uncharacterized protein; electron transfe	88.33
3gzk_A		537	Cellulase; fold from GH9 from CAZY database, glyco	88.29
3hz8_A		193	Thiol:disulfide interchange protein DSBA; thiol-ox	87.54
2sqc_A		631	Squalene-hopene cyclase; isomerase, triterpene cyc	87.5
2c0d_A		221	Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, th	87.42
3p7x_A		166	Probable thiol peroxidase; thioredoxin fold, oxido	87.36
2rem_A		193	Disulfide oxidoreductase; disulfide oxidoreductase	86.37
4g2e_A		157	Peroxiredoxin; redox protein, structural genomics,	85.91
3ixr_A		179	Bacterioferritin comigratory protein; alpha beta p	85.17
3gv1_A		147	Disulfide interchange protein; neisseria gonorrhoe	84.83
1t1v_A		93	SH3BGRL3, SH3 domain-binding glutamic acid-rich pr	84.81
2znm_A		195	Thiol:disulfide interchange protein DSBA; thioredo	84.69
2i3y_A		215	Epididymal secretory glutathione peroxidase; thior	83.95
2r37_A		207	Glutathione peroxidase 3; plasma, structural genom	83.9
2a4v_A		159	Peroxiredoxin DOT5; yeast nuclear thiol peroxidase	83.32
2ct6_A		111	SH3 domain-binding glutamic acid-rich-like protein	82.29
2wul_A		118	Glutaredoxin related protein 5; chromosome 14 open	81.94
1nm3_A		241	Protein HI0572; hybrid, peroxiredoxin, glutaredoxi	81.93
3keb_A		224	Probable thiol peroxidase; structural genomics, AP	81.81
1clc_A		639	Endoglucanase CELD; EC: 3.2.1.4; cellulase, glycos	81.59
1psq_A		163	Probable thiol peroxidase; structural genomics, NY	80.34
1gxm_A		332	Pectate lyase; mechanism, elimination; 1.32A {Cell	80.09

>1fp3_A N-acyl-D-glucosamine 2-epimerase; alpha/alpha-barrel, isomer; 2.00A {Sus scrofa} SCOP: a.102.1.3	Back alignment and structure

Probab=100.00  E-value=2.4e-35  Score=325.43  Aligned_cols=336  Identities=10%  Similarity=-0.026  Sum_probs=251.8

Q ss_pred             HHHHHHHHH-hcccccCCCCCC------CCCCCChhHHHH----HHHhhhhhcccCCCCCCHHHHHHHHHHHHHHHhCCC
Q 005023          157 LRLCAEQLS-KSYDSRFGGFGS------APKFPRPVEIQM----MLYHSKKLEDTGKSGEASEGQKMVLFTLQCMAKGGI  225 (718)
Q Consensus       157 ~~~~~~~l~-~~~D~~~GGfg~------apKFP~~~~l~~----Ll~~~~~~~~~~~~~~~~~~~~~~~~TL~~m~~gGi  225 (718)
                      ++.++.+|. ..+|+++|||++      .|| |.+..+.+    |+.++....... ..+++..+++|.+|++.|.+++ 
T Consensus        19 ~~~~l~~w~~~~~D~~~GGf~~~~~~dg~~~-~~~k~l~~nar~l~~~a~a~~~~~-~~~~~~~l~~A~~~~~fl~~~~-   95 (402)
T 1fp3_A           19 LDRVMAFWLEHSHDREHGGFFTCLGRDGRVY-DDLKYVWLQGRQVWMYCRLYRKLE-RFHRPELLDAAKAGGEFLLRHA-   95 (402)
T ss_dssp             HHHHHHHHHHHSBCTTTSSBCCCBCTTSCBS-CCCEEHHHHHHHHHHHHHHHHHCG-GGCCHHHHHHHHHHHHHHHHHT-
T ss_pred             HHHHHHHhhccCCCCCCCCEeeEECCCCCCC-CCccchhhhHHHHHHHHHHHHHhc-ccCCHHHHHHHHHHHHHHHHhc-
Confidence            467788898 799999999976      788 76654544    555543221100 0135899999999999999966 


Q ss_pred             cccCCC-cEEEEecCCCCCCCCCcchHHHHHHHHHHHHHHHHccCChHHHHHHHHHHHHHHHhcc-CCCCceeeeccCCc
Q 005023          226 HDHVGG-GFHRYSVDERWHVPHFEKMLYDQGQLANVYLDAFSLTKDVFYSYICRDILDYLRRDMI-GPGGEIFSAEDADS  303 (718)
Q Consensus       226 ~D~v~G-GF~RYsvD~~W~vPHFEKmLyDnA~ll~~ya~Ay~~t~~~~y~~~A~~~~~~l~~~m~-~p~Ggf~sa~DADs  303 (718)
                      +|+.|| ||| ||+|.+|.+||++|||||||+++.+|+++|++|+++.|++.|+++++++++++. +++| +|++.|++.
T Consensus        96 ~d~~gg~g~~-~s~d~dg~~~~~~~~lyd~af~~~a~~~~~~atgd~~~~~~A~~l~~~~~~~~~d~~~G-~f~~~~~~~  173 (402)
T 1fp3_A           96 RVAPPEKKCA-FVLTRDGRPVKVQRSIFSECFYTMAMNELWRVTAEARYQSEAVDMMDQIVHWVREDPSG-LGRPQLPGA  173 (402)
T ss_dssp             BSSTTSCCBC-SEECTTSCEEECCSSSHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHTCGGG-GCCCCCTTS
T ss_pred             cCcCCCCceE-EEECCCCCccccccchHHHHHHHHHHHHHHHHhCCHHHHHHHHHHHHHHHHHhccCCCc-ccCccccCc
Confidence            999988 999 899999999999999999999999999999999999999999999999999998 6655 567666542


Q ss_pred             ccccCcccccCCceEeechHHHHHHhchhHHHHHH---HhcccCCCCcCCCCCCCCCCccCCcceeeccCCchHHHHhcC
Q 005023          304 AETEGATRKKEGAFYVWTSKEVEDILGEHAILFKE---HYYLKPTGNCDLSRMSDPHNEFKGKNVLIELNDSSASASKLG  380 (718)
Q Consensus       304 ~~~~~~~~~~EG~yY~Wt~~Ei~~~L~~~~~~~~~---~~~v~~~Gn~~~~~~~dp~~~~eg~nvL~~~~~~~~~a~~~g  380 (718)
                      .+       .+|.    +      ..-.....+.+   .+.+++++                                  
T Consensus       174 ~~-------~~~~----~------~~m~~~~~~l~l~~l~~~~~~~----------------------------------  202 (402)
T 1fp3_A          174 VA-------SESM----A------VPMMLLCLVEQLGEEDEELAGR----------------------------------  202 (402)
T ss_dssp             CC-------EEET----H------HHHHHHHHHHHHHTTCHHHHHH----------------------------------
T ss_pred             cC-------CCCc----c------hHHHHHHHHHHHHHHHHhcCcH----------------------------------
Confidence            11       0000    0      00001112222   22222110                                  


Q ss_pred             CCHHHHHHHHHHHHHHHHhhhccCCCCCCCchhhhch----HH--------H---HHHHHHHHHHHhhhhhhhhcccCCC
Q 005023          381 MPLEKYLNILGECRRKLFDVRSKRPRPHLDDKVIVSW----NG--------L---VISSFARASKILKSEAESAMFNFPV  445 (718)
Q Consensus       381 ~~~~~~~~~l~~~r~~L~~~R~~R~~P~~Ddkilt~W----Ng--------l---~I~ALa~A~~~~~d~~~~~~~~~~~  445 (718)
                       -.+.+++.++.++++ ++.|.+|..+++|.    +|    |.        .   ..+.|+++++++++           
T Consensus       203 -~~~~a~~~~~~~~~~-~~~~~~~~~e~~d~----dw~~~~~~~g~~~~pgh~ie~~wlL~~a~~~~~~-----------  265 (402)
T 1fp3_A          203 -YAQLGHWCARRILQH-VQRDGQAVLENVSE----DGEELSGCLGRHQNPGHALEAGWFLLRHSSRSGD-----------  265 (402)
T ss_dssp             -THHHHHHHHHHHHTT-EETTTTEECSEEET----TSCBCCHHHHHEECHHHHHHHHHHHHHHHHHTTC-----------
T ss_pred             -HHHHHHHHHHHHHHH-hCcCCCeEEEEECC----CCCccCCCCCCCCCCCcHHHHHHHHHHHHHHcCC-----------
Confidence             024566777888888 88899999999885    36    22        1   34489999999998           


Q ss_pred             CCCChHHHHHHHHHHHHHH-HHhccccCCCeEEEe-ecCCCCC-----CCCCcccHHHHHHHHHHHHHHcCChHHHHHHH
Q 005023          446 VGSDRKEYMEVAESAASFI-RRHLYDEQTHRLQHS-FRNGPSK-----APGFLDDYAFLISGLLDLYEFGSGTKWLVWAI  518 (718)
Q Consensus       446 ~~~~~~~~l~~A~~~~~~l-~~~~~d~~~g~l~~~-~~~g~~~-----~~~~l~DyA~li~all~LYeaTgd~~~L~~A~  518 (718)
                           ++|++.|+++++++ .+++|+++.|+++++ +.+|.+.     ....++.+|.+|.|++.||++|||++||++|.
T Consensus       266 -----~~~l~~A~~~~~~~~~~~~~d~~~gg~~~~~~~~g~~~~~l~d~~~~~W~qaea~~a~l~ly~~tgd~~yl~~a~  340 (402)
T 1fp3_A          266 -----AKLRAHVIDTFLLLPFRSGWDADHGGLFYFQDADGLCPTQLEWAMKLWWPHSEAMIAFLMGYSESGDPALLRLFY  340 (402)
T ss_dssp             -----HHHHHHHHHHHTHHHHHHHBCTTTCSBCSCEETTSCCCSSTTTTCEEHHHHHHHHHHHHHHHHHHCCHHHHHHHH
T ss_pred             -----hHHHHHHHHHHHHHHHHHhccCCCCCEEEeecCCCCccccCcCCCcCcHHHHHHHHHHHHHHHHhCCHHHHHHHH
Confidence                 89999999999999 999999765667665 6777752     22334455688999999999999999999999


Q ss_pred             HHHHHHHHhcccccCCccccCCCCCCccccccccCCCCCCCChHHHHHHHHHH
Q 005023          519 ELQNTQDELFLDREGGGYFNTTGEDPSVLLRVKEDHDGAEPSGNSVSVINLVR  571 (718)
Q Consensus       519 ~L~~~~~~~F~D~~~Gg~f~t~~~~~~l~~r~k~~~D~a~PS~ns~~a~~Llr  571 (718)
                      ++++.+.++|+|+++|+||++...+..+....|. .-+.+|.+|..|+..+++
T Consensus       341 ~~~~~~~~~f~D~~~G~w~~~~~~~g~~~~~~k~-~~~k~~yH~~r~~~~~~~  392 (402)
T 1fp3_A          341 QVAEYTFRQFRDPEYGEWFGYLNREGKVALTIKG-GPFKGCFHVPRCLAMCEE  392 (402)
T ss_dssp             HHHHHHHHHTBCTTTSSBCCEECTTSCEEECCSS-CSSCCSSHHHHHHHHHHH
T ss_pred             HHHHHHHHhCcCCCCCceEeeECCCcCCCCCCCC-CCCCCCCccHHHHHHHHH
Confidence            9999999999999999999987766655544333 356789999987765543

PyMOL of 1fp3

>2gz6_A N-acetyl-D-glucosamine 2-epimerase; anabaena SP. CH1, isomer; 2.00A {Anabaena SP}	Back alignment and structure

>2zbl_A Putative isomerase; N-acyl-D-glucosamine 2-epimerase protein family; HET: BMA; 1.60A {Salmonella typhimurium} PDB: 2afa_A 2rgk_A*	Back alignment and structure

>3ira_A Conserved protein; methanosarcina mazei,structural genomics, MCSG, protein structure initiative, midwest center for STRU genomics; 2.10A {Methanosarcina mazei}	Back alignment and structure

>3gt5_A N-acetylglucosamine 2-epimerase; structural genomics, isomerase, PSI-2; 1.70A {Xylella fastidiosa}	Back alignment and structure

>1fp3_A N-acyl-D-glucosamine 2-epimerase; alpha/alpha-barrel, isomer; 2.00A {Sus scrofa} SCOP: a.102.1.3	Back alignment and structure

>3gt5_A N-acetylglucosamine 2-epimerase; structural genomics, isomerase, PSI-2; 1.70A {Xylella fastidiosa}	Back alignment and structure

>2gz6_A N-acetyl-D-glucosamine 2-epimerase; anabaena SP. CH1, isomer; 2.00A {Anabaena SP}	Back alignment and structure

>2zzr_A Unsaturated glucuronyl hydrolase; alpha barrel; 1.75A {Streptococcus agalactiae} PDB: 3anj_A 3ank_A* 3ani_A*	Back alignment and structure

>2zbl_A Putative isomerase; N-acyl-D-glucosamine 2-epimerase protein family; HET: BMA; 1.60A {Salmonella typhimurium} PDB: 2afa_A 2rgk_A*	Back alignment and structure

>2ahf_A Unsaturated glucuronyl hydrolase; alpha6/alpha6 barrel, glycoside hydrolase family 88; 1.52A {Bacillus SP} PDB: 2ahg_A* 2fv0_A* 2fv1_A* 2d5j_A 1vd5_A 2fuz_A	Back alignment and structure

>2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24	Back alignment and structure

>3k7x_A LIN0763 protein; Q92DQ0, LKR23, NESG, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.89A {Listeria innocua}	Back alignment and structure

>3ph9_A Anterior gradient protein 3 homolog; thioredoxin fold, protein disulfide isomerase, endoplasmic R isomerase; 1.83A {Homo sapiens} SCOP: c.47.1.0 PDB: 2lns_A 2lnt_A	Back alignment and structure

>3h7l_A Endoglucanase; dehydrogenase, PSI-2, NYSGXRC, structural GEN protein structure initiative; 2.30A {Vibrio parahaemolyticus}	Back alignment and structure

>3f9u_A Putative exported cytochrome C biogenesis-related; exported cytochrome C biogenesis-related protein, bacteroide fragilis; 2.20A {Bacteroides fragilis nctc 9343}	Back alignment and structure

>3k7x_A LIN0763 protein; Q92DQ0, LKR23, NESG, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.89A {Listeria innocua}	Back alignment and structure

>3pmm_A Putative cytoplasmic protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 1.90A {Klebsiella pneumoniae subsp} PDB: 3qwt_A	Back alignment and structure

>2ahf_A Unsaturated glucuronyl hydrolase; alpha6/alpha6 barrel, glycoside hydrolase family 88; 1.52A {Bacillus SP} PDB: 2ahg_A* 2fv0_A* 2fv1_A* 2d5j_A 1vd5_A 2fuz_A	Back alignment and structure

>2zzr_A Unsaturated glucuronyl hydrolase; alpha barrel; 1.75A {Streptococcus agalactiae} PDB: 3anj_A 3ank_A* 3ani_A*	Back alignment and structure

>3k11_A Putative glycosyl hydrolase; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MSE MES; 1.80A {Bacteroides thetaiotaomicron vpi-5482}	Back alignment and structure

>3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa}	Back alignment and structure

>1nc5_A Hypothetical protein YTER; structural genomics, helix barrel, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Bacillus subtilis} SCOP: a.102.1.6 PDB: 2d8l_A* 2gh4_A*	Back alignment and structure

>2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae}	Back alignment and structure

>1nc5_A Hypothetical protein YTER; structural genomics, helix barrel, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Bacillus subtilis} SCOP: a.102.1.6 PDB: 2d8l_A* 2gh4_A*	Back alignment and structure

>3pmm_A Putative cytoplasmic protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 1.90A {Klebsiella pneumoniae subsp} PDB: 3qwt_A	Back alignment and structure

>2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron}	Back alignment and structure

>2ec4_A FAS-associated factor 1; UAS domain, protein FAF1, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3k11_A Putative glycosyl hydrolase; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MSE MES; 1.80A {Bacteroides thetaiotaomicron vpi-5482}	Back alignment and structure

>2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A	Back alignment and structure

>2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus}	Back alignment and structure

>3dml_A Putative uncharacterized protein; thioredoxin, oxidoreductase, sulfur oxidation, thiol- disulfide oxidoreductase; HET: MSE; 1.90A {Paracoccus denitrificans} PDB: 3d4t_A*	Back alignment and structure

>2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens}	Back alignment and structure

>1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A	Back alignment and structure

>3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A	Back alignment and structure

>2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus}	Back alignment and structure

>3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0	Back alignment and structure

>1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A	Back alignment and structure

>2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ...	Back alignment and structure

>1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1	Back alignment and structure

>2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A	Back alignment and structure

>1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1	Back alignment and structure

>3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum}	Back alignment and structure

>2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti}	Back alignment and structure

>2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A	Back alignment and structure

>1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1	Back alignment and structure

>3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B	Back alignment and structure

>1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A	Back alignment and structure

>3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0	Back alignment and structure

>1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C	Back alignment and structure

>1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1	Back alignment and structure

>1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A	Back alignment and structure

>1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor}	Back alignment and structure

>3h7l_A Endoglucanase; dehydrogenase, PSI-2, NYSGXRC, structural GEN protein structure initiative; 2.30A {Vibrio parahaemolyticus}	Back alignment and structure

>2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A*	Back alignment and structure

>2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A	Back alignment and structure

>2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>3zzx_A Thioredoxin; oxidoreductase; 1.88A {Litopenaeus vannamei}	Back alignment and structure

>1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1	Back alignment and structure

>2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli}	Back alignment and structure

>2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A	Back alignment and structure

>3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C*	Back alignment and structure

>3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A	Back alignment and structure

>1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa}	Back alignment and structure

>3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A	Back alignment and structure

>3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei}	Back alignment and structure

>3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis}	Back alignment and structure

>3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae}	Back alignment and structure

>4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus}	Back alignment and structure

>3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus}	Back alignment and structure

>3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ...	Back alignment and structure

>2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus}	Back alignment and structure

>2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A	Back alignment and structure

>1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis}	Back alignment and structure

>1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1	Back alignment and structure

>2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A	Back alignment and structure

>1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A	Back alignment and structure

>2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis}	Back alignment and structure

>1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2	Back alignment and structure

>2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A	Back alignment and structure

>3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} SCOP: c.47.1.0 PDB: 1xbs_A	Back alignment and structure

>1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1	Back alignment and structure

>2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii}	Back alignment and structure

>2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus}	Back alignment and structure

>1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1	Back alignment and structure

>1qgv_A Spliceosomal protein U5-15KD; snRNP, thioredoxin, transcription; 1.40A {Homo sapiens} SCOP: c.47.1.8 PDB: 1syx_A 1pqn_A	Back alignment and structure

>2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica}	Back alignment and structure

>2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A	Back alignment and structure

>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A*	Back alignment and structure

>2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A	Back alignment and structure

>1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1	Back alignment and structure

>2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A	Back alignment and structure

>2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct}	Back alignment and structure

>2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A	Back alignment and structure

>3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum}	Back alignment and structure

>1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1	Back alignment and structure

>3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A	Back alignment and structure

>1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii}	Back alignment and structure

>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157}	Back alignment and structure

>1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1	Back alignment and structure

>1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus}	Back alignment and structure

>1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1	Back alignment and structure

>2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1ks8_A Endo-B-1,4-glucanase; cellulase, endoglucanase, termite, glycosyl hydrolase, family 9, (alpha/alpha)6; 1.40A {Nasutitermes takasagoensis} SCOP: a.102.1.2 PDB: 1ksc_A 1ksd_A	Back alignment and structure

>1z6n_A Hypothetical protein PA1234; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.47.1.1 PDB: 3lef_A	Back alignment and structure

>2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus}	Back alignment and structure

>3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} SCOP: c.47.1.0	Back alignment and structure

>3gzk_A Cellulase; fold from GH9 from CAZY database, glycosidase, hydrolase; 1.80A {Alicyclobacillus acidocaldarius subsp} PDB: 3ez8_A 3h2w_A* 3h3k_A* 3rx5_A* 3rx7_A* 3rx8_A*	Back alignment and structure

>2b1k_A Thiol:disulfide interchange protein DSBE; C-terminal thioredoxin-like domain, N-terminal beta-sheet, fingerprint rigion, oxidoreductase; 1.90A {Escherichia coli} PDB: 3k8n_A 2g0f_A 1z5y_E 2b1l_A	Back alignment and structure

>3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B}	Back alignment and structure

>3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} SCOP: c.47.1.0	Back alignment and structure

>2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A	Back alignment and structure

>3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis}	Back alignment and structure

>1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10	Back alignment and structure

>2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A	Back alignment and structure

>4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae}	Back alignment and structure

>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A	Back alignment and structure

>2qgv_A Hydrogenase-1 operon protein HYAE; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Shigella flexneri 2A} PDB: 2hfd_A	Back alignment and structure

>3e6u_A LANC-like protein 1; alpha barrel, cytoplasm, signaling protein; 2.60A {Homo sapiens} PDB: 3e73_A*	Back alignment and structure

>3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls}	Back alignment and structure

>1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A	Back alignment and structure

>1ia6_A Cellulase CEL9M; cellullase, alpha barrel, hydrolase; 1.80A {Clostridium cellulolyticum} SCOP: a.102.1.2 PDB: 1ia7_A*	Back alignment and structure

>1wou_A Thioredoxin -related protein, 14 kDa; electron transport; 1.80A {Homo sapiens} SCOP: c.47.1.16 PDB: 1v9w_A	Back alignment and structure

>3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15}	Back alignment and structure

>3kh7_A Thiol:disulfide interchange protein DSBE; TRX-like, thiol-disulfide exchange, cell inner membrane, CYT C-type biogenesis, disulfide bond; 1.75A {Pseudomonas aeruginosa} PDB: 3kh9_A	Back alignment and structure

>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A	Back alignment and structure

>1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10	Back alignment and structure

>2h30_A Thioredoxin, peptide methionine sulfoxide reductase MSRA/MSRB; reduced, thiol-disulfide exchange, oxidoreductase; 1.60A {Neisseria gonorrhoeae} PDB: 2jzr_A 2jzs_A 2k9f_A 2fy6_A	Back alignment and structure

>1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1	Back alignment and structure

>3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15}	Back alignment and structure

>2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP}	Back alignment and structure

>3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix}	Back alignment and structure

>3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} SCOP: c.47.1.0	Back alignment and structure

>1i5g_A Tryparedoxin II; electron transport; HET: TS5; 1.40A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1o6j_A 1o81_A 1oc8_A 1oc9_B 1fg4_A 1oc9_A	Back alignment and structure

>3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix}	Back alignment and structure

>3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis}	Back alignment and structure

>2qsi_A Putative hydrogenase expression/formation protein; HUPG, MCS SAD, structural genomics, protein structure initiative; 1.80A {Rhodopseudomonas palustris}	Back alignment and structure

>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A	Back alignment and structure

>2ls5_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, NEW structural genomics research consortium; NMR {Bacteroides thetaiotaomicron}	Back alignment and structure

>1clc_A Endoglucanase CELD; EC: 3.2.1.4; cellulase, glycosyl hydrolase; 1.90A {Clostridium thermocellum} SCOP: a.102.1.2 b.1.18.2	Back alignment and structure

>1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A	Back alignment and structure

>3eyt_A Uncharacterized protein SPOA0173; thioredoxin-like superfamily protein SPOA0173, silicibacter DSS, structural genomics, PSI-2; 1.95A {Silicibacter pomeroyi}	Back alignment and structure

>1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10	Back alignment and structure

>2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A	Back alignment and structure

>1tf4_A T. fusca endo/EXO-cellulase E4 catalytic domain and cellulose-binding domain; glycosyl hydrolase, cellulose degradation; 1.90A {Thermobifida fusca} SCOP: a.102.1.2 b.2.2.2 PDB: 1js4_A 3tf4_A* 4tf4_A*	Back alignment and structure

>3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis}	Back alignment and structure

>3lor_A Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, structural genomics, midwest CE structural genomics; HET: MSE; 2.20A {Corynebacterium glutamicum}	Back alignment and structure

>3lwa_A Secreted thiol-disulfide isomerase; thioredoxin, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.75A {Corynebacterium glutamicum}	Back alignment and structure

>3s9f_A Tryparedoxin; thioredoxin fold, disulfide reductase, electron transport; 1.80A {Leishmania major}	Back alignment and structure

>1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A	Back alignment and structure

>2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A	Back alignment and structure

>3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens}	Back alignment and structure

>3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP}	Back alignment and structure

>1g87_A Endocellulase 9G; endoglucanase, cellulose binding domain, (ALPH 6-helix barrel, beta barrel, hydrolase; 1.60A {Clostridium cellulolyticum} SCOP: a.102.1.2 b.2.2.2 PDB: 1ga2_A* 1k72_A* 1kfg_A*	Back alignment and structure

>2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B}	Back alignment and structure

>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A	Back alignment and structure

>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A	Back alignment and structure

>3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus}	Back alignment and structure

>2xfg_A Endoglucanase 1; hydrolase-sugar binding protein complex, family-9 glycoside hydrolase, hydrolase, sugar binding protein; 1.68A {Clostridium thermocellum}	Back alignment and structure

>2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens}	Back alignment and structure

>1jfu_A Thiol:disulfide interchange protein TLPA; thioredoxin-like, double disulfide bridge, membrane protein; 1.60A {Bradyrhizobium japonicum} SCOP: c.47.1.10	Back alignment and structure

>1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A	Back alignment and structure

>2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea}	Back alignment and structure

>2lus_A Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carcinoscorpius rotundicauda}	Back alignment and structure

>3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, thiol-disulfide oxidoreduct TLPA-like family, PSI-2; 1.74A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A	Back alignment and structure

>3ga4_A Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit OST6; oxidoreductase, active site loop, redox state, membrane; HET: PG4; 1.30A {Saccharomyces cerevisiae} PDB: 3g7y_A 3g9b_A*	Back alignment and structure

>4fo5_A Thioredoxin-like protein; AHPC/TSA family protein, structural genomics, joint center F structural genomics, JCSG; 2.02A {Parabacteroides distasonis}	Back alignment and structure

>2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus}	Back alignment and structure

>2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B	Back alignment and structure

>2yik_A Endoglucanase; hydrolase; 2.10A {Clostridium thermocellum}	Back alignment and structure

>2cvb_A Probable thiol-disulfide isomerase/thioredoxin; redox protein, structural genomics, riken struc genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.47.1.10 PDB: 2ywo_A	Back alignment and structure

>2v8i_A Pectate lyase; periplasm, beta-elimination, pectin degradation; 1.50A {Yersinia enterocolitica} PDB: 2v8k_A* 2v8j_A	Back alignment and structure

>2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A*	Back alignment and structure

>3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A*	Back alignment and structure

>2djk_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp2_A	Back alignment and structure

>3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae}	Back alignment and structure

>3iv4_A Putative oxidoreductase; APC23140, meticillin-resistant staphylococcus aureus, oxidor thioredoxin fold, structural genomics, PSI-2; HET: MSE; 1.50A {Staphylococcus aureus subsp}	Back alignment and structure

>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A	Back alignment and structure

>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A	Back alignment and structure

>2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ywi_A Hypothetical conserved protein; uncharacterized conserved protein, NPPSFA, national project protein structural and functional analyses; 1.60A {Geobacillus kaustophilus}	Back alignment and structure

>2hyx_A Protein DIPZ; thioredoxin fold, jelly-roll, structural genomics, TB struct genomics consortium, TBSGC, unknown function; 1.90A {Mycobacterium tuberculosis}	Back alignment and structure

>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix}	Back alignment and structure

>3qcp_A QSOX from trypanosoma brucei (tbqsox); ERV fold, thioredoxin fold, sulfhydryl oxidase, oxidoreducta; HET: FAD; 2.30A {Trypanosoma brucei} PDB: 3qd9_A*	Back alignment and structure

>1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A*	Back alignment and structure

>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus}	Back alignment and structure

>2rli_A SCO2 protein homolog, mitochondrial; copper protein, thioredoxin fold, metal transport, structural genomics, spine2-complexes; NMR {Homo sapiens}	Back alignment and structure

>2c0g_A ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, protein disulfide isomerase, PIPE, dorsal-ventral patterning, chaperone, WIND mutants; 1.75A {Drosophila melanogaster} SCOP: a.71.1.1 c.47.1.7 PDB: 1ovn_A 2c0f_A 2c1y_A 2c0e_A	Back alignment and structure

>2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea}	Back alignment and structure

>2vup_A Glutathione peroxidase-like protein; oxidoreductase, trypanothione, dithiol-dependant peroxidase; 2.10A {Trypanosoma brucei}	Back alignment and structure

>1a0r_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; HET: FAR; 2.80A {Bos taurus} SCOP: c.47.1.6 PDB: 1b9y_C 1b9x_C	Back alignment and structure

>2p5q_A Glutathione peroxidase 5; thioredoxin fold, oxidoreductase; 2.00A {Populus trichocarpa x populusdeltoides} PDB: 2p5r_A	Back alignment and structure

>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A	Back alignment and structure

>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A	Back alignment and structure

>3cmi_A Peroxiredoxin HYR1; thioredoxin-like fold, oxidoreductase, peroxidase, redox-ACT center; 2.02A {Saccharomyces cerevisiae}	Back alignment and structure

>2ri9_A Mannosyl-oligosaccharide alpha-1,2-mannosidase; alternative conformations, modulation of activity, glycoprot glycosidase, hydrolase; HET: NAG NDG MAN MMA; 1.95A {Penicillium citrinum} SCOP: a.102.2.1 PDB: 2ri8_A* 1kkt_A* 1kre_A* 1krf_A*	Back alignment and structure

>3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A*	Back alignment and structure

>3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A	Back alignment and structure

>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus}	Back alignment and structure

>2ggt_A SCO1 protein homolog, mitochondrial; copper chaperone, Cu-binding protein, mitochondrial assembly factor, redox, nickel, disuplhide, mitochondrion; 2.40A {Homo sapiens} SCOP: c.47.1.10 PDB: 2gqk_A 2gql_A 2gqm_A 2gt5_A 2gt6_A 2gvp_A 2hrf_A 2hrn_A 1wp0_A	Back alignment and structure

>3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A*	Back alignment and structure

>2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis}	Back alignment and structure

>3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3v1w_A* 3trq_A* 3trp_A* 3uom_A	Back alignment and structure

>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A	Back alignment and structure

>3e6u_A LANC-like protein 1; alpha barrel, cytoplasm, signaling protein; 2.60A {Homo sapiens} PDB: 3e73_A*	Back alignment and structure

>3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0	Back alignment and structure

>1x9d_A Endoplasmic reticulum mannosyl-oligosaccharide 1, 2-alpha-mannosidase; substrate analogue, glycosyl hydrolase; HET: SMD; 1.41A {Homo sapiens} SCOP: a.102.2.1 PDB: 1fo3_A* 1fo2_A* 1fmi_A	Back alignment and structure

>1hcu_A Alpha-1,2-mannosidase; glycosylation, glycosyl hydrolase; HET: NAG; 2.37A {Trichoderma reesei} SCOP: a.102.2.1	Back alignment and structure

>3kp9_A Vkorc1/thioredoxin domain protein; warfarin, disulfide formation, blood coagulation, oxidoreduc blood coagulation,oxidoreductase; HET: U10; 3.60A {Synechococcus SP}	Back alignment and structure

>1ia6_A Cellulase CEL9M; cellullase, alpha barrel, hydrolase; 1.80A {Clostridium cellulolyticum} SCOP: a.102.1.2 PDB: 1ia7_A*	Back alignment and structure

>2trc_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; 2.40A {Rattus norvegicus} SCOP: c.47.1.6	Back alignment and structure

>1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1	Back alignment and structure

>1nxc_A Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA; glycosidase, structural genomics, PSI, protein initiative; HET: NAG BMA MAN; 1.51A {Mus musculus} SCOP: a.102.2.1	Back alignment and structure

>2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens}	Back alignment and structure

>3u5r_E Uncharacterized protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, hypothetical protein; 2.05A {Sinorhizobium meliloti}	Back alignment and structure

>2k6v_A Putative cytochrome C oxidase assembly protein; thioredoxin fold, electron transfer protein, metal binding protein, electron transport; NMR {Thermus thermophilus}	Back alignment and structure

>3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei}	Back alignment and structure

>1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1	Back alignment and structure

>3drn_A Peroxiredoxin, bacterioferritin comigratory prote homolog; bacterioferritin comigratory protein, oxidore; HET: CIT; 2.15A {Sulfolobus solfataricus} SCOP: c.47.1.0	Back alignment and structure

>1dl2_A Class I alpha-1,2-mannosidase; alpha-alpha helix barrel, hydrolase; HET: NAG NDG BMA MAN; 1.54A {Saccharomyces cerevisiae} SCOP: a.102.2.1 PDB: 1g6i_A*	Back alignment and structure

>3dwv_A Glutathione peroxidase-like protein; alpha beta, 3-layer(ABA) sandwich, glutaredoxin fold, oxidor peroxidase; 1.41A {Trypanosoma brucei} PDB: 2rm5_A 2rm6_A 3e0u_A	Back alignment and structure

>3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A*	Back alignment and structure

>1x9d_A Endoplasmic reticulum mannosyl-oligosaccharide 1, 2-alpha-mannosidase; substrate analogue, glycosyl hydrolase; HET: SMD; 1.41A {Homo sapiens} SCOP: a.102.2.1 PDB: 1fo3_A* 1fo2_A* 1fmi_A	Back alignment and structure

>1eej_A Thiol:disulfide interchange protein; oxidoreductase, protein disulfide isomerase, protein folding, redox protein, redox-active center; HET: MES; 1.90A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1tjd_A 1jzd_A 1jzo_A 1g0t_A 2iyj_A	Back alignment and structure

>3evi_A Phosducin-like protein 2; alpha beta, 3-layer(ABA) sandwich, unknown function; 2.70A {Homo sapiens}	Back alignment and structure

>1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A*	Back alignment and structure

>1xvq_A Thiol peroxidase; thioredoxin fold, structural genomics, PSI, protein structur initiative, TB structural genomics consortium, TBSGC; 1.75A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1y25_A	Back alignment and structure

>1ks8_A Endo-B-1,4-glucanase; cellulase, endoglucanase, termite, glycosyl hydrolase, family 9, (alpha/alpha)6; 1.40A {Nasutitermes takasagoensis} SCOP: a.102.1.2 PDB: 1ksc_A 1ksd_A	Back alignment and structure

>1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A	Back alignment and structure

>4hde_A SCO1/SENC family lipoprotein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; HET: MSE; 1.32A {Bacillus anthracis}	Back alignment and structure

>2v8i_A Pectate lyase; periplasm, beta-elimination, pectin degradation; 1.50A {Yersinia enterocolitica} PDB: 2v8k_A* 2v8j_A	Back alignment and structure

>2obi_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase (GPX4); human GPX4, selenoprotein, thioredoxin-fold, anti-oxidatve defense system; 1.55A {Homo sapiens}	Back alignment and structure

>1nxc_A Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA; glycosidase, structural genomics, PSI, protein initiative; HET: NAG BMA MAN; 1.51A {Mus musculus} SCOP: a.102.2.1	Back alignment and structure

>2qc7_A ERP31, ERP28, endoplasmic reticulum protein ERP29; B domain (residues 33-153), D domain (residues 154-261), CHA; 2.90A {Homo sapiens} PDB: 1g7e_A 1g7d_A	Back alignment and structure

>1xvw_A Hypothetical protein RV2238C/MT2298; thioredoxin fold, oxidized cystein sulfenic acid, structural genomics, PSI; 1.90A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1xxu_A	Back alignment and structure

>2bmx_A Alkyl hydroperoxidase C; peroxiredoxin, antioxidant defense system, oxidoreductase, structural proteomics in EURO spine; 2.4A {Mycobacterium tuberculosis} SCOP: c.47.1.10	Back alignment and structure

>3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae}	Back alignment and structure

>1t3b_A Thiol:disulfide interchange protein DSBC; oxidoreductase, protein disulfide isomerase, protein folding, redox protein; 2.50A {Haemophilus influenzae} SCOP: c.47.1.9 d.17.3.1	Back alignment and structure

>3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A*	Back alignment and structure

>2f8a_A Glutathione peroxidase 1; thioredoxin fold, structural genomics, structural genomics consortium, SGC, oxidoreductase; 1.50A {Homo sapiens} SCOP: c.47.1.10 PDB: 1gp1_A 2he3_A	Back alignment and structure

>3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0	Back alignment and structure

>3gyk_A 27KDA outer membrane protein; APC61738.2, silicibacter pomeroyi DSS-3, thioredoxin-like, oxidoreductase, structural genomics, PSI-2; HET: MSE; 1.76A {Silicibacter pomeroyi}	Back alignment and structure

>1dl2_A Class I alpha-1,2-mannosidase; alpha-alpha helix barrel, hydrolase; HET: NAG NDG BMA MAN; 1.54A {Saccharomyces cerevisiae} SCOP: a.102.2.1 PDB: 1g6i_A*	Back alignment and structure

>1hcu_A Alpha-1,2-mannosidase; glycosylation, glycosyl hydrolase; HET: NAG; 2.37A {Trichoderma reesei} SCOP: a.102.2.1	Back alignment and structure

>2g0d_A Nisin biosynthesis protein NISC; alpha toroid, alpha barrel, biosynthetic protein; 2.21A {Lactococcus lactis subsp} SCOP: a.102.6.1 PDB: 2g02_A	Back alignment and structure

>1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1	Back alignment and structure

>3kij_A Probable glutathione peroxidase 8; human PDI-peroxidase, membrane, oxidoreductase, transmembrane; 1.80A {Homo sapiens} SCOP: c.47.1.0 PDB: 3cyn_A	Back alignment and structure

>1zye_A Thioredoxin-dependent peroxide reductase; catenane, dodecamer, peroxiredoxin, oxidoreductase; 3.30A {Bos taurus} SCOP: c.47.1.10	Back alignment and structure

>3hd5_A Thiol:disulfide interchange protein DSBA; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.35A {Bordetella parapertussis}	Back alignment and structure

>3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus}	Back alignment and structure

>1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1	Back alignment and structure

>4gqc_A Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, fully folded, locally unfolded, peroxide, DTT, structural genomics, riken; 2.00A {Aeropyrum pernix} PDB: 2cx3_A 2cx4_A 4gqf_A	Back alignment and structure

>1xzo_A BSSCO, hypothetical protein YPMQ; thioredoxin-like fold, structural genomics, montreal-kingsto bacterial structural genomics initiative, BSGI; 1.70A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1on4_A	Back alignment and structure

>2ri9_A Mannosyl-oligosaccharide alpha-1,2-mannosidase; alternative conformations, modulation of activity, glycoprot glycosidase, hydrolase; HET: NAG NDG MAN MMA; 1.95A {Penicillium citrinum} SCOP: a.102.2.1 PDB: 2ri8_A* 1kkt_A* 1kre_A* 1krf_A*	Back alignment and structure

>1v58_A Thiol:disulfide interchange protein DSBG; reduced DSBG, redox protein, protein disulfide isomerase, thioredoxin fold; 1.70A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1v57_A 2h0i_A 2h0h_A 2h0g_A 2iy2_A	Back alignment and structure

>2g0d_A Nisin biosynthesis protein NISC; alpha toroid, alpha barrel, biosynthetic protein; 2.21A {Lactococcus lactis subsp} SCOP: a.102.6.1 PDB: 2g02_A	Back alignment and structure

>1we0_A Alkyl hydroperoxide reductase C; peroxiredoxin, AHPC, oxidoreductase; 2.90A {Amphibacillus xylanus} SCOP: c.47.1.10	Back alignment and structure

>1uul_A Tryparedoxin peroxidase homologue; peroxiredoxin, oxidoreductase; 2.8A {Trypanosoma cruzi} SCOP: c.47.1.10	Back alignment and structure

>2h01_A 2-Cys peroxiredoxin; thioredoxin peroxidase, structural genomics, SGC, structural genomics consortium, oxidoreductase; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10	Back alignment and structure

>3h93_A Thiol:disulfide interchange protein DSBA; disulfide bond, redox-active center, transcription regulator; HET: MSE GOL; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: c.47.1.0	Back alignment and structure

>2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae}	Back alignment and structure

>2v1m_A Glutathione peroxidase; selenium, selenocysteine, oxidoreductase, lipid peroxidase, schistosoma detoxification pathway; 1.00A {Schistosoma mansoni} PDB: 2wgr_A	Back alignment and structure

>1w6k_A Lanosterol synthase; cyclase, cholesterol, monotopic membrane protein, B-octyl-glucoside, isomerase, steroid biosynthesis; HET: BOG LAN; 2.1A {Homo sapiens} SCOP: a.102.4.2 a.102.4.2 PDB: 1w6j_A*	Back alignment and structure

>2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis}	Back alignment and structure

>1zof_A Alkyl hydroperoxide-reductase; decamer, toroide-shaped complex, oxidoreductase; 2.95A {Helicobacter pylori} SCOP: c.47.1.10	Back alignment and structure

>1qmv_A Human thioredoxin peroxidase-B; peroxiredoxin, sulphinic acid; 1.7A {Homo sapiens} SCOP: c.47.1.10 PDB: 1qq2_A 2z9s_A 2rii_A 3hy2_A*	Back alignment and structure

>3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A	Back alignment and structure

>2i81_A 2-Cys peroxiredoxin; structural genomics consortium, SGC, oxidoreductase; 2.45A {Plasmodium vivax sai-1} PDB: 2h66_A	Back alignment and structure

>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix}	Back alignment and structure

>2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A	Back alignment and structure

>3ztl_A Thioredoxin peroxidase; oxidoreductase, reductase, schistosomiasis, thioredoxin fold; 3.00A {Schistosoma mansoni} PDB: 3zvj_A 3zvj_D	Back alignment and structure

>1ut9_A Cellulose 1,4-beta-cellobiosidase; hydrolase, glycoside hydrolase, family 9, cellobiohydrolase; 2.1A {Clostridium thermocellum} SCOP: a.102.1.2 b.1.18.2 PDB: 1rq5_A*	Back alignment and structure

>2p31_A CL683, glutathione peroxidase 7; thioredoxin fold, NPGPX, phospholipid hydroperoxidase, struc genomics, structural genomics consortium, SGC; 2.00A {Homo sapiens}	Back alignment and structure

>2jsy_A Probable thiol peroxidase; solution structure, antioxidant, oxidoreductase; NMR {Bacillus subtilis} PDB: 2jsz_A	Back alignment and structure

>3gkn_A Bacterioferritin comigratory protein; BCP, PRX, atypical 2-Cys, oxidoreduc; HET: BIH; 1.47A {Xanthomonas campestris PV} PDB: 3gkk_A 3gkm_A	Back alignment and structure

>3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens}	Back alignment and structure

>2gs3_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase; GSHPX-4,phospholipid hydroperoxide; 1.90A {Homo sapiens}	Back alignment and structure

>3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae}	Back alignment and structure

>3a2v_A Probable peroxiredoxin; thioredoxin peroxidase, hydrogen peroxide, antioxidant, oxidoreductase, redox-active center; 1.65A {Aeropyrum pernix} PDB: 1x0r_A 2zct_A 2nvl_A 2e2g_A 2cv4_A* 3a5w_A 2e2m_A 3a2x_A 3a2w_A	Back alignment and structure

>2b7k_A SCO1 protein; metallochaperone, cytochrome C oxidase, metal binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 PDB: 2b7j_A	Back alignment and structure

>1wzz_A Probable endoglucanase; glycoside hydrolase family 8 (GH-8), (alpha/alpha)6 barrel, structural genomics; 1.65A {Gluconacetobacter xylinus} SCOP: a.102.1.2	Back alignment and structure

>1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A	Back alignment and structure

>3me7_A Putative uncharacterized protein; electron transfer protein, electron transport, structural GE PSI-2, protein structure initiative; 1.50A {Aquifex aeolicus} PDB: 3me8_A	Back alignment and structure

>3gzk_A Cellulase; fold from GH9 from CAZY database, glycosidase, hydrolase; 1.80A {Alicyclobacillus acidocaldarius subsp} PDB: 3ez8_A 3h2w_A* 3h3k_A* 3rx5_A* 3rx7_A* 3rx8_A*	Back alignment and structure

>3hz8_A Thiol:disulfide interchange protein DSBA; thiol-oxidoreductase, disulfide bond; 1.45A {Neisseria meningitidis MC58} PDB: 3dvw_A 3a3t_A	Back alignment and structure

>2sqc_A Squalene-hopene cyclase; isomerase, triterpene cyclase, monotopic membrane protein, QW-sequence, repeat; HET: C8E; 2.00A {Alicyclobacillus acidocaldarius} SCOP: a.102.4.2 a.102.4.2 PDB: 3sqc_A 1ump_A* 1h35_A* 1h36_A* 1h37_A* 1h39_A* 1h3a_A* 1h3b_A* 1h3c_A* 1o6h_A* 1o6q_A* 1gsz_A* 1o79_A* 1sqc_A* 1o6r_A*	Back alignment and structure

>2c0d_A Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, thioredoxin dependant, mitochondrial, antioxidant, oxidoreductase, redox-active center; 1.78A {Plasmodium falciparum}	Back alignment and structure

>3p7x_A Probable thiol peroxidase; thioredoxin fold, oxidoreductase; HET: PG4; 1.96A {Staphylococcus aureus} SCOP: c.47.1.0	Back alignment and structure

>2rem_A Disulfide oxidoreductase; disulfide oxidoreductase, DSBA, thioredoxin fold, redox- active center; 1.90A {Xylella fastidiosa}	Back alignment and structure

>4g2e_A Peroxiredoxin; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 1.40A {Sulfolobus tokodaii} PDB: 2ywn_A 3hjp_A	Back alignment and structure

>3ixr_A Bacterioferritin comigratory protein; alpha beta protein, oxidoreductase; 1.60A {Xylella fastidiosa}	Back alignment and structure

>3gv1_A Disulfide interchange protein; neisseria gonorrhoeae (strain 700825 / FA 1090), DSBC, structural genomics, unknown funct 2; 2.00A {Neisseria gonorrhoeae}	Back alignment and structure

>1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A	Back alignment and structure

>2znm_A Thiol:disulfide interchange protein DSBA; thioredoxin fold, DSBA-like, oxidoreductase; 2.30A {Neisseria meningitidis serogroup B} PDB: 3dvx_A	Back alignment and structure

>2i3y_A Epididymal secretory glutathione peroxidase; thioredoxin fold, epididymal androgen related protein, struc genomics, structural genomics consortium; 2.00A {Homo sapiens}	Back alignment and structure

>2r37_A Glutathione peroxidase 3; plasma, structural genomics consort oxidoreductase, secreted, selenium, selenocysteine; 1.85A {Homo sapiens}	Back alignment and structure

>2a4v_A Peroxiredoxin DOT5; yeast nuclear thiol peroxidase, atypical 2-Cys peroxiredoxin, oxidoreductase; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10	Back alignment and structure

>2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2wul_A Glutaredoxin related protein 5; chromosome 14 open reading frame 87, oxidoreductase, thiored family, GLRX5, FLB4739; HET: GSH; 2.40A {Homo sapiens}	Back alignment and structure

>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10	Back alignment and structure

>3keb_A Probable thiol peroxidase; structural genomics, APC40679, PSI-2, Pro structure initiative; HET: MSE; 1.80A {Chromobacterium violaceum}	Back alignment and structure

>1clc_A Endoglucanase CELD; EC: 3.2.1.4; cellulase, glycosyl hydrolase; 1.90A {Clostridium thermocellum} SCOP: a.102.1.2 b.1.18.2	Back alignment and structure

>1psq_A Probable thiol peroxidase; structural genomics, NYSGXRC, PSI, structure initiative, NEW YORK SGX research center for STRU genomics; 2.30A {Streptococcus pneumoniae} SCOP: c.47.1.10	Back alignment and structure

>1gxm_A Pectate lyase; mechanism, elimination; 1.32A {Cellvibrio cellulosa} SCOP: a.102.5.1 PDB: 1gxn_A 1gxo_A*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		718
d1fp3a_		402	a.102.1.3 (A:) N-acyl-D-glucosamine 2-epimerase {P	2e-32
d2afaa1		411	a.102.1.3 (A:4-415) Putative NAG isomerase YihS {S	4e-17
d1sena_		135	c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19	4e-10

>d1fp3a_ a.102.1.3 (A:) N-acyl-D-glucosamine 2-epimerase {Pig (Sus scrofa) [TaxId: 9823]} Length = 402	Back information, alignment and structure


class: All alpha proteins
fold: alpha/alpha toroid
superfamily: Six-hairpin glycosidases
family: N-acylglucosamine (NAG) epimerase
domain: N-acyl-D-glucosamine 2-epimerase
species: Pig (Sus scrofa) [TaxId: 9823]

 Score =  128 bits (321), Expect = 2e-32
 Identities = 44/403 (10%), Positives = 93/403 (23%), Gaps = 71/403 (17%)

Query: 164 LSKSYDSRFGGF-------GSAPKFPRPVEIQM-MLYHSKKLEDTGKSGEASEGQKMVLF 215
           L  S+D   GGF       G      + V +Q   ++   +L    +     E       
Sbjct: 27  LEHSHDREHGGFFTCLGRDGRVYDDLKYVWLQGRQVWMYCRLYRKLERFHRPELLDAAKA 86

Query: 216 TLQCMAKGGIHDHVGGGFHRYSVDERWHVPHFEKMLYDQGQLANVYLDAFSLTKDVFYSY 275
             + + +             + +         ++ ++ +        + + +T +  Y  
Sbjct: 87  GGEFLLRHARVAPPEKKCA-FVLTRDGRPVKVQRSIFSECFYTMAMNELWRVTAEARYQS 145

Query: 276 ICRDILDYLRRDMIGPGGEIFSAEDADSAETEGATRKKEGAFYVWTSKEVEDILGEHAIL 335
              D++D +   +      +   +   +          E          + + LGE    
Sbjct: 146 EAVDMMDQIVHWVREDPSGLGRPQLPGA-------VASESMAVPMMLLCLVEQLGEEDEE 198

Query: 336 FKEHYYLKPTGNCDLSRMSDPHNEFKGKNVLIELNDSSASASKLGMPLEKYLNILGECRR 395
               Y     G+    R+                                          
Sbjct: 199 LAGRY--AQLGHWCARRILQHVQRDGQ-------------------------------AV 225

Query: 396 KLFDVRSKRPRPHLDDKVIVSWNGLVISSFARASKILKSEAESAMFNFPVVGSDRKEYME 455
                           +     + L    F              +        D K    
Sbjct: 226 LENVSEDGEELSGCLGRHQNPGHALEAGWF--------------LLRHSSRSGDAKLRAH 271

Query: 456 VAESAASFIRRHLYDEQTHRLQHSFRNGPSKAPGFLDD-------YAFLISGLLDLYEFG 508
           V ++      R  +D   H     F++     P  L+        ++  +   L  Y   
Sbjct: 272 VIDTFLLLPFRSGWDAD-HGGLFYFQDADGLCPTQLEWAMKLWWPHSEAMIAFLMGYSES 330

Query: 509 SGTKWLVWAIELQNTQDELFLDREGGGYFNTTGEDPSVLLRVK 551
                L    ++       F D E G +F     +  V L +K
Sbjct: 331 GDPALLRLFYQVAEYTFRQFRDPEYGEWFGYLNREGKVALTIK 373

PyMOL of d1fp3a_

>d2afaa1 a.102.1.3 (A:4-415) Putative NAG isomerase YihS {Salmonella typhimurium [TaxId: 90371]} Length = 411	Back information, alignment and structure

>d1sena_ c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 {Human (Homo sapiens) [TaxId: 9606]} Length = 135	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		718
d1fp3a_		402	N-acyl-D-glucosamine 2-epimerase {Pig (Sus scrofa)	100.0
d2afaa1		411	Putative NAG isomerase YihS {Salmonella typhimuriu	99.94
d2afaa1		411	Putative NAG isomerase YihS {Salmonella typhimuriu	99.83
d2dlxa1		147	UBX domain-containing protein 7 {Human (Homo sapie	99.67
d1fp3a_		402	N-acyl-D-glucosamine 2-epimerase {Pig (Sus scrofa)	99.66
d1sena_		135	Thioredoxin-like protein p19, TLP19 {Human (Homo s	99.6
d2fwha1		117	Thiol:disulfide interchange protein DsbD, C-termin	99.33
d2d5ja1		377	Unsaturated glucuronyl hydrolase {Bacillus sp. GL1	99.25
d1nc5a_		363	Hypothetical protein YteR {Bacillus subtilis [TaxI	98.77
d1ep7a_		112	Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305	98.68
d1dbya_		107	Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305	98.57
d1xfla_		114	Thioredoxin {Thale cress (Arabidopsis thaliana) [T	98.57
d2d5ja1		377	Unsaturated glucuronyl hydrolase {Bacillus sp. GL1	98.56
d1nw2a_		105	Thioredoxin {Alicyclobacillus acidocaldarius, form	98.53
d2trxa_		108	Thioredoxin {Escherichia coli [TaxId: 562]}	98.5
d1qgva_		137	spliceosomal protein U5-15Kd {Human (Homo sapiens)	98.46
d1ti3a_		113	Thioredoxin {European aspen (Populus tremula), thi	98.43
d1thxa_		108	Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]}	98.42
d1a8la2		107	Protein disulfide isomerase, PDI {Archaeon Pyrococ	98.4
d1fb6a_		104	Thioredoxin {Spinach (Spinacia oleracea), thioredo	98.33
d1xwaa_		111	Thioredoxin {Fruit fly (Drosophila melanogaster) [	98.21
d2ifqa1		105	Thioredoxin {Human (Homo sapiens) [TaxId: 9606]}	98.2
d1fo5a_		85	MJ0307, thioredoxin/glutaredoxin-like protein {Arc	98.09
d1syra_		103	Thioredoxin {Malarial parasite (Plasmodium falcipa	98.07
d1nc5a_		363	Hypothetical protein YteR {Bacillus subtilis [TaxI	98.04
d1z5ye1		136	Thioredoxin-like protein CcmG (CycY, DsbE) {Escher	98.02
d1meka_		120	Protein disulfide isomerase, PDI {Human (Homo sapi	97.99
d1r26a_		113	Thioredoxin {Trypanosoma brucei [TaxId: 5691]}	97.98
d2b5ea4		119	Protein disulfide isomerase, PDI {Baker's yeast (S	97.9
d1nhoa_		85	MTH807, thioredoxin/glutaredoxin-like protein {Arc	97.88
d1hyua4		96	Alkyl hydroperoxide reductase subunit F (AhpF), N-	97.86
d1zmaa1		115	Bacterocin transport accessory protein Bta {Strept	97.86
d1ia6a_		431	Nonprocessive cellulase Cel9M {Clostridium cellulo	97.81
d1ks8a_		433	Endo-b-1,4-glucanase {Termite (Nasutitermes takasa	97.77
d1f9ma_		112	Thioredoxin {Spinach (Spinacia oleracea), thioredo	97.76
d1woua_		119	Putative 42-9-9 protein (thioredoxin containing pr	97.76
d1gh2a_		107	Thioredoxin-like protein, N-terminal domain {Human	97.74
d1g87a1		454	Endo/exocellulase:cellobiose E-4, N-terminal domai	97.73
d1clca1		441	CelD cellulase, C-terminal domain {Clostridium the	97.49
d2es7a1		119	Hydrogenase-1 operon protein HyaE {Salmonella typh	97.48
d1ut9a1		511	Cellulose 1,4-beta-cellobiosidase CbhA {Clostridiu	97.38
d1lu4a_		134	Soluble secreted antigen MPT53 {Mycobacterium tube	97.27
d1knga_		144	Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyr	97.26
d2hfda1		132	Hydrogenase-1 operon protein HyaE {Escherichia col	97.23
d2fy6a1		143	Peptide methionine sulfoxide reductase MsrA/MsrB,	97.16
d1tf4a1		460	Endo/exocellulase:cellobiose E-4, N-terminal domai	97.06
d1o73a_		144	Tryparedoxin I {Trypanosoma brucei brucei [TaxId:	96.96
d2b5xa1		143	thiol:disulfide oxidoreductase YkuV {Bacillus subt	96.91
d1jfua_		176	Membrane-anchored thioredoxin-like protein TlpA, s	96.9
d1st9a_		137	Thiol-disulfide oxidoreductase ResA {Bacillus subt	96.82
d1zzoa1		134	Lipoprotein DsbF {Mycobacterium tuberculosis [TaxI	96.81
d1o8xa_		144	Tryparedoxin I {Crithidia fasciculata [TaxId: 5656	96.78
d2djja1		116	Protein disulfide isomerase, PDI {Fungi (Humicola	96.53
d1nxca_		467	Class I alpha-1;2-mannosidase, catalytic domain {M	96.39
d1a8ya1		124	Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax	96.23
d1nxca_		467	Class I alpha-1;2-mannosidase, catalytic domain {M	96.13
d1wjka_		100	Thioredoxin-like structure containing protein C330	96.0
d1hcua_		488	Class I alpha-1;2-mannosidase, catalytic domain {T	95.93
d1x9da1		453	Class I alpha-1;2-mannosidase, catalytic domain {H	95.83
d1x9da1		453	Class I alpha-1;2-mannosidase, catalytic domain {H	95.69
d2cvba1		187	Probable thiol-disulfide isomerase/thioredoxin TTH	95.62
d1dl2a_		511	Class I alpha-1;2-mannosidase, catalytic domain {B	95.55
d1i5ga_		144	Tryparedoxin II {Crithidia fasciculata [TaxId: 565	95.53
d1ia6a_		431	Nonprocessive cellulase Cel9M {Clostridium cellulo	95.49
d1dl2a_		511	Class I alpha-1;2-mannosidase, catalytic domain {B	95.42
d2ri9a1		475	Class I alpha-1;2-mannosidase, catalytic domain {F	95.3
d2g0da1		409	Nisin biosynthesis protein NisC {Lactococcus lacti	95.28
d2c0ga2		122	Windbeutel, N-terminal domain {Fruit fly (Drosophi	94.93
d1w6ka1		448	Lanosterol synthase {Human (Homo sapiens) [TaxId:	94.9
d2b5ea1		140	Protein disulfide isomerase, PDI {Baker's yeast (S	94.62
d1ks8a_		433	Endo-b-1,4-glucanase {Termite (Nasutitermes takasa	94.45
d2sqca1		352	Squalene-hopene cyclase {Alicyclobacillus acidocal	94.44
d1ut9a1		511	Cellulose 1,4-beta-cellobiosidase CbhA {Clostridiu	94.23
d1t3ba1		150	Disulfide bond isomerase, DsbC, C-terminal domain	93.97
d1h75a_		76	Glutaredoxin-like NRDH-redoxin {Escherichia coli [	93.93
d1r7ha_		74	Glutaredoxin-like NRDH-redoxin {Corynebacterium am	93.8
d1eeja1		156	Disulfide bond isomerase, DsbC, C-terminal domain	93.6
d1z6na1		166	Hypothetical protein PA1234 {Pseudomonas aeruginos	93.56
d2ri9a1		475	Class I alpha-1;2-mannosidase, catalytic domain {F	93.26
d2cx4a1		160	Bacterioferritin comigratory protein {Archaeon Aer	92.87
d1hcua_		488	Class I alpha-1;2-mannosidase, catalytic domain {T	91.46
d1fova_		82	Glutaredoxin (Grx, thioltransferase) {Escherichia	91.31
d1xzoa1		172	Thioredoxin-like protein Sco1 (YpmQ), soluble doma	91.21
d1nm3a1		74	C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus	90.3
d1wzza1		319	Probable endoglucanase CmcAX {Acetobacter xylinus	90.17
d1ktea_		105	Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr	89.39
d2bmxa1		169	Alkyl hydroperoxide reductase AhpC {Mycobacterium	86.65
d1wika_		109	Thioredoxin-like protein 2 {Mouse (Mus musculus) [	85.35
d1g7ea_		122	Endoplasmic reticulum protein ERP29, N-terminal do	85.19
d1clca1		441	CelD cellulase, C-terminal domain {Clostridium the	85.19
d1ttza_		75	Hypothetical protein XCC2852 {Xanthomonas campestr	84.2
d2trcp_		217	Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]}	83.71
d2p7vb1		68	Sigma70 (SigA, RpoD) {Escherichia coli [TaxId: 562	83.45
d1egoa_		85	Glutaredoxin (Grx, thioltransferase) {Escherichia	83.05
d2b7ka1		169	Thioredoxin-like protein Sco1 (YpmQ), soluble doma	82.63
d2sqca1		352	Squalene-hopene cyclase {Alicyclobacillus acidocal	80.81
d1w6ka1		448	Lanosterol synthase {Human (Homo sapiens) [TaxId:	80.19
d1gxma_		324	Polygalacturonic acid lyase (pectate lyase) {Cellv	80.18

>d1fp3a_ a.102.1.3 (A:) N-acyl-D-glucosamine 2-epimerase {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

class: All alpha proteins
fold: alpha/alpha toroid
superfamily: Six-hairpin glycosidases
family: N-acylglucosamine (NAG) epimerase
domain: N-acyl-D-glucosamine 2-epimerase
species: Pig (Sus scrofa) [TaxId: 9823]

Probab=100.00  E-value=8.6e-38  Score=342.31  Aligned_cols=351  Identities=12%  Similarity=-0.007  Sum_probs=257.6

Q ss_pred             HHHHHHHHHh-cccccCCCCCC----------CCCCCChhHHHHHHHhhhhhcccCCCCCCHHHHHHHHHHHHHHHhCCC
Q 005023          157 LRLCAEQLSK-SYDSRFGGFGS----------APKFPRPVEIQMMLYHSKKLEDTGKSGEASEGQKMVLFTLQCMAKGGI  225 (718)
Q Consensus       157 ~~~~~~~l~~-~~D~~~GGfg~----------apKFP~~~~l~~Ll~~~~~~~~~~~~~~~~~~~~~~~~TL~~m~~gGi  225 (718)
                      +++++..|.+ .+|+++|||-+          .||+.... -++|.-++.... .+...+++..+++|.++++.|.++|+
T Consensus        19 l~~ilpfW~~~~~D~~~GGf~~~ld~dg~~~~~~k~~~~~-~R~l~~fs~a~~-~~~~~~~~~~~~~a~~g~~~L~~~~~   96 (402)
T d1fp3a_          19 LDRVMAFWLEHSHDREHGGFFTCLGRDGRVYDDLKYVWLQ-GRQVWMYCRLYR-KLERFHRPELLDAAKAGGEFLLRHAR   96 (402)
T ss_dssp             HHHHHHHHHHHSBCTTTSSBCCCBCTTSCBSCCCEEHHHH-HHHHHHHHHHHH-HCGGGCCHHHHHHHHHHHHHHHHHTB
T ss_pred             HHHHHHHHHhcCcCcCCCCeeeeECCCCCcCCCCceeeee-HHHHHHHHHHHH-HhcccCCHHHHHHHHHHHHHHHHhCC
Confidence            4667777765 69999999932          45543321 113333322110 01122468999999999999999999


Q ss_pred             cccCCCcEEEEecCCCCCCCCCcchHHHHHHHHHHHHHHHHccCChHHHHHHHHHHHHHHHhccCCCCceeeeccCCccc
Q 005023          226 HDHVGGGFHRYSVDERWHVPHFEKMLYDQGQLANVYLDAFSLTKDVFYSYICRDILDYLRRDMIGPGGEIFSAEDADSAE  305 (718)
Q Consensus       226 ~D~v~GGF~RYsvD~~W~vPHFEKmLyDnA~ll~~ya~Ay~~t~~~~y~~~A~~~~~~l~~~m~~p~Ggf~sa~DADs~~  305 (718)
                      +|+.+|||| ||||.+|.+||++||+||||+++.+|+++|++||++.|+++|.+|++||.++|++++||||++.|+|+. 
T Consensus        97 ~d~~~Gg~~-~~vd~dG~~~~~~k~~Yd~Af~l~a~a~~~~~tg~~~~~~~a~~~~~~i~~~~~~~~~g~~~~~~~~~~-  174 (402)
T d1fp3a_          97 VAPPEKKCA-FVLTRDGRPVKVQRSIFSECFYTMAMNELWRVTAEARYQSEAVDMMDQIVHWVREDPSGLGRPQLPGAV-  174 (402)
T ss_dssp             SSTTSCCBC-SEECTTSCEEECCSSSHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHTCGGGGCCCCCTTSC-
T ss_pred             ccCCCCCEE-EEECCCCCcCcccccccccHHHHHHHHHHHhccCCHHHHHHHHHHHHHHHHHhhcccCCCCccccCCCc-
Confidence            999999998 999999999999999999999999999999999999999999999999999999999999999999984 


Q ss_pred             ccCcccccCCceEeechHHHHHHhchhHHHHHHHhcccCCCCcCCCCCCCCCCccCCcceeeccCCchHHHHhcCCCHHH
Q 005023          306 TEGATRKKEGAFYVWTSKEVEDILGEHAILFKEHYYLKPTGNCDLSRMSDPHNEFKGKNVLIELNDSSASASKLGMPLEK  385 (718)
Q Consensus       306 ~~~~~~~~EG~yY~Wt~~Ei~~~L~~~~~~~~~~~~v~~~Gn~~~~~~~dp~~~~eg~nvL~~~~~~~~~a~~~g~~~~~  385 (718)
                            +.+|.+|.|...|+..+|++........+....+...+.  +.+ +..-+...++                   
T Consensus       175 ------~~~g~~~~m~l~ea~~~l~~~~~~~~~~~~~~~~~~~~~--~~~-~~~~~~~~~~-------------------  226 (402)
T d1fp3a_         175 ------ASESMAVPMMLLCLVEQLGEEDEELAGRYAQLGHWCARR--ILQ-HVQRDGQAVL-------------------  226 (402)
T ss_dssp             ------CEEETHHHHHHHHHHHHHHTTCHHHHHHTHHHHHHHHHH--HHT-TEETTTTEEC-------------------
T ss_pred             ------cccccchHHHHHHHHHHHccccchhHHHHHHHHHHHHHH--HHh-hccccchhHH-------------------
Confidence                  688999999999999988742111110000000000000  000 0000000000                   


Q ss_pred             HHHHHHHHHHHHHhhhccCCCCCCCchhhhchHHHHHHHHH-HHHHHhhhhhhhhcccCCCCCCChHHHHHHHHHH-HHH
Q 005023          386 YLNILGECRRKLFDVRSKRPRPHLDDKVIVSWNGLVISSFA-RASKILKSEAESAMFNFPVVGSDRKEYMEVAESA-ASF  463 (718)
Q Consensus       386 ~~~~l~~~r~~L~~~R~~R~~P~~Ddkilt~WNgl~I~ALa-~A~~~~~d~~~~~~~~~~~~~~~~~~~l~~A~~~-~~~  463 (718)
                                 .+..++.++.|..|+|+++.||+++++.|+ ++++++++                ++++..|.+. ..+
T Consensus       227 -----------e~~~~~~~~~~~~~~~~i~pGh~~e~~wLll~a~~~~~~----------------~~~~~~a~~~~~~~  279 (402)
T d1fp3a_         227 -----------ENVSEDGEELSGCLGRHQNPGHALEAGWFLLRHSSRSGD----------------AKLRAHVIDTFLLL  279 (402)
T ss_dssp             -----------SEEETTSCBCCHHHHHEECHHHHHHHHHHHHHHHHHTTC----------------HHHHHHHHHHHTHH
T ss_pred             -----------hhhccccCcccCcccCcCCcchhhHHHHHHHHHHHHcCC----------------chHHHHHHHHHHHH
Confidence                       011244577888899999999999988776 79999987                7888877665 577


Q ss_pred             HHHhccccCCCeEEEe-ecCCCCC-----CCCCcccHHHHHHHHHHHHHHcCChHHHHHHHHHHHHHHHhcccccCCccc
Q 005023          464 IRRHLYDEQTHRLQHS-FRNGPSK-----APGFLDDYAFLISGLLDLYEFGSGTKWLVWAIELQNTQDELFLDREGGGYF  537 (718)
Q Consensus       464 l~~~~~d~~~g~l~~~-~~~g~~~-----~~~~l~DyA~li~all~LYeaTgd~~~L~~A~~L~~~~~~~F~D~~~Gg~f  537 (718)
                      +.++.||++.|++++. ..+|.+.     ..+.+++||++|.|++.+|++|+|+.|+++|.++++.+.++|+|+++|+||
T Consensus       280 ~~~~g~d~~~ggl~~~~~~~g~~~~~~~~~~k~~W~qaE~i~a~l~ly~~tgd~~~l~~a~~l~~~~~~~f~D~~~G~W~  359 (402)
T d1fp3a_         280 PFRSGWDADHGGLFYFQDADGLCPTQLEWAMKLWWPHSEAMIAFLMGYSESGDPALLRLFYQVAEYTFRQFRDPEYGEWF  359 (402)
T ss_dssp             HHHHHBCTTTCSBCSCEETTSCCCSSTTTTCEEHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHTBCTTTSSBC
T ss_pred             HHHhCccCCCCeEEEEecCCCCccccccchHHHHHHHHHHHHHHHHHHHccCCHHHHHHHHHHHHHHHHhCCCCCCCeeE
Confidence            7888999888888776 3455432     246778899999999999999999999999999999999999999999999


Q ss_pred             cCCCCCCccccccccCCCCCCCChHHHHHH
Q 005023          538 NTTGEDPSVLLRVKEDHDGAEPSGNSVSVI  567 (718)
Q Consensus       538 ~t~~~~~~l~~r~k~~~D~a~PS~ns~~a~  567 (718)
                      +.-+.+..++...|.. -...|.++..++.
T Consensus       360 ~~~~~~g~~~~~~k~~-p~~~~YH~~ral~  388 (402)
T d1fp3a_         360 GYLNREGKVALTIKGG-PFKGCFHVPRCLA  388 (402)
T ss_dssp             CEECTTSCEEECCSSC-SSCCSSHHHHHHH
T ss_pred             eeECCCCCCCccCCCC-CCCCcchHHHHHH
Confidence            8765555544443322 2456778775443

PyMOL of d1fp3a_

>d2afaa1 a.102.1.3 (A:4-415) Putative NAG isomerase YihS {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d2afaa1 a.102.1.3 (A:4-415) Putative NAG isomerase YihS {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fp3a_ a.102.1.3 (A:) N-acyl-D-glucosamine 2-epimerase {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1sena_ c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2d5ja1 a.102.1.7 (A:1-377) Unsaturated glucuronyl hydrolase {Bacillus sp. GL1 [TaxId: 84635]}	Back information, alignment and structure

>d1nc5a_ a.102.1.6 (A:) Hypothetical protein YteR {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]}	Back information, alignment and structure

>d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]}	Back information, alignment and structure

>d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d2d5ja1 a.102.1.7 (A:1-377) Unsaturated glucuronyl hydrolase {Bacillus sp. GL1 [TaxId: 84635]}	Back information, alignment and structure

>d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]}	Back information, alignment and structure

>d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]}	Back information, alignment and structure

>d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]}	Back information, alignment and structure

>d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]}	Back information, alignment and structure

>d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]}	Back information, alignment and structure

>d1nc5a_ a.102.1.6 (A:) Hypothetical protein YteR {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1z5ye1 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG (CycY, DsbE) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]}	Back information, alignment and structure

>d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}	Back information, alignment and structure

>d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d1ia6a_ a.102.1.2 (A:) Nonprocessive cellulase Cel9M {Clostridium cellulolyticum [TaxId: 1521]}	Back information, alignment and structure

>d1ks8a_ a.102.1.2 (A:) Endo-b-1,4-glucanase {Termite (Nasutitermes takasagoensis) [TaxId: 62960]}	Back information, alignment and structure

>d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]}	Back information, alignment and structure

>d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g87a1 a.102.1.2 (A:3-456) Endo/exocellulase:cellobiose E-4, N-terminal domain {Clostridium cellulolyticum, atcc 35319 [TaxId: 1521]}	Back information, alignment and structure

>d1clca1 a.102.1.2 (A:135-575) CelD cellulase, C-terminal domain {Clostridium thermocellum [TaxId: 1515]}	Back information, alignment and structure

>d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1ut9a1 a.102.1.2 (A:306-816) Cellulose 1,4-beta-cellobiosidase CbhA {Clostridium thermocellum [TaxId: 1515]}	Back information, alignment and structure

>d1lu4a_ c.47.1.10 (A:) Soluble secreted antigen MPT53 {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1knga_ c.47.1.10 (A:) Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyrhizobium japonicum [TaxId: 375]}	Back information, alignment and structure

>d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2fy6a1 c.47.1.10 (A:33-175) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]}	Back information, alignment and structure

>d1tf4a1 a.102.1.2 (A:1-460) Endo/exocellulase:cellobiose E-4, N-terminal domain {Thermomonospora fusca [TaxId: 2021]}	Back information, alignment and structure

>d1o73a_ c.47.1.10 (A:) Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 5702]}	Back information, alignment and structure

>d2b5xa1 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase YkuV {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1jfua_ c.47.1.10 (A:) Membrane-anchored thioredoxin-like protein TlpA, soluble domain {Bradyrhizobium japonicum [TaxId: 375]}	Back information, alignment and structure

>d1st9a_ c.47.1.10 (A:) Thiol-disulfide oxidoreductase ResA {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1zzoa1 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1o8xa_ c.47.1.10 (A:) Tryparedoxin I {Crithidia fasciculata [TaxId: 5656]}	Back information, alignment and structure

>d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]}	Back information, alignment and structure

>d1nxca_ a.102.2.1 (A:) Class I alpha-1;2-mannosidase, catalytic domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}	Back information, alignment and structure

>d1nxca_ a.102.2.1 (A:) Class I alpha-1;2-mannosidase, catalytic domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1hcua_ a.102.2.1 (A:) Class I alpha-1;2-mannosidase, catalytic domain {Trichoderma reesei [TaxId: 51453]}	Back information, alignment and structure

>d1x9da1 a.102.2.1 (A:245-697) Class I alpha-1;2-mannosidase, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x9da1 a.102.2.1 (A:245-697) Class I alpha-1;2-mannosidase, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cvba1 c.47.1.10 (A:2-188) Probable thiol-disulfide isomerase/thioredoxin TTHA0593 {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1dl2a_ a.102.2.1 (A:) Class I alpha-1;2-mannosidase, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1i5ga_ c.47.1.10 (A:) Tryparedoxin II {Crithidia fasciculata [TaxId: 5656]}	Back information, alignment and structure

>d1ia6a_ a.102.1.2 (A:) Nonprocessive cellulase Cel9M {Clostridium cellulolyticum [TaxId: 1521]}	Back information, alignment and structure

>d1dl2a_ a.102.2.1 (A:) Class I alpha-1;2-mannosidase, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2ri9a1 a.102.2.1 (A:1036-1510) Class I alpha-1;2-mannosidase, catalytic domain {Fungus (Penicillium citrinum) [TaxId: 5077]}	Back information, alignment and structure

>d2g0da1 a.102.6.1 (A:7-415) Nisin biosynthesis protein NisC {Lactococcus lactis [TaxId: 1358]}	Back information, alignment and structure

>d2c0ga2 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1w6ka1 a.102.4.2 (A:6-99,A:379-732) Lanosterol synthase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1ks8a_ a.102.1.2 (A:) Endo-b-1,4-glucanase {Termite (Nasutitermes takasagoensis) [TaxId: 62960]}	Back information, alignment and structure

>d2sqca1 a.102.4.2 (A:8-36,A:308-630) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius [TaxId: 405212]}	Back information, alignment and structure

>d1ut9a1 a.102.1.2 (A:306-816) Cellulose 1,4-beta-cellobiosidase CbhA {Clostridium thermocellum [TaxId: 1515]}	Back information, alignment and structure

>d1t3ba1 c.47.1.9 (A:61-210) Disulfide bond isomerase, DsbC, C-terminal domain {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]}	Back information, alignment and structure

>d1eeja1 c.47.1.9 (A:61-216) Disulfide bond isomerase, DsbC, C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1z6na1 c.47.1.1 (A:1-166) Hypothetical protein PA1234 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d2ri9a1 a.102.2.1 (A:1036-1510) Class I alpha-1;2-mannosidase, catalytic domain {Fungus (Penicillium citrinum) [TaxId: 5077]}	Back information, alignment and structure

>d2cx4a1 c.47.1.10 (A:4-163) Bacterioferritin comigratory protein {Archaeon Aeropyrum pernix [TaxId: 56636]}	Back information, alignment and structure

>d1hcua_ a.102.2.1 (A:) Class I alpha-1;2-mannosidase, catalytic domain {Trichoderma reesei [TaxId: 51453]}	Back information, alignment and structure

>d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]}	Back information, alignment and structure

>d1xzoa1 c.47.1.10 (A:3-174) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1wzza1 a.102.1.2 (A:23-341) Probable endoglucanase CmcAX {Acetobacter xylinus [TaxId: 28448]}	Back information, alignment and structure

>d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d2bmxa1 c.47.1.10 (A:2-170) Alkyl hydroperoxide reductase AhpC {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1g7ea_ c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1clca1 a.102.1.2 (A:135-575) CelD cellulase, C-terminal domain {Clostridium thermocellum [TaxId: 1515]}	Back information, alignment and structure

>d1ttza_ c.47.1.1 (A:) Hypothetical protein XCC2852 {Xanthomonas campestris [TaxId: 339]}	Back information, alignment and structure

>d2trcp_ c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2p7vb1 a.4.13.2 (B:546-613) Sigma70 (SigA, RpoD) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2b7ka1 c.47.1.10 (A:111-279) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Baker's yeast(Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2sqca1 a.102.4.2 (A:8-36,A:308-630) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius [TaxId: 405212]}	Back information, alignment and structure

>d1w6ka1 a.102.4.2 (A:6-99,A:379-732) Lanosterol synthase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1gxma_ a.102.5.1 (A:) Polygalacturonic acid lyase (pectate lyase) {Cellvibrio cellulosa [TaxId: 155077]}	Back information, alignment and structure