Citrus Sinensis ID: 005043

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------

MFGFSRRRMKLGRVKKVQLSDSAQAIRSPIRPPKRNSNPNSECVAPSSNHADDRDCECTIAGPEVSNGTSGNSENWMVLSIAGDKPIPRFNHAAAVIGNKMIVVGGESGNGLLDDVQVLNFDRFSWTAASSKLYLSPSSLPLKIPACRGHSLISWGKKVLLVGGKTDSGSDRVSVWTFDTETECWSVVEAKGDIPVARSGHTVVRASSVLILFGGEDGKRRKLNDLHMFDLKSLTWLPLHCTGTGPSPRSNHVAALYDDKNLLIFGGSSKSKTLNDLYSLDFETMIWTRIKIRGFHPSPRAGCCGVLCGTKWYIAGGGSRKKRHAETLIFDILKGEWSVAITSPSSSVTSNKGFTLVLVQHKEKDFLVAFGGIKKEPSNQVEVLSIEKNESSMGRRSTPNAKGPGQLLFEKRSSSTGLACQLGNGAPQRSVDSVARQNLASAIEQHGSGRKSLSEFALVDPNPISGNVSLGKQFQNEEEYSTAVKMEKNSEDETSFVQTTENRKNQSDLGAQTSICVGKTNIDEAPLFDYENSNPLVQGIGNFHVDNDNVIFPDNDKSGALSGPSSIYQFYESKMAALIRKNGILEGQLAAALVNREAAEKNFSSVLKSRQEMEKKLADSLKEMELLKEKLAGLELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFNV

cccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccEEEEEccccccccccccEEEEEccEEEEEcccccccccccEEEEEccccEEEEEEEccccccccccccccccccEEEEEEccEEEEEccccccccccEEEEEEEccccEEEEEEEcccccccccccEEEEEccEEEEEccccccccccccEEEEEcccccEEEEEccccccccccccEEEEEccEEEEEEcccccccccccEEEEEcccccEEEEEccccccccccccEEEEEccEEEEEccccccccccccEEEEccccEEEEEEcccccccccccccEEEEEEEccccEEEEEccccccccccEEEEEcccccccccccccccccccccccccccccccccEEccccccccccccHHHHccccHHHHHccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccc

cccccccccccccccccccHHHHHHccccccccccccccccccEEEEccEEEEEccccccccccccccccccccEEEEccccccccccccccEEEEEccEEEEEEccccccccccEEEEcccccEEEEEcccccccccccccccccccccEEEEEccEEEEEEccccccccccEEEEEcccccEEEEccccccccccccccEEEEEccEEEEEEcccccccccccEEEEcccccEEEEEcccccccccccccEEEEEcccEEEEEEccccccccccEEEEcccccEEEEcccccccccccccEEEEEEccEEEEEEccccccccccEEEEcccccEEEEEcccccccccccccEEEEEEEEccccEEEEEEcccccccccEEEEcccccccEcccccccccccccEEEEcccccccEEEEcccccccccccccEEEccccccccccccccccccHEEcccccccccccccccccccHEHccHHccccccccccccccccccccccccEEcccccEEccEEEEEEEEEEEcccccccccccccEEcccccEEccccccccccccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccc

mfgfsrrrmklgrvkkvqlsdsaqairspirppkrnsnpnsecvapssnhaddrdcectiagpevsngtsgnsenWMVLSIagdkpiprfnHAAAVIGNKMIVvggesgngllddvqvlnfdrfswtaassklylspsslplkipacrghslisWGKKVLLvggktdsgsdrvsvWTFDTETECWSVveakgdipvarsghtVVRASSVLIlfggedgkrrklndlhmfdlksltwlplhctgtgpsprsnhvaalyddknllifggssksktlndlysLDFETMIWTRIkirgfhpspragccgvlcgtkwyiagggsrkkrHAETLIFDILKgewsvaitspsssvtsnkgFTLVLVQHKEKDFLVAfggikkepsnqvEVLSIeknessmgrrstpnakgpgqllfekrssstglacqlgngapqrsvDSVARQNLASAIEQhgsgrkslsefalvdpnpisgnvslgkqfqneeEYSTAVKMeknsedetSFVQTTenrknqsdlgaqtsicvgktnideaplfdyensnplvqgignfhvdndnvifpdndksgalsgpssIYQFYESKMAALIRKNGILEGQLAAALVNREAAEKNFSSVLKSRQEMEKKLADSLKEMELLKEKLAGLELAQEEANSlsnivhsdnvrlEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSlenraptprkpfnv

mfgfsrrrmklgrvkkvqlsdsaqairspirppkrnsnpnseCVAPSSNHADDRDCECTIAGpevsngtsgnseNWMVLSIAGDKPIPRFNHAAAVIGNKMIVVGGESGNGLLDDVQVLNFDRFSWTAASSKLYLSPSSLPLKIPACRGHSLISWGKKVLLVGgktdsgsdrvsvWTFDTETECWSVVEAKgdipvarsghtvvrassvlilfggedgkrrkLNDLHMFDLKSLTWLPLHCTGTGPSPRSNHVAALYDDKNLLIFGGSSKSKTLNDLYSLDFETMIWTRIKIRGFHPSPRAGCCGVLCGTKWYiagggsrkkrHAETLIFDILKGEWSVAItspsssvtsnkGFTLVLVQHKEKDFLVAfggikkepsnqvevlsieknessmgrrstpnakgpgQLLFEKRSSSTGLACQLGNGAPQRSVDSVARQNLASAIEQHGSGRKSLSEFALVDPNPISGNVSLGKQFQNEEEYSTAVKMEKNSEDETSFVQTtenrknqsdlgaqTSICVGKTNIDEAPLFDYENSNPLVQGIGNFHVDNDNVIFPDNDKSGALSGPSSIYQFYESKMAALIRKNGILEGQLAAALVNREAAEKNFSSVLKSRQEMEKKLADSLKEMELLKEKLAGLELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRlqslenraptprkpfnv

MFGFSRRRMKLGRVKKVQLSDSAQAIRSPIRPPKRNSNPNSECVAPSSNHADDRDCECTIAGPEVSNGTSGNSENWMVLSIAGDKPIPRFNHAAAVIGNKMIVVGGESGNGLLDDVQVLNFDRFSWTAAssklylspsslplkIPACRGHSLISWGKKVLLVGGKTDSGSDRVSVWTFDTETECWSVVEAKGDIPVARSGHTVVRASSVLILFGGEDGKRRKLNDLHMFDLKSLTWLPLHCTGTGPSPRSNHVAALYDDKNLLIFGGSSKSKTLNDLYSLDFETMIWTRIKIRGFHPSPRAGCCGVLCGTKWYIAGGGSRKKRHAETLIFDILKGEWSVAITSPSSSVTSNKGFTLVLVQHKEKDFLVAFGGIKKEPSNQVEVLSIEKNESSMGRRSTPNAKGPGQLLFEKRSSSTGLACQLGNGAPQRSVDSVARQNLASAIEQHGSGRKSLSEFALVDPNPISGNVSLGKQFQNEEEYSTAVKMEKNSEDETSFVQTTENRKNQSDLGAQTSICVGKTNIDEAPLFDYENSNPLVQGIGNFHVDNDNVIFPDNDKSGALSGPSSIYQFYESKMAALIRKNGILEGQLAAALVNREAAEKNFSSVLKSRQEMEKKLADSlkemellkeklaglelaqeeaNSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFNV

**************************************************************************NWMVLSIAGDKPIPRFNHAAAVIGNKMIVVGGESGNGLLDDVQVLNFDRFSWTAASSKLYLSPSSLPLKIPACRGHSLISWGKKVLLVGGKTDSGSDRVSVWTFDTETECWSVVEAKGDIPVARSGHTVVRASSVLILFGGEDGKRRKLNDLHMFDLKSLTWLPLHCTGTGPSPRSNHVAALYDDKNLLIFGGSSKSKTLNDLYSLDFETMIWTRIKIRGFHPSPRAGCCGVLCGTKWYIAGGGSRKKRHAETLIFDILKGEWSVAITSPS*SVTSNKGFTLVLVQHKEKDFLVAFGGIK******************************************************************************************************************************************TSICVGKTNIDEAPLFDYENSNPLVQGIGNFHVDNDNVIFPD**********SSIYQFYESKMAALIRKNGILEGQLAAALVN**************************************************NIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLK*******************

MFG*********************************************NHADDRDCECTIAGPEVSNGTSGNSENWMVLSIAGDKPIPRFNHAAAVIGNKMIVVGGESGNGLLDDVQVLNFDRFSWTAASSKLYL******LKIPACRGHSLISWGKKVLLVGGKTDSGSDRVSVWTFDTETECWSVVEAKGDIPVARSGHTVVRASSVLILFGGEDGKRRKLNDLHMFDLKSLTWLPLHCTGTGPSPRSNHVAALYDDKNLLIFGGSSKSKTLNDLYSLDFETMIWTRIKIRGFHPSPRAGCCGVLCGTKWYIAGGGSRKKRHAETLIFDILKGEWSVA************GFTLVLVQHKEKDFLVAFGGIKKEPSNQVEVLSIEKNE*********************RSSSTGLACQLGN*************************************************************************************************************************************************************************************************************************************RLEHDVAFLKAVLDD********************QLQVEVFHL********************

MFGFSRRRMKLGRVKKVQLSDSAQAIRSPIRP********************DRDCECTIAGPEVSNGTSGNSENWMVLSIAGDKPIPRFNHAAAVIGNKMIVVGGESGNGLLDDVQVLNFDRFSWTAASSKLYLSPSSLPLKIPACRGHSLISWGKKVLLVGGKTDSGSDRVSVWTFDTETECWSVVEAKGDIPVARSGHTVVRASSVLILFGGEDGKRRKLNDLHMFDLKSLTWLPLHCTGTGPSPRSNHVAALYDDKNLLIFGGSSKSKTLNDLYSLDFETMIWTRIKIRGFHPSPRAGCCGVLCGTKWYIAGGGSRKKRHAETLIFDILKGEWSVAITSPSSSVTSNKGFTLVLVQHKEKDFLVAFGGIKKEPSNQVEVLSIEK*************KGPGQLLFEKRSSSTGLACQLGNGAPQRSVDSVARQNLASAIEQHGSGRKSLSEFALVDPNPISGNVSLGKQFQNE*****************************SDLGAQTSICVGKTNIDEAPLFDYENSNPLVQGIGNFHVDNDNVIFPDNDKSGALSGPSSIYQFYESKMAALIRKNGILEGQLAAALVNREAAEKNFSSVLKSRQEMEKKLADSLKEMELLKEKLAGLELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSLENRAP********

****************VQLSDSAQAIRSPIRPPKRNSNPNSECVAPSSNHADDRDCECTIAGPEVSNGTSGNSENWMVLSIAGDKPIPRFNHAAAVIGNKMIVVGGESGNGLLDDVQVLNFDRFSWTAASSKLYLSPSSLPLKIPACRGHSLISWGKKVLLVGGKTDSGSDRVSVWTFDTETECWSVVEAKGDIPVARSGHTVVRASSVLILFGGEDGKRRKLNDLHMFDLKSLTWLPLHCTGTGPSPRSNHVAALYDDKNLLIFGGSSKSKTLNDLYSLDFETMIWTRIKIRGFHPSPRAGCCGVLCGTKWYIAGGGSRKKRHAETLIFDILKGEWSVAITSPSSSVTSNKGFTLVLVQHKEKDFLVAFGGIKKEPSNQVEVLSIEKNESSMGRRSTPNAKGPGQLLFEKRSSSTGLACQLGNGAPQRSVDSVARQNLASAIEQHGSGRKSLSEFALVDPNPISGNVSLGKQFQNEEEYSTAVK**********FV********QSDLGAQTSICVGKTNIDEAPLFDYENSNPLVQGIGNFHVDNDNVIFPDNDKSGALSGPSSIYQFYESKMAALIRKNGILEGQLAAALVNREAAEKNFSSVLKSRQEMEKKLADSLKEMELLKEKLAGLELAQEEANSLSNIVHSDNVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQS*E************

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MFGFSRRRMKLGRVKKVQLSDSAQAIRSPIRPPKRNSNPNSECVAPSSNHADDRDCECTIAGPEVSNGTSGNSENWMVLSIAGDKPIPRFNHAAAVIGNKMIVVGGESGNGLLDDVQVLNFDRFSWTAASSKLYLSPSSLPLKIPACRGHSLISWGKKVLLVGGKTDSGSDRVSVWTFDTETECWSVVEAKGDIPVARSGHTVVRASSVLILFGGEDGKRRKLNDLHMFDLKSLTWLPLHCTGTGPSPRSNHVAALYDDKNLLIFGGSSKSKTLNDLYSLDFETMIWTRIKIRGFHPSPRAGCCGVLCGTKWYIAGGGSRKKRHAETLIFDILKGEWSVAITSPSSSVTSNKGFTLVLVQHKEKDFLVAFGGIKKEPSNQVEVLSIEKNESSMGRRSTPNAKGPGQLLFEKRSSSTGLACQLGNGAPQRSVDSVARQNLASAIEQHGSGRKSLSEFALVDPNPISGNVSLGKQFQNEEEYSTAVKMEKNSEDETSFVQTTENRKNQSDLGAQTSICVGKTNIDEAPLFDYENSNPLVQGIGNFHVDNDNVIFPDNDKSGALSGPSSIYQFYESKMAALIRKNGILEGQLAAALVNxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSNIVHSDxxxxxxxxxxxxxxxxxxxxxLHSTRGVLAGERARxxxxxxxxxxxxxxxxxxxxxAPTPRKPFNV

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		717	2.2.26 [Sep-21-2011]
Q9MA55		668	Acyl-CoA-binding domain-c	no	no	0.460	0.494	0.368	5e-64
Q8RWD9		648	Acyl-CoA-binding domain-c	no	no	0.456	0.504	0.360	8e-63
Q5EA50		372	Rab9 effector protein wit	yes	no	0.373	0.720	0.278	3e-23
P51611		2090	Host cell factor 1 OS=Mes	N/A	no	0.317	0.109	0.300	7e-22
Q61191		2045	Host cell factor 1 OS=Mus	yes	no	0.317	0.111	0.300	8e-22
P87061		1147	Tip elongation aberrant p	yes	no	0.312	0.195	0.297	1e-21
P51610		2035	Host cell factor 1 OS=Hom	yes	no	0.317	0.112	0.296	2e-21
Q7Z6M1		372	Rab9 effector protein wit	no	no	0.365	0.704	0.276	5e-21
Q8VCH5		380	Rab9 effector protein wit	no	no	0.319	0.602	0.294	1e-20
Q8H4D4		1043	tRNA wybutosine-synthesiz	no	no	0.309	0.212	0.309	2e-20

>sp\|Q9MA55\|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1	Back alignment and function desciption

 Score =  246 bits (628), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 123/334 (36%), Positives = 188/334 (56%), Gaps = 4/334 (1%)

Query: 76  WMVLSIAGDKPIPRFNHAAAVIGNKMIVVGGESGNGLLDDVQVLNFDRFSWTAASSKLYL 135
           W     +G +P  R+ H AAVI +KM + GG      L D+ VL+   ++W+   +K+  
Sbjct: 171 WTAPQTSGQRPKARYEHGAAVIQDKMYIYGGNHNGRYLGDLHVLDLKSWTWSRVETKVAT 230

Query: 136 --SPSSLPLKIPACRGHSLISWGKKVLLVGGKTDSGSDRVSVWTFDTETECWSVVEAKGD 193
               +S P  +  C GHSLI+W  K+L +GG T   S+ + V  FD  T  WS+++  G 
Sbjct: 231 ESQETSTPTLLAPCAGHSLIAWDNKLLSIGGHTKDPSESMQVKVFDPHTITWSMLKTYGK 290

Query: 194 IPVARSGHTVVRASSVLILFGGEDGKRRKLNDLHMFDLKSLTWLPLHCTGTGPSPRSNHV 253
            PV+R G +V      L++FGG+D KR  LNDLH+ DL ++TW  +   G  PSPRS+H 
Sbjct: 291 PPVSRGGQSVTMVGKTLVIFGGQDAKRSLLNDLHILDLDTMTWDEIDAVGVSPSPRSDHA 350

Query: 254 AALYDDKNLLIFGGSSKSKTLNDLYSLDFETMIWTRIKIRGFHPSPRAGCCGVLCGTKWY 313
           AA++ ++ LLIFGG S +   +DL+ LD +TM W+R   +G  P+PRAG  GV  G  W+
Sbjct: 351 AAVHAERFLLIFGGGSHATCFDDLHVLDLQTMEWSRPAQQGDAPTPRAGHAGVTIGENWF 410

Query: 314 IAGGGSRKKRHAETLIFDILKGEWSVAITSPSSSVTSNKGFTLVLVQHKEKDFLVAFGGI 373
           I GGG  K   +E+++ ++    WSV  +       +++G +LV+  +  +D LVAFGG 
Sbjct: 411 IVGGGDNKSGASESVVLNMSTLAWSVVASVQGRVPLASEGLSLVVSSYNGEDVLVAFGGY 470

Query: 374 KKEPSNQVEVLSIEKNESSMGRRSTPNAKGPGQL 407
               +N++ +L  + +  S  +  T  A  PG L
Sbjct: 471 NGRYNNEINLL--KPSHKSTLQTKTLEAPLPGSL 502

Binds medium- and long-chain acyl-CoA esters with very high affinity. Can interact in vitro with oleoyl-CoA, barely with palmitoyl-CoA, but not with arachidonyl-CoA. May function as an intracellular carrier of acyl-CoA esters. Plays a role in the biosynthesis of membrane lipids including galactolipids and phospholipids.
Arabidopsis thaliana (taxid: 3702)

>sp\|Q8RWD9\|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1	Back alignment and function description

>sp\|Q5EA50\|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1	Back alignment and function description

>sp\|P51611\|HCFC1_MESAU Host cell factor 1 OS=Mesocricetus auratus GN=HCFC1 PE=1 SV=1	Back alignment and function description

>sp\|Q61191\|HCFC1_MOUSE Host cell factor 1 OS=Mus musculus GN=Hcfc1 PE=1 SV=2	Back alignment and function description

>sp\|P87061\|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1	Back alignment and function description

>sp\|P51610\|HCFC1_HUMAN Host cell factor 1 OS=Homo sapiens GN=HCFC1 PE=1 SV=2	Back alignment and function description

>sp\|Q7Z6M1\|RABEK_HUMAN Rab9 effector protein with kelch motifs OS=Homo sapiens GN=RABEPK PE=1 SV=1	Back alignment and function description

>sp\|Q8VCH5\|RABEK_MOUSE Rab9 effector protein with kelch motifs OS=Mus musculus GN=Rabepk PE=2 SV=2	Back alignment and function description

>sp\|Q8H4D4\|TYW23_ORYSJ tRNA wybutosine-synthesizing protein 2/3/4 OS=Oryza sativa subsp. japonica GN=Os07g0515000 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		717
359477427		717	PREDICTED: uncharacterized protein LOC10	0.995	0.995	0.770	0.0
225432358		706	PREDICTED: uncharacterized protein LOC10	0.980	0.995	0.768	0.0
255551677		713	acyl-CoA binding protein, putative [Rici	0.988	0.994	0.768	0.0
224130424		707	predicted protein [Populus trichocarpa]	0.977	0.991	0.761	0.0
356563867		708	PREDICTED: acyl-CoA-binding domain-conta	0.973	0.985	0.730	0.0
449432819		678	PREDICTED: acyl-CoA-binding domain-conta	0.938	0.992	0.717	0.0
224110584		663	predicted protein [Populus trichocarpa]	0.917	0.992	0.712	0.0
356519992		711	PREDICTED: acyl-CoA-binding domain-conta	0.979	0.987	0.72	0.0
357478641		743	Acyl-CoA-binding domain-containing prote	0.983	0.948	0.698	0.0
357478643		735	Acyl-CoA-binding domain-containing prote	0.972	0.948	0.689	0.0

>gi\|359477427\|ref\|XP_003631976.1\| PREDICTED: uncharacterized protein LOC100264848 isoform 2 [Vitis vinifera] gi\|297736898\|emb\|CBI26099.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

 Score = 1114 bits (2882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 555/720 (77%), Positives = 615/720 (85%), Gaps = 6/720 (0%)

Query: 1   MFGFSRRRMKLGRVKKVQLSDSAQAIRSPIRPPKRNSNPNS-ECVAPSSNHADDRDCECT 59
           MFGFSRRRMKLGR+K VQL+DSAQ  RSPI+  KR SN N+ E    +S  +D+ +C+ +
Sbjct: 1   MFGFSRRRMKLGRLK-VQLADSAQGTRSPIKQSKRTSNTNNGESGGRASGQSDELNCQYS 59

Query: 60  IAGPEVSNGTSGNSENWMVLSIAGDKPIPRFNHAAAVIGNKMIVVGGESGNGLLDDVQVL 119
              PE +N T+G SENWMVLSIAGDKP PRFNHAAAVIGNKM+VVGGES NGLL+DVQVL
Sbjct: 60  SDAPEANNTTTGKSENWMVLSIAGDKPTPRFNHAAAVIGNKMVVVGGESENGLLEDVQVL 119

Query: 120 NFDRFSWTAASSKLYLSPSSLPLKIPACRGHSLISWGKKVLLVGGKTDSGSDRVSVWTFD 179
           NFDRF+W+A SSK+YLSP+SLPLKIPAC+GHSL+SWG+KVLLVGGKT+ GS+RVSVW FD
Sbjct: 120 NFDRFTWSAPSSKIYLSPTSLPLKIPACKGHSLVSWGQKVLLVGGKTEPGSERVSVWAFD 179

Query: 180 TETECWSVVEAKGDIPVARSGHTVVRASSVLILFGGEDGKRRKLNDLHMFDLKSLTWLPL 239
            ETECWS++EAKGDIPVARSGHTVVRASSVLILFGGED KRRKLNDLHMFDLKSLTWLPL
Sbjct: 180 IETECWSLMEAKGDIPVARSGHTVVRASSVLILFGGEDSKRRKLNDLHMFDLKSLTWLPL 239

Query: 240 HCTGTGPSPRSNHVAALYDDKNLLIFGGSSKSKTLNDLYSLDFETMIWTRIKIRGFHPSP 299
           HCTGTGPSPRSNHVAALYDDK L IFGG SKS+TLNDLYSLDFETMIW+RIK +   PSP
Sbjct: 240 HCTGTGPSPRSNHVAALYDDKILFIFGGGSKSRTLNDLYSLDFETMIWSRIKKKRGFPSP 299

Query: 300 RAGCCGVLCGTKWYIAGGGSRKKRHAETLIFDILKGEWSVAITSPSSSVTSNKGFTLVLV 359
           RAGCCGVLCGTKWYIAGGGSRKKRHAETLI+D+LK EWSV I  P+SS+T+NKGF+LVLV
Sbjct: 300 RAGCCGVLCGTKWYIAGGGSRKKRHAETLIYDVLKVEWSV-IAGPTSSITTNKGFSLVLV 358

Query: 360 QHKEKDFLVAFGGIKKEPSNQVEVLSIEKNESSMGRRSTPNAKGPGQLLFEKRSSSTGLA 419
           QHKEKDFLVAFGG KKEPSN+VEVL  EKNE S+ RRST N KG    L E RSSS GLA
Sbjct: 359 QHKEKDFLVAFGGTKKEPSNEVEVLIKEKNEVSISRRSTLN-KGSELFLSENRSSSAGLA 417

Query: 420 CQLGNGAPQRSVDSVARQNLASAIEQHGSGRKSLSEFALVDPNPISGNVSLGKQFQNEEE 479
            QL NGAPQ  V+SV RQNLASAIEQHGSGRKSLSE +LVDPNP  GNVSL KQF NEEE
Sbjct: 418 SQLSNGAPQHPVESVMRQNLASAIEQHGSGRKSLSESSLVDPNPAPGNVSLRKQFHNEEE 477

Query: 480 YSTAVKMEKNSEDETSFVQTTENRKNQSDLGAQTSICVGKTNIDEAP-LFDYENSNPLVQ 538
           Y+TAVK  ++ EDE    Q +E+R    D G   S+   K N+DE P + D ENSN   Q
Sbjct: 478 YNTAVKTLRSLEDECYSSQASEHRMKLFDTGIHGSLAGCKINVDEIPSVLDSENSNAYNQ 537

Query: 539 GIGNFHVDNDNVIFPD-NDKSGALSGPSSIYQFYESKMAALIRKNGILEGQLAAALVNRE 597
           G GN  VDND+ +FP+ + KS A S PSSIYQ YE+KMAALIRKNGILEGQL AAL +RE
Sbjct: 538 GNGNLLVDNDDEVFPESHGKSVAFSAPSSIYQLYETKMAALIRKNGILEGQLTAALASRE 597

Query: 598 AAEKNFSSVLKSRQEMEKKLADSLKEMELLKEKLAGLELAQEEANSLSNIVHSDNVRLEH 657
           A EKN SSVLK+RQEMEKKLAD+LKEME+LKEKLAG+ELAQEEAN+LSN+VHSDNVRLEH
Sbjct: 598 AVEKNLSSVLKNRQEMEKKLADTLKEMEMLKEKLAGVELAQEEANNLSNMVHSDNVRLEH 657

Query: 658 DVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSLENRAPTPRKPFNV 717
           DVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQS+ENRAPTPRKPF+V
Sbjct: 658 DVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSMENRAPTPRKPFHV 717

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|225432358\|ref\|XP_002275331.1\| PREDICTED: uncharacterized protein LOC100264848 isoform 1 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255551677\|ref\|XP_002516884.1\| acyl-CoA binding protein, putative [Ricinus communis] gi\|223543972\|gb\|EEF45498.1\| acyl-CoA binding protein, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|224130424\|ref\|XP_002328605.1\| predicted protein [Populus trichocarpa] gi\|222838587\|gb\|EEE76952.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|356563867\|ref\|XP_003550179.1\| PREDICTED: acyl-CoA-binding domain-containing protein 4-like [Glycine max]	Back alignment and taxonomy information

>gi\|449432819\|ref\|XP_004134196.1\| PREDICTED: acyl-CoA-binding domain-containing protein 4-like [Cucumis sativus] gi\|449529842\|ref\|XP_004171907.1\| PREDICTED: acyl-CoA-binding domain-containing protein 4-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|224110584\|ref\|XP_002315566.1\| predicted protein [Populus trichocarpa] gi\|222864606\|gb\|EEF01737.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|356519992\|ref\|XP_003528652.1\| PREDICTED: acyl-CoA-binding domain-containing protein 4-like [Glycine max]	Back alignment and taxonomy information

>gi\|357478641\|ref\|XP_003609606.1\| Acyl-CoA-binding domain-containing protein [Medicago truncatula] gi\|355510661\|gb\|AES91803.1\| Acyl-CoA-binding domain-containing protein [Medicago truncatula]	Back alignment and taxonomy information

>gi\|357478643\|ref\|XP_003609607.1\| Acyl-CoA-binding domain-containing protein [Medicago truncatula] gi\|355510662\|gb\|AES91804.1\| Acyl-CoA-binding domain-containing protein [Medicago truncatula]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		717
TAIR\|locus:2183008		708	AT5G18590 [Arabidopsis thalian	0.974	0.987	0.626	8.7e-230
TAIR\|locus:2184352		514	AT5G04420 [Arabidopsis thalian	0.444	0.620	0.338	7.8e-58
TAIR\|locus:2143676		648	ACBP5 "acyl-CoA binding protei	0.596	0.660	0.307	9.6e-57
UNIPROTKB\|Q5EA50		372	RABEPK "Rab9 effector protein	0.343	0.661	0.290	4.1e-24
MGI\|MGI:2139530		380	Rabepk "Rab9 effector protein	0.343	0.647	0.294	1.4e-23
RGD\|1310612		372	Rabepk "Rab9 effector protein	0.343	0.661	0.290	6.3e-23
UNIPROTKB\|F1SKQ3		370	RABEPK "Uncharacterized protei	0.343	0.664	0.283	1.1e-21
UNIPROTKB\|Q7Z6M1		372	RABEPK "Rab9 effector protein	0.343	0.661	0.283	3.6e-21
DICTYBASE\|DDB_G0270750		485	DDB_G0270750 "Kelch repeat-con	0.337	0.498	0.287	5.5e-21
WB\|WBGene00001827		782	hcf-1 [Caenorhabditis elegans	0.341	0.313	0.294	5.2e-20

TAIR\|locus:2183008 AT5G18590 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 2217 (785.5 bits), Expect = 8.7e-230, P = 8.7e-230
 Identities = 455/726 (62%), Positives = 543/726 (74%)

Query:     1 MFGFSRRRMKLGRVKKVQLSDSAQAIRSPIRPPKRNSNPNSECVAPSSNHADDRDCECTI 60
             MF FS+RRM+LGRVKKVQLSDS Q  +SP+R  KR  + ++E    +++++D+ D +   
Sbjct:     1 MFSFSKRRMRLGRVKKVQLSDSVQGYKSPLRVTKRADSSSNEAAVAATSYSDELDFQ--- 57

Query:    61 AGPEVSNGTSGNSENWMVLSIAGDKPIPRFNHAAAVIGNKMIVVGGESGNGLLDDVQVLN 120
               P     +SGNSENWMVLS+ G+KP PRFNHAAA IGNKMIVVGGESG+GLLDDVQVLN
Sbjct:    58 --P-----SSGNSENWMVLSVNGEKPAPRFNHAAATIGNKMIVVGGESGSGLLDDVQVLN 110

Query:   121 FDRFSWTAAXXXXXXXXXXXXXXIPACRGHSLISWGKKVLLVGGKTDSGSDRVSVWTFDT 180
             FD  +W+ A              IPA +GH L+SWGKKVLLVGGKTD  SDRVSVW FDT
Sbjct:   111 FDSCTWSTASSKVYLSPSSLPLMIPAWKGHCLVSWGKKVLLVGGKTDPSSDRVSVWAFDT 170

Query:   181 ETECWSVVEAKGDIPVARSGHTVVRASSVLILFGGEDGKRRKLNDLHMFDLKSLTWLPLH 240
             ++ECWS+++AKGD+PV+RSGHTVVRASSVLILFGGED K+RKLNDLHMFDLKS TWLPL+
Sbjct:   171 DSECWSLMDAKGDLPVSRSGHTVVRASSVLILFGGEDSKKRKLNDLHMFDLKSSTWLPLN 230

Query:   241 CTGTGPSPRSNHVAALYDDKNLLIFGGSSKSKTLNDLYSLDFETMIWTRIKIRGFHPSPR 300
             CTGT P  RS+HVA L+DDK L +FGGS K+KTLNDLYSLDFETM+W+RIKIRGFHPSPR
Sbjct:   231 CTGTRPCARSHHVATLFDDKILFVFGGSGKNKTLNDLYSLDFETMVWSRIKIRGFHPSPR 290

Query:   301 AGCCGVLCGTKWYIAGGGSRKKRHAETLIFDILKGEWSVAITSPSSSVTSNKGFTLVLVQ 360
             AG CGVLCGTKWYI GGGSRKKRHAETL+FDILK EWSVA  S  SSVTSNKGF+LVL+Q
Sbjct:   291 AGSCGVLCGTKWYITGGGSRKKRHAETLVFDILKVEWSVASISSQSSVTSNKGFSLVLLQ 350

Query:   361 HKEKDFLVAFGGIKKEPSNQVEVLSIEKNES-SMGRRSTPNAKGPGQLLFEKRSSSTGLA 419
             HK+KDFLVAFGG KK+PSNQV+  +I+KN+S S     T + K PG+LLF KRSSS+ + 
Sbjct:   351 HKDKDFLVAFGGTKKDPSNQVDAFTIDKNKSESPTHPQTTSKKNPGRLLFGKRSSSSAVL 410

Query:   420 C--QLGNGAPQRSVDSVARQNLASAIEQHG-SGRKSLSEFALVDP-NPISGNVSLGKQFQ 475
                +    + QR +DSVARQ LASAIE+HG SGR+SLSE A  D  NP SGNVSL KQF 
Sbjct:   411 TSDESVKASSQRLIDSVARQKLASAIEEHGGSGRRSLSEIAFGDHRNPPSGNVSLRKQFS 470

Query:   476 NEEEYSTAVKMEKNSEDETSFVQ-TTENRKNQSDLGAQTSICVGKTNIDEAPLFDYENSN 534
              EEEY   ++  K SE++ S    TT++    + + A+ ++ +    + +  +   +   
Sbjct:   471 TEEEYRAVIEPAKCSEEDISVPPPTTDDNTGGAKITAEKTLSM----VSDREILSLQKQC 526

Query:   535 PLVQGIGNFHVDNDNVIFPDNDK---SGALSGPSSIYQFYESKMAALIRKNGILEGQLAA 591
                  + N  VD   +IF + D    +G+ S  SS+YQF+E+KM ALIR+NGILEGQL A
Sbjct:   527 SETYPLEN--VDGA-LIFQEMDNINFAGSASS-SSVYQFHEAKMTALIRRNGILEGQLEA 582

Query:   592 ALVNREAAEKNFSSVLKSRQEMEKKLADSXXXXXXXXXXXXXXXXXXXXXNSLSNIVHSD 651
             AL  REAAE+N S  L+S+QE +KKL+D+                     NSLSN+VHSD
Sbjct:   583 ALAGREAAERNVSVALRSKQETDKKLSDAMRDVELLKEKLTGLELAQEEANSLSNMVHSD 642

Query:   652 NVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSLENRAPTP 711
             NVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSLENRA TP
Sbjct:   643 NVRLEHDVAFLKAVLDDTQKELHSTRGVLAGERARAFQLQVEVFHLKQRLQSLENRAATP 702

Query:   712 RKPFNV 717
             RKPF+V
Sbjct:   703 RKPFHV 708

GO:0005634 "nucleus" evidence=ISM

GO:0008150 "biological_process" evidence=ND

GO:0005829 "cytosol" evidence=IDA

GO:0006869 "lipid transport" evidence=RCA

TAIR\|locus:2184352 AT5G04420 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2143676 ACBP5 "acyl-CoA binding protein 5" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5EA50 RABEPK "Rab9 effector protein with kelch motifs" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

MGI\|MGI:2139530 Rabepk "Rab9 effector protein with kelch motifs" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

RGD\|1310612 Rabepk "Rab9 effector protein with kelch motifs" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|F1SKQ3 RABEPK "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|Q7Z6M1 RABEPK "Rab9 effector protein with kelch motifs" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0270750 DDB_G0270750 "Kelch repeat-containing protein" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

WB\|WBGene00001827 hcf-1 [Caenorhabditis elegans (taxid:6239)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		717
PLN02193		470	PLN02193, PLN02193, nitrile-specifier protein	3e-12
PLN02153		341	PLN02153, PLN02153, epithiospecifier protein	2e-09
pfam13415		48	pfam13415, Kelch_3, Galactose oxidase, central dom	2e-08
PHA03098		534	PHA03098, PHA03098, kelch-like protein; Provisiona	3e-08
pfam13418		49	pfam13418, Kelch_4, Galactose oxidase, central dom	4e-08
PLN02153		341	PLN02153, PLN02153, epithiospecifier protein	5e-08
pfam13418		49	pfam13418, Kelch_4, Galactose oxidase, central dom	3e-07
pfam01344		46	pfam01344, Kelch_1, Kelch motif	2e-06
PLN02153		341	PLN02153, PLN02153, epithiospecifier protein	2e-05
pfam13415		48	pfam13415, Kelch_3, Galactose oxidase, central dom	2e-05
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	2e-05
pfam01344		46	pfam01344, Kelch_1, Kelch motif	3e-05
pfam13854		42	pfam13854, Kelch_5, Kelch motif	4e-05
pfam13854		42	pfam13854, Kelch_5, Kelch motif	7e-05
PHA03098		534	PHA03098, PHA03098, kelch-like protein; Provisiona	1e-04
PHA03098		534	PHA03098, PHA03098, kelch-like protein; Provisiona	2e-04
PLN02153		341	PLN02153, PLN02153, epithiospecifier protein	4e-04
pfam13415		48	pfam13415, Kelch_3, Galactose oxidase, central dom	4e-04
pfam13418		49	pfam13418, Kelch_4, Galactose oxidase, central dom	4e-04
pfam01576		859	pfam01576, Myosin_tail_1, Myosin tail	6e-04
pfam13854		42	pfam13854, Kelch_5, Kelch motif	9e-04
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	0.001
pfam13964		50	pfam13964, Kelch_6, Kelch motif	0.001
pfam07646		48	pfam07646, Kelch_2, Kelch motif	0.002
pfam07646		48	pfam07646, Kelch_2, Kelch motif	0.002
pfam07646		48	pfam07646, Kelch_2, Kelch motif	0.004
TIGR03548		323	TIGR03548, mutarot_permut, cyclically-permuted mut	0.004
COG3055		381	COG3055, COG3055, Uncharacterized protein conserve	0.004

>gnl\|CDD\|177844 PLN02193, PLN02193, nitrile-specifier protein	Back alignment and domain information

 Score = 68.8 bits (168), Expect = 3e-12
 Identities = 60/247 (24%), Positives = 110/247 (44%), Gaps = 17/247 (6%)

Query: 75  NWMVLSIAGDKPIPRFNHAAAVIGNKMIVVGGE-SGNGLLDD-VQVLNFDRFSWTAASSK 132
            W+ +   G+ P  R +H  A +GNK+   GGE + N  +D  + V + +  +W+     
Sbjct: 152 KWIKVEQKGEGPGLRCSHGIAQVGNKIYSFGGEFTPNQPIDKHLYVFDLETRTWS----- 206

Query: 133 LYLSPSSLPLKIPACRGHSLISWGKKVLLVGGKTDSGSDRVSVWTFDTETECWSVVEAKG 192
             +SP++  +   +C G  ++S G  + + GG+ D+       ++FDT T  W ++    
Sbjct: 207 --ISPATGDVPHLSCLGVRMVSIGSTLYVFGGR-DASRQYNGFYSFDTTTNEWKLLTPVE 263

Query: 193 DIPVARSGHTVVRASSVLILFGGEDGKRRKLNDLHMFDLKSLTWLPLHCTGTGPSPRSNH 252
           + P  RS H++      + +FGG      +L  L  +++    W   HC+  G S     
Sbjct: 264 EGPTPRSFHSMAADEENVYVFGGV-SATARLKTLDSYNIVDKKW--FHCSTPGDSFSIRG 320

Query: 253 VAAL--YDDKNLLIFGGSSKSKTLNDLYSLDFETMIWTRIKIRGFHPSPRAGCCGVLCGT 310
            A L     K  +++G +     ++D++  D     WT+++  G  PS R+       G 
Sbjct: 321 GAGLEVVQGKVWVVYGFNGCE--VDDVHYYDPVQDKWTQVETFGVRPSERSVFASAAVGK 378

Query: 311 KWYIAGG 317
              I GG
Sbjct: 379 HIVIFGG 385

Length = 470

>gnl\|CDD\|177814 PLN02153, PLN02153, epithiospecifier protein	Back alignment and domain information

>gnl\|CDD\|222113 pfam13415, Kelch_3, Galactose oxidase, central domain	Back alignment and domain information

>gnl\|CDD\|222983 PHA03098, PHA03098, kelch-like protein; Provisional	Back alignment and domain information

>gnl\|CDD\|205596 pfam13418, Kelch_4, Galactose oxidase, central domain	Back alignment and domain information

>gnl\|CDD\|177814 PLN02153, PLN02153, epithiospecifier protein	Back alignment and domain information

>gnl\|CDD\|205596 pfam13418, Kelch_4, Galactose oxidase, central domain	Back alignment and domain information

>gnl\|CDD\|201739 pfam01344, Kelch_1, Kelch motif	Back alignment and domain information

>gnl\|CDD\|177814 PLN02153, PLN02153, epithiospecifier protein	Back alignment and domain information

>gnl\|CDD\|222113 pfam13415, Kelch_3, Galactose oxidase, central domain	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|201739 pfam01344, Kelch_1, Kelch motif	Back alignment and domain information

>gnl\|CDD\|222419 pfam13854, Kelch_5, Kelch motif	Back alignment and domain information

>gnl\|CDD\|222419 pfam13854, Kelch_5, Kelch motif	Back alignment and domain information

>gnl\|CDD\|222983 PHA03098, PHA03098, kelch-like protein; Provisional	Back alignment and domain information

>gnl\|CDD\|222983 PHA03098, PHA03098, kelch-like protein; Provisional	Back alignment and domain information

>gnl\|CDD\|177814 PLN02153, PLN02153, epithiospecifier protein	Back alignment and domain information

>gnl\|CDD\|222113 pfam13415, Kelch_3, Galactose oxidase, central domain	Back alignment and domain information

>gnl\|CDD\|205596 pfam13418, Kelch_4, Galactose oxidase, central domain	Back alignment and domain information

>gnl\|CDD\|144972 pfam01576, Myosin_tail_1, Myosin tail	Back alignment and domain information

>gnl\|CDD\|222419 pfam13854, Kelch_5, Kelch motif	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|206134 pfam13964, Kelch_6, Kelch motif	Back alignment and domain information

>gnl\|CDD\|116261 pfam07646, Kelch_2, Kelch motif	Back alignment and domain information

>gnl\|CDD\|116261 pfam07646, Kelch_2, Kelch motif	Back alignment and domain information

>gnl\|CDD\|116261 pfam07646, Kelch_2, Kelch motif	Back alignment and domain information

>gnl\|CDD\|211835 TIGR03548, mutarot_permut, cyclically-permuted mutarotase family protein	Back alignment and domain information

>gnl\|CDD\|225597 COG3055, COG3055, Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		717
PLN02193		470	nitrile-specifier protein	100.0
PLN02153		341	epithiospecifier protein	100.0
KOG4441		571	consensus Proteins containing BTB/POZ and Kelch do	100.0
KOG4693		392	consensus Uncharacterized conserved protein, conta	100.0
KOG4441		571	consensus Proteins containing BTB/POZ and Kelch do	100.0
PLN02193		470	nitrile-specifier protein	100.0
PLN02153		341	epithiospecifier protein	100.0
PHA02713		557	hypothetical protein; Provisional	100.0
PHA02713		557	hypothetical protein; Provisional	100.0
KOG4693		392	consensus Uncharacterized conserved protein, conta	100.0
TIGR03547		346	muta_rot_YjhT mutatrotase, YjhT family. Members of	100.0
KOG0379		482	consensus Kelch repeat-containing proteins [Genera	100.0
PRK14131		376	N-acetylneuraminic acid mutarotase; Provisional	100.0
PHA03098		534	kelch-like protein; Provisional	100.0
TIGR03548		323	mutarot_permut cyclically-permuted mutatrotase fam	100.0
PHA03098		534	kelch-like protein; Provisional	100.0
TIGR03547		346	muta_rot_YjhT mutatrotase, YjhT family. Members of	100.0
TIGR03548		323	mutarot_permut cyclically-permuted mutatrotase fam	100.0
PRK14131		376	N-acetylneuraminic acid mutarotase; Provisional	100.0
KOG4152		830	consensus Host cell transcription factor HCFC1 [Ce	100.0
PHA02790		480	Kelch-like protein; Provisional	100.0
KOG0379		482	consensus Kelch repeat-containing proteins [Genera	99.98
PHA02790		480	Kelch-like protein; Provisional	99.97
KOG1230		521	consensus Protein containing repeated kelch motifs	99.97
KOG1230		521	consensus Protein containing repeated kelch motifs	99.97
KOG4152		830	consensus Host cell transcription factor HCFC1 [Ce	99.96
COG3055		381	Uncharacterized protein conserved in bacteria [Fun	99.74
COG3055		381	Uncharacterized protein conserved in bacteria [Fun	99.7
KOG2437		723	consensus Muskelin [Signal transduction mechanisms	99.6
KOG2437		723	consensus Muskelin [Signal transduction mechanisms	99.53
PF13964		50	Kelch_6: Kelch motif	98.95
PF03089		337	RAG2: Recombination activating protein 2; InterPro	98.87
PF13964		50	Kelch_6: Kelch motif	98.85
PLN02772		398	guanylate kinase	98.82
PF13415		49	Kelch_3: Galactose oxidase, central domain	98.68
PF01344		47	Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is	98.64
PF01344		47	Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is	98.64
PF13415		49	Kelch_3: Galactose oxidase, central domain	98.63
PLN02772		398	guanylate kinase	98.62
PF13418		49	Kelch_4: Galactose oxidase, central domain; PDB: 2	98.6
PF07646		49	Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is	98.57
PF07646		49	Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is	98.53
PF07250		243	Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP	98.52
PF03089		337	RAG2: Recombination activating protein 2; InterPro	98.49
PF13418		49	Kelch_4: Galactose oxidase, central domain; PDB: 2	98.48
PF13854		42	Kelch_5: Kelch motif	98.39
PF13854		42	Kelch_5: Kelch motif	98.32
smart00612		47	Kelch Kelch domain.	98.25
smart00612		47	Kelch Kelch domain.	98.09
TIGR01640		230	F_box_assoc_1 F-box protein interaction domain. Th	98.09
TIGR01640		230	F_box_assoc_1 F-box protein interaction domain. Th	98.03
PF07250		243	Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP	97.9
PRK11138		394	outer membrane biogenesis protein BamB; Provisiona	97.8
PRK11138		394	outer membrane biogenesis protein BamB; Provisiona	97.57
PF13360		238	PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A	97.39
TIGR03300		377	assembly_YfgL outer membrane assembly lipoprotein	97.29
TIGR03300		377	assembly_YfgL outer membrane assembly lipoprotein	97.1
PF13360		238	PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A	97.07
PF08450		246	SGL: SMP-30/Gluconolaconase/LRE-like region; Inter	97.04
TIGR03866		300	PQQ_ABC_repeats PQQ-dependent catabolism-associate	96.94
PRK13684		334	Ycf48-like protein; Provisional	96.92
PF14870		302	PSII_BNR: Photosynthesis system II assembly factor	96.61
PRK04792		448	tolB translocation protein TolB; Provisional	96.56
PF07893		342	DUF1668: Protein of unknown function (DUF1668); In	96.11
TIGR02800		417	propeller_TolB tol-pal system beta propeller repea	96.08
PF12768		281	Rax2: Cortical protein marker for cell polarity	96.01
KOG0310		487	consensus Conserved WD40 repeat-containing protein	96.0
KOG0161		1930	consensus Myosin class II heavy chain [Cytoskeleto	96.0
PF12768		281	Rax2: Cortical protein marker for cell polarity	95.92
PF07893		342	DUF1668: Protein of unknown function (DUF1668); In	95.88
PRK13684		334	Ycf48-like protein; Provisional	95.87
cd00216		488	PQQ_DH Dehydrogenases with pyrrolo-quinoline quino	95.85
PRK05137		435	tolB translocation protein TolB; Provisional	95.77
PTZ00421		493	coronin; Provisional	95.69
PF10282		345	Lactonase: Lactonase, 7-bladed beta-propeller; Int	95.67
PF14870		302	PSII_BNR: Photosynthesis system II assembly factor	95.63
PRK04922		433	tolB translocation protein TolB; Provisional	95.59
cd00200		289	WD40 WD40 domain, found in a number of eukaryotic	95.51
KOG2055		514	consensus WD40 repeat protein [General function pr	95.49
KOG2055		514	consensus WD40 repeat protein [General function pr	95.39
PRK00178		430	tolB translocation protein TolB; Provisional	95.34
PF08450		246	SGL: SMP-30/Gluconolaconase/LRE-like region; Inter	95.19
PRK05137		435	tolB translocation protein TolB; Provisional	94.98
PRK03629		429	tolB translocation protein TolB; Provisional	94.97
PRK11028		330	6-phosphogluconolactonase; Provisional	94.97
PRK00178		430	tolB translocation protein TolB; Provisional	94.87
cd00216		488	PQQ_DH Dehydrogenases with pyrrolo-quinoline quino	94.85
TIGR03075		527	PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan	94.84
TIGR03866		300	PQQ_ABC_repeats PQQ-dependent catabolism-associate	94.84
PRK02889		427	tolB translocation protein TolB; Provisional	94.81
PLN00033		398	photosystem II stability/assembly factor; Provisio	94.79
TIGR03075		527	PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan	94.61
cd00094		194	HX Hemopexin-like repeats.; Hemopexin is a heme-bi	94.43
PRK04792		448	tolB translocation protein TolB; Provisional	94.36
PF02897		414	Peptidase_S9_N: Prolyl oligopeptidase, N-terminal	94.35
TIGR02800		417	propeller_TolB tol-pal system beta propeller repea	94.32
PF07888		546	CALCOCO1: Calcium binding and coiled-coil domain (	94.09
PRK04043		419	tolB translocation protein TolB; Provisional	93.98
PF02191		250	OLF: Olfactomedin-like domain; InterPro: IPR003112	93.93
PRK04922		433	tolB translocation protein TolB; Provisional	93.92
PLN00181		793	protein SPA1-RELATED; Provisional	93.41
PLN00181		793	protein SPA1-RELATED; Provisional	93.27
PF05096		264	Glu_cyclase_2: Glutamine cyclotransferase; InterPr	93.07
cd00094		194	HX Hemopexin-like repeats.; Hemopexin is a heme-bi	93.05
cd00200		289	WD40 WD40 domain, found in a number of eukaryotic	93.0
PRK04043		419	tolB translocation protein TolB; Provisional	92.93
PRK01742		429	tolB translocation protein TolB; Provisional	92.53
PTZ00421		493	coronin; Provisional	92.38
KOG0310		487	consensus Conserved WD40 repeat-containing protein	92.35
PF10186		302	Atg14: UV radiation resistance protein and autopha	92.06
COG1520		370	FOG: WD40-like repeat [Function unknown]	91.78
PF15188		85	CCDC-167: Coiled-coil domain-containing protein 16	91.55
PRK03629		429	tolB translocation protein TolB; Provisional	91.52
PF10282		345	Lactonase: Lactonase, 7-bladed beta-propeller; Int	91.45
PRK10884		206	SH3 domain-containing protein; Provisional	91.31
PF02191		250	OLF: Olfactomedin-like domain; InterPro: IPR003112	91.3
KOG2048		691	consensus WD40 repeat protein [General function pr	91.05
PRK02889		427	tolB translocation protein TolB; Provisional	91.03
COG4946		668	Uncharacterized protein related to the periplasmic	90.82
KOG3478		120	consensus Prefoldin subunit 6, KE2 family [Posttra	90.81
KOG0646		476	consensus WD40 repeat protein [General function pr	90.61
PF13094		160	CENP-Q: CENP-Q, a CENPA-CAD centromere complex sub	90.6
PF13851		201	GAS: Growth-arrest specific micro-tubule binding	90.47
PF08581		79	Tup_N: Tup N-terminal; InterPro: IPR013890 The N-t	90.12
PF02897		414	Peptidase_S9_N: Prolyl oligopeptidase, N-terminal	90.07
PF08268		129	FBA_3: F-box associated domain; InterPro: IPR01318	89.99
KOG2321		703	consensus WD40 repeat protein [General function pr	89.97
PF13088		275	BNR_2: BNR repeat-like domain; PDB: 2F11_A 2F0Z_A	89.64
PF05096		264	Glu_cyclase_2: Glutamine cyclotransferase; InterPr	89.32
PRK11028		330	6-phosphogluconolactonase; Provisional	89.0
COG4946		668	Uncharacterized protein related to the periplasmic	89.0
KOG0977		546	consensus Nuclear envelope protein lamin, intermed	88.91
PTZ00420		568	coronin; Provisional	88.91
KOG0933		1174	consensus Structural maintenance of chromosome pro	88.74
smart00284		255	OLF Olfactomedin-like domains.	88.62
PRK01742		429	tolB translocation protein TolB; Provisional	88.13
PF13851		201	GAS: Growth-arrest specific micro-tubule binding	87.77
PLN02919		1057	haloacid dehalogenase-like hydrolase family protei	87.56
TIGR03074		764	PQQ_membr_DH membrane-bound PQQ-dependent dehydrog	87.46
PRK11281		1113	hypothetical protein; Provisional	87.42
PLN00033		398	photosystem II stability/assembly factor; Provisio	87.08
KOG4673		961	consensus Transcription factor TMF, TATA element m	87.03
PF03178		321	CPSF_A: CPSF A subunit region; InterPro: IPR004871	86.67
PF02239		369	Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO	86.54
PF07888		546	CALCOCO1: Calcium binding and coiled-coil domain (	86.53
PLN02919		1057	haloacid dehalogenase-like hydrolase family protei	86.53
PF12217		367	End_beta_propel: Catalytic beta propeller domain o	85.78
PF08268		129	FBA_3: F-box associated domain; InterPro: IPR01318	85.7
PF04880		166	NUDE_C: NUDE protein, C-terminal conserved region;	85.69
PRK11637		428	AmiB activator; Provisional	85.65
PF04111		314	APG6: Autophagy protein Apg6; InterPro: IPR007243	85.29
PF08826		61	DMPK_coil: DMPK coiled coil domain like; InterPro:	84.83
smart00787		312	Spc7 Spc7 kinetochore protein. This domain is foun	84.7
KOG0649		325	consensus WD40 repeat protein [General function pr	84.13
PF05266		190	DUF724: Protein of unknown function (DUF724); Inte	83.99
PF10186		302	Atg14: UV radiation resistance protein and autopha	83.96
PF12329		74	TMF_DNA_bd: TATA element modulatory factor 1 DNA b	83.95
TIGR02169		1164	SMC_prok_A chromosome segregation protein SMC, pri	83.77
COG1196		1163	Smc Chromosome segregation ATPases [Cell division	83.68
KOG0306		888	consensus WD40-repeat-containing subunit of the 18	83.67
TIGR02658		352	TTQ_MADH_Hv methylamine dehydrogenase heavy chain.	83.57
KOG0316		307	consensus Conserved WD40 repeat-containing protein	83.42
PF08317		325	Spc7: Spc7 kinetochore protein; InterPro: IPR01325	83.3
PF12718		143	Tropomyosin_1: Tropomyosin like; InterPro: IPR0005	83.23
KOG0993		542	consensus Rab5 GTPase effector Rabaptin-5 [Intrace	83.21
KOG1899		861	consensus LAR transmembrane tyrosine phosphatase-i	82.67
KOG3215		222	consensus Uncharacterized conserved protein [Funct	82.67
PF00261		237	Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop	82.51
PRK09039		343	hypothetical protein; Validated	82.44
PF12777		344	MT: Microtubule-binding stalk of dynein motor; Int	81.42
COG4257		353	Vgb Streptogramin lyase [Defense mechanisms]	81.19
PF03178		321	CPSF_A: CPSF A subunit region; InterPro: IPR004871	81.19
PRK11281		1113	hypothetical protein; Provisional	80.81
PF14197		69	Cep57_CLD_2: Centrosome localisation domain of PPC	80.41
PF05529		192	Bap31: B-cell receptor-associated protein 31-like	80.15

>PLN02193 nitrile-specifier protein	Back alignment and domain information

Probab=100.00  E-value=1.7e-42  Score=391.39  Aligned_cols=336  Identities=19%  Similarity=0.300  Sum_probs=267.1

Q ss_pred             CCCEEEEEcCCCCCCCCccccccccccCCCCCCCCCeEEeeecCCCCCCcceeEEEEECCEEEEEcccCC-CC-CcccEE
Q 005043           40 NSECVAPSSNHADDRDCECTIAGPEVSNGTSGNSENWMVLSIAGDKPIPRFNHAAAVIGNKMIVVGGESG-NG-LLDDVQ  117 (717)
Q Consensus        40 ~~~~i~l~GG~~~~~~~~~~~~~~~~~~~~~~~s~~W~~l~~~g~~P~~R~~haav~~~~~lyV~GG~~~-~~-~~~~v~  117 (717)
                      .+..|+.|+|+..+..  ....+|..........++|..++..+.+|.||.+|++++++++||||||... .. ..+++|
T Consensus       119 ~~~~ivgf~G~~~~~~--~~ig~y~~~~~~~~~~~~W~~~~~~~~~P~pR~~h~~~~~~~~iyv~GG~~~~~~~~~~~v~  196 (470)
T PLN02193        119 QGGKIVGFHGRSTDVL--HSLGAYISLPSTPKLLGKWIKVEQKGEGPGLRCSHGIAQVGNKIYSFGGEFTPNQPIDKHLY  196 (470)
T ss_pred             cCCeEEEEeccCCCcE--EeeEEEEecCCChhhhceEEEcccCCCCCCCccccEEEEECCEEEEECCcCCCCCCeeCcEE
Confidence            3677899999766541  2222232211111124899999876678999999999999999999999753 22 347899


Q ss_pred             EEEcCCCceEEccccccCCCCCCCCCCCcccceEEEEECCEEEEEeccCCCCCCceEEEEEECCCCcEEEeeecCCCCCC
Q 005043          118 VLNFDRFSWTAASSKLYLSPSSLPLKIPACRGHSLISWGKKVLLVGGKTDSGSDRVSVWTFDTETECWSVVEAKGDIPVA  197 (717)
Q Consensus       118 ~yd~~t~~W~~l~~~~~~~~~~~~~~~p~r~~hs~v~~~~~Iyv~GG~~~~~~~~~~v~~yD~~t~~W~~l~~~g~~P~~  197 (717)
                      +||+.+++|..++++..       .|.++|.+|++++++++||||||... ....+++|+||+.+++|+.+++.+..|.+
T Consensus       197 ~yD~~~~~W~~~~~~g~-------~P~~~~~~~~~v~~~~~lYvfGG~~~-~~~~ndv~~yD~~t~~W~~l~~~~~~P~~  268 (470)
T PLN02193        197 VFDLETRTWSISPATGD-------VPHLSCLGVRMVSIGSTLYVFGGRDA-SRQYNGFYSFDTTTNEWKLLTPVEEGPTP  268 (470)
T ss_pred             EEECCCCEEEeCCCCCC-------CCCCcccceEEEEECCEEEEECCCCC-CCCCccEEEEECCCCEEEEcCcCCCCCCC
Confidence            99999999998765311       22234668999999999999999864 34578999999999999999875555899


Q ss_pred             ceeeEEEEECCEEEEEccccCCCCCcCcEEEEEcCCCceEeccCCCCCCCCCcccEEEEECCcEEEEEcCCCCCCCCCeE
Q 005043          198 RSGHTVVRASSVLILFGGEDGKRRKLNDLHMFDLKSLTWLPLHCTGTGPSPRSNHVAALYDDKNLLIFGGSSKSKTLNDL  277 (717)
Q Consensus       198 R~~hs~~~~~~~Lyv~GG~~~~~~~~~~v~~yD~~t~~W~~l~~~g~~P~~R~~~aa~~~~~~~lyV~GG~~~~~~~ndv  277 (717)
                      |+.|+++.++++||||||.+.. ..++++++||+.+++|+.++..+.+|.+|..|++++++++ |||+||.++. ..+++
T Consensus       269 R~~h~~~~~~~~iYv~GG~~~~-~~~~~~~~yd~~t~~W~~~~~~~~~~~~R~~~~~~~~~gk-iyviGG~~g~-~~~dv  345 (470)
T PLN02193        269 RSFHSMAADEENVYVFGGVSAT-ARLKTLDSYNIVDKKWFHCSTPGDSFSIRGGAGLEVVQGK-VWVVYGFNGC-EVDDV  345 (470)
T ss_pred             ccceEEEEECCEEEEECCCCCC-CCcceEEEEECCCCEEEeCCCCCCCCCCCCCcEEEEECCc-EEEEECCCCC-ccCce
Confidence            9999999999999999999765 4678999999999999999876778899999999999988 9999998654 46899


Q ss_pred             EEEECCCCcEEEeecCCCCCCCCcceEEEEECCEEEEEecCCC---------CCccCeEEEEECCCCcEEEeecCCC--C
Q 005043          278 YSLDFETMIWTRIKIRGFHPSPRAGCCGVLCGTKWYIAGGGSR---------KKRHAETLIFDILKGEWSVAITSPS--S  346 (717)
Q Consensus       278 ~~yd~~t~~W~~v~~~g~~P~~R~~~sav~~~~~IyV~GG~~~---------~~~~~dv~~yD~~t~~W~~l~~~p~--~  346 (717)
                      ++||+.+++|+.+...+..|.+|..|+++.++++|||+||...         ....+++|+||+.+++|+.+...+.  .
T Consensus       346 ~~yD~~t~~W~~~~~~g~~P~~R~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~~~ndv~~~D~~t~~W~~~~~~~~~~~  425 (470)
T PLN02193        346 HYYDPVQDKWTQVETFGVRPSERSVFASAAVGKHIVIFGGEIAMDPLAHVGPGQLTDGTFALDTETLQWERLDKFGEEEE  425 (470)
T ss_pred             EEEECCCCEEEEeccCCCCCCCcceeEEEEECCEEEEECCccCCccccccCccceeccEEEEEcCcCEEEEcccCCCCCC
Confidence            9999999999999887778999999999999999999999753         1245789999999999999875432  3


Q ss_pred             CCCCCcceEEEEEEeCCCcEEEEEcCCCC--CCCCeEEEEEccC
Q 005043          347 SVTSNKGFTLVLVQHKEKDFLVAFGGIKK--EPSNQVEVLSIEK  388 (717)
Q Consensus       347 ~~~~r~g~s~v~v~~~~~~~I~v~GG~~~--~~~n~v~vyd~~~  388 (717)
                      .|.+|..++++.....+++.|++|||+..  ...+|+|.|++++
T Consensus       426 ~P~~R~~~~~~~~~~~~~~~~~~fGG~~~~~~~~~D~~~~~~~~  469 (470)
T PLN02193        426 TPSSRGWTASTTGTIDGKKGLVMHGGKAPTNDRFDDLFFYGIDS  469 (470)
T ss_pred             CCCCCccccceeeEEcCCceEEEEcCCCCccccccceEEEecCC
Confidence            45677666554433334567999999964  4489999998765

>PLN02153 epithiospecifier protein	Back alignment and domain information

>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only]	Back alignment and domain information

>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only]	Back alignment and domain information

>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only]	Back alignment and domain information

>PLN02193 nitrile-specifier protein	Back alignment and domain information

>PLN02153 epithiospecifier protein	Back alignment and domain information

>PHA02713 hypothetical protein; Provisional	Back alignment and domain information

>PHA02713 hypothetical protein; Provisional	Back alignment and domain information

>KOG4693 consensus Uncharacterized conserved protein, contains kelch repeat [General function prediction only]	Back alignment and domain information

>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family	Back alignment and domain information

>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only]	Back alignment and domain information

>PRK14131 N-acetylneuraminic acid mutarotase; Provisional	Back alignment and domain information

>PHA03098 kelch-like protein; Provisional	Back alignment and domain information

>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein	Back alignment and domain information

>PHA03098 kelch-like protein; Provisional	Back alignment and domain information

>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family	Back alignment and domain information

>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein	Back alignment and domain information

>PRK14131 N-acetylneuraminic acid mutarotase; Provisional	Back alignment and domain information

>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription]	Back alignment and domain information

>PHA02790 Kelch-like protein; Provisional	Back alignment and domain information

>KOG0379 consensus Kelch repeat-containing proteins [General function prediction only]	Back alignment and domain information

>PHA02790 Kelch-like protein; Provisional	Back alignment and domain information

>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only]	Back alignment and domain information

>KOG1230 consensus Protein containing repeated kelch motifs [General function prediction only]	Back alignment and domain information

>KOG4152 consensus Host cell transcription factor HCFC1 [Cell cycle control, cell division, chromosome partitioning; Transcription]	Back alignment and domain information

>COG3055 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>COG3055 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>KOG2437 consensus Muskelin [Signal transduction mechanisms]	Back alignment and domain information

>KOG2437 consensus Muskelin [Signal transduction mechanisms]	Back alignment and domain information

>PF13964 Kelch_6: Kelch motif	Back alignment and domain information

>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination	Back alignment and domain information

>PF13964 Kelch_6: Kelch motif	Back alignment and domain information

>PLN02772 guanylate kinase	Back alignment and domain information

>PF13415 Kelch_3: Galactose oxidase, central domain	Back alignment and domain information

>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified []	Back alignment and domain information

>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified []	Back alignment and domain information

>PF13415 Kelch_3: Galactose oxidase, central domain	Back alignment and domain information

>PLN02772 guanylate kinase	Back alignment and domain information

>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B	Back alignment and domain information

>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified []	Back alignment and domain information

>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified []	Back alignment and domain information

>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes	Back alignment and domain information

>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination	Back alignment and domain information

>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B	Back alignment and domain information

>PF13854 Kelch_5: Kelch motif	Back alignment and domain information

>PF13854 Kelch_5: Kelch motif	Back alignment and domain information

>smart00612 Kelch Kelch domain	Back alignment and domain information

>smart00612 Kelch Kelch domain	Back alignment and domain information

>TIGR01640 F_box_assoc_1 F-box protein interaction domain	Back alignment and domain information

>TIGR01640 F_box_assoc_1 F-box protein interaction domain	Back alignment and domain information

>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes	Back alignment and domain information

>PRK11138 outer membrane biogenesis protein BamB; Provisional	Back alignment and domain information

>PRK11138 outer membrane biogenesis protein BamB; Provisional	Back alignment and domain information

>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A	Back alignment and domain information

>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL	Back alignment and domain information

>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL	Back alignment and domain information

>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A	Back alignment and domain information

>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species	Back alignment and domain information

>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein	Back alignment and domain information

>PRK13684 Ycf48-like protein; Provisional	Back alignment and domain information

>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A	Back alignment and domain information

>PRK04792 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function	Back alignment and domain information

>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB	Back alignment and domain information

>PF12768 Rax2: Cortical protein marker for cell polarity	Back alignment and domain information

>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton]	Back alignment and domain information

>PF12768 Rax2: Cortical protein marker for cell polarity	Back alignment and domain information

>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function	Back alignment and domain information

>PRK13684 Ycf48-like protein; Provisional	Back alignment and domain information

>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases	Back alignment and domain information

>PRK05137 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PTZ00421 coronin; Provisional	Back alignment and domain information

>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3	Back alignment and domain information

>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A	Back alignment and domain information

>PRK04922 tolB translocation protein TolB; Provisional	Back alignment and domain information

>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto

Back alignment and domain information

>KOG2055 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG2055 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PRK00178 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species	Back alignment and domain information

>PRK05137 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK03629 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK11028 6-phosphogluconolactonase; Provisional	Back alignment and domain information

>PRK00178 tolB translocation protein TolB; Provisional	Back alignment and domain information

>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases	Back alignment and domain information

>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family	Back alignment and domain information

>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein	Back alignment and domain information

>PRK02889 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PLN00033 photosystem II stability/assembly factor; Provisional	Back alignment and domain information

>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family	Back alignment and domain information

>cd00094 HX Hemopexin-like repeats	Back alignment and domain information

>PRK04792 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB	Back alignment and domain information

>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT)	Back alignment and domain information

>PRK04043 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium []	Back alignment and domain information

>PRK04922 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PLN00181 protein SPA1-RELATED; Provisional	Back alignment and domain information

>PLN00181 protein SPA1-RELATED; Provisional	Back alignment and domain information

>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2	Back alignment and domain information

>cd00094 HX Hemopexin-like repeats	Back alignment and domain information

Back alignment and domain information

>PRK04043 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK01742 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PTZ00421 coronin; Provisional	Back alignment and domain information

>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking	Back alignment and domain information

>COG1520 FOG: WD40-like repeat [Function unknown]	Back alignment and domain information

>PF15188 CCDC-167: Coiled-coil domain-containing protein 167	Back alignment and domain information

>PRK03629 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3	Back alignment and domain information

>PRK10884 SH3 domain-containing protein; Provisional	Back alignment and domain information

>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium []	Back alignment and domain information

>KOG2048 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PRK02889 tolB translocation protein TolB; Provisional	Back alignment and domain information

>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown]	Back alignment and domain information

>KOG3478 consensus Prefoldin subunit 6, KE2 family [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0646 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PF13094 CENP-Q: CENP-Q, a CENPA-CAD centromere complex subunit	Back alignment and domain information

>PF13851 GAS: Growth-arrest specific micro-tubule binding	Back alignment and domain information

>PF08581 Tup_N: Tup N-terminal; InterPro: IPR013890 The N-terminal region of the Tup protein has been shown to interact with the Ssn6 transcriptional co-repressor []	Back alignment and domain information

>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants	Back alignment and domain information

>KOG2321 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PF13088 BNR_2: BNR repeat-like domain; PDB: 2F11_A 2F0Z_A 1VCU_B 2F25_B 1SO7_A 2F29_A 1SNT_A 2F13_A 2F28_A 2F27_A	Back alignment and domain information

>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2	Back alignment and domain information

>PRK11028 6-phosphogluconolactonase; Provisional	Back alignment and domain information

>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown]	Back alignment and domain information

>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure]	Back alignment and domain information

>PTZ00420 coronin; Provisional	Back alignment and domain information

>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>smart00284 OLF Olfactomedin-like domains	Back alignment and domain information

>PRK01742 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PF13851 GAS: Growth-arrest specific micro-tubule binding	Back alignment and domain information

>PLN02919 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family	Back alignment and domain information

>PRK11281 hypothetical protein; Provisional	Back alignment and domain information

>PLN00033 photosystem II stability/assembly factor; Provisional	Back alignment and domain information

>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription]	Back alignment and domain information

>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit	Back alignment and domain information

>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A	Back alignment and domain information

>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT)	Back alignment and domain information

>PLN02919 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>PF12217 End_beta_propel: Catalytic beta propeller domain of bacteriophage endosialidase; InterPro: IPR024428 This entry represents the beta propeller domain of endosialidases, which consists of catalytically active part of the enzymes	Back alignment and domain information

>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants	Back alignment and domain information

>PF04880 NUDE_C: NUDE protein, C-terminal conserved region; InterPro: IPR006964 This domain represents the C-terminal conserved region of NUDE proteins	Back alignment and domain information

>PRK11637 AmiB activator; Provisional	Back alignment and domain information

>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure	Back alignment and domain information

>smart00787 Spc7 Spc7 kinetochore protein	Back alignment and domain information

>KOG0649 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana	Back alignment and domain information

>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking	Back alignment and domain information

>PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures	Back alignment and domain information

>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain	Back alignment and domain information

>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association []	Back alignment and domain information

>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>KOG0993 consensus Rab5 GTPase effector Rabaptin-5 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only]	Back alignment and domain information

>KOG3215 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>PRK09039 hypothetical protein; Validated	Back alignment and domain information

>PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases	Back alignment and domain information

>COG4257 Vgb Streptogramin lyase [Defense mechanisms]	Back alignment and domain information

>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit	Back alignment and domain information

>PRK11281 hypothetical protein; Provisional	Back alignment and domain information

>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89	Back alignment and domain information

>PF05529 Bap31: B-cell receptor-associated protein 31-like ; InterPro: IPR008417 Bap31 is a polytopic integral protein of the endoplasmic reticulum membrane and a substrate of caspase-8	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		717
2woz_A		318	The Novel Beta-Propeller Of The Btb-Kelch Protein K		8e-04

>pdb|2WOZ|A Chain A, The Novel Beta-Propeller Of The Btb-Kelch Protein Krp1 Provides The Binding Site For Lasp-1 That Is Necessary For Pseudopodia Extension Length = 318

Back alignment and structure

Iteration: 1

Score = 42.4 bits (98), Expect = 8e-04, Method: Compositional matrix adjust. Identities = 47/186 (25%), Positives = 81/186 (43%), Gaps = 19/186 (10%) Query: 158 KVLLVGGK---TDSGSDRVSVWTFDTETECWSVVEAKGDIPVARSGHTVVRASSVLILFG 214 K+ +V GK T++ D SV +D WS V+ ++P+ GH V+ + ++ G Sbjct: 111 KIYVVAGKDLQTEASLD--SVLCYDPVAAKWSEVK---NLPIKVYGHNVISHNGMIYCLG 165 Query: 215 GEDGKRRKLNDLHMFDLKSLTWLPLHCTGTGPSPRSNHVAALYDDKNLLIFGGSSKSKTL 274 G+ ++ N + +++ K W L T PRS A++ K ++I GG ++ Sbjct: 166 GKTDDKKCTNRVFIYNPKKGDWKDLAPMKT---PRSMFGVAIHKGK-IVIAGGVTEDGLS 221 Query: 275 NDLYSLDFETMIWTRIKIRGFHPSPRAGCCGVLCGTKWYIAGGGS----RKKRHAETLIF 330 + + D +T W ++ P R+ V Y GG + K A T + Sbjct: 222 ASVEAFDLKTNKW---EVMTEFPQERSSISLVSLAGSLYAIGGFAMIQLESKEFAPTEVN 278 Query: 331 DILKGE 336 DI K E Sbjct: 279 DIWKYE 284

PyMOL of 2woz

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		717
2zwa_A		695	Leucine carboxyl methyltransferase 2; HET: SAH CIT	4e-41
2zwa_A		695	Leucine carboxyl methyltransferase 2; HET: SAH CIT	5e-40
2zwa_A		695	Leucine carboxyl methyltransferase 2; HET: SAH CIT	1e-26
3ii7_A		306	Kelch-like protein 7; protein-binding, kelch-repea	2e-32
3ii7_A		306	Kelch-like protein 7; protein-binding, kelch-repea	4e-20
3ii7_A		306	Kelch-like protein 7; protein-binding, kelch-repea	7e-16
2xn4_A		302	Kelch-like protein 2; structural protein, cytoskel	2e-32
2xn4_A		302	Kelch-like protein 2; structural protein, cytoskel	3e-25
2xn4_A		302	Kelch-like protein 2; structural protein, cytoskel	2e-13
2xn4_A		302	Kelch-like protein 2; structural protein, cytoskel	3e-08
2vpj_A		301	Kelch-like protein 12; adaptor protein, WNT signal	2e-32
2vpj_A		301	Kelch-like protein 12; adaptor protein, WNT signal	8e-26
2vpj_A		301	Kelch-like protein 12; adaptor protein, WNT signal	8e-25
2vpj_A		301	Kelch-like protein 12; adaptor protein, WNT signal	8e-22
2vpj_A		301	Kelch-like protein 12; adaptor protein, WNT signal	3e-20
1zgk_A		308	Kelch-like ECH-associated protein 1; beta-propelle	9e-32
1zgk_A		308	Kelch-like ECH-associated protein 1; beta-propelle	3e-28
1zgk_A		308	Kelch-like ECH-associated protein 1; beta-propelle	1e-25
4asc_A		315	Kelch repeat and BTB domain-containing protein 5;	7e-29
4asc_A		315	Kelch repeat and BTB domain-containing protein 5;	3e-26
4asc_A		315	Kelch repeat and BTB domain-containing protein 5;	2e-14
4asc_A		315	Kelch repeat and BTB domain-containing protein 5;	4e-14
2uvk_A		357	YJHT; unknown function, hypothetical protein, sial	8e-29
2uvk_A		357	YJHT; unknown function, hypothetical protein, sial	8e-26
2uvk_A		357	YJHT; unknown function, hypothetical protein, sial	4e-06
2woz_A		318	Kelch repeat and BTB domain-containing protein 10;	5e-28
2woz_A		318	Kelch repeat and BTB domain-containing protein 10;	5e-14
1k3i_A		656	Galactose oxidase precursor; blade beta propeller,	3e-08
1k3i_A		656	Galactose oxidase precursor; blade beta propeller,	4e-04
1c1g_A		284	Tropomyosin; contractIle protein; 7.00A {Sus scrof	2e-05
1c1g_A		284	Tropomyosin; contractIle protein; 7.00A {Sus scrof	2e-04
1c1g_A		284	Tropomyosin; contractIle protein; 7.00A {Sus scrof	3e-04
1c1g_A		284	Tropomyosin; contractIle protein; 7.00A {Sus scrof	6e-04
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	4e-05
2efr_A		155	General control protein GCN4 and tropomyosin 1 Al;	6e-05
2fxo_A		129	Myosin heavy chain, cardiac muscle beta isoform; c	1e-04
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	2e-04
3o0z_A		168	RHO-associated protein kinase 1; coiled-coil, tran	2e-04

>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695	Back alignment and structure

 Score =  159 bits (403), Expect = 4e-41
 Identities = 50/275 (18%), Positives = 87/275 (31%), Gaps = 35/275 (12%)

Query: 65  VSNGTSGNSENWMVLSIAGDKPIPRFNHAAAVIG--NKMIVVGGESGNG-LLDDVQVLNF 121
             +      +   +   + + P+ R  H    I   N+++++GG       L D  + + 
Sbjct: 416 QLSIHYDKIDMKNIEVSSSEVPVARMCHTFTTISRNNQLLLIGGRKAPHQGLSDNWIFDM 475

Query: 122 DRFSWTAASSKLYLSPSSLPLKIPACRGHSLISWGK-KVLLVGGKTDSGSDRVSVWTFDT 180
               W+           SL         HS  S     VL++GG T+  +    +  ++ 
Sbjct: 476 KTREWS--------MIKSLS---HTRFRHSACSLPDGNVLILGGVTEGPA----MLLYNV 520

Query: 181 ETECWSVVEAKGDIPVARSGHTVV----RASSVLILFGGEDGKRRKLNDLHMFDLK---- 232
             E +  V  K +          +     +   +IL GG   +    +   +F       
Sbjct: 521 TEEIFKDVTPKDEFFQNSLVSAGLEFDPVSKQGIILGGGFMDQTTVSDKAIIFKYDAENA 580

Query: 233 SLTWLPLHCTGTGPSPRSNHVAALYDDKNLLIFGGSSKSKTL---NDLYSLDFETMIWTR 289
           +     +         R          + LLI GG+S S      N + SLD  +   T 
Sbjct: 581 TEPITVIKKLQHPLFQRYGSQIKYITPRKLLIVGGTSPSGLFDRTNSIISLDPLSETLTS 640

Query: 290 IKI----RGFHPSPRAG-CCGVLCGTKWYIAGGGS 319
           I I       H    AG           +I GGG+
Sbjct: 641 IPISRRIWEDHSLMLAGFSLVSTSMGTIHIIGGGA 675

PyMOL of 2zwa

>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695	Back alignment and structure

>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695	Back alignment and structure

>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306	Back alignment and structure

>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306	Back alignment and structure

>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306	Back alignment and structure

>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302	Back alignment and structure

>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302	Back alignment and structure

>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302	Back alignment and structure

>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302	Back alignment and structure

>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301	Back alignment and structure

>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301	Back alignment and structure

>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301	Back alignment and structure

>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301	Back alignment and structure

>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301	Back alignment and structure

>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308	Back alignment and structure

>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308	Back alignment and structure

>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308	Back alignment and structure

>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315	Back alignment and structure

>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315	Back alignment and structure

>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315	Back alignment and structure

>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315	Back alignment and structure

>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357	Back alignment and structure

>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357	Back alignment and structure

>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357	Back alignment and structure

>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318	Back alignment and structure

>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318	Back alignment and structure

>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656	Back alignment and structure

>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656	Back alignment and structure

>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284	Back alignment and structure

>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284	Back alignment and structure

>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284	Back alignment and structure

>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Length = 155	Back alignment and structure

>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Length = 129	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Length = 168	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		717
2xn4_A		302	Kelch-like protein 2; structural protein, cytoskel	100.0
1zgk_A		308	Kelch-like ECH-associated protein 1; beta-propelle	100.0
1zgk_A		308	Kelch-like ECH-associated protein 1; beta-propelle	100.0
3ii7_A		306	Kelch-like protein 7; protein-binding, kelch-repea	100.0
2vpj_A		301	Kelch-like protein 12; adaptor protein, WNT signal	100.0
3ii7_A		306	Kelch-like protein 7; protein-binding, kelch-repea	100.0
2xn4_A		302	Kelch-like protein 2; structural protein, cytoskel	100.0
2woz_A		318	Kelch repeat and BTB domain-containing protein 10;	100.0
4asc_A		315	Kelch repeat and BTB domain-containing protein 5;	100.0
2vpj_A		301	Kelch-like protein 12; adaptor protein, WNT signal	100.0
4asc_A		315	Kelch repeat and BTB domain-containing protein 5;	100.0
2uvk_A		357	YJHT; unknown function, hypothetical protein, sial	100.0
2woz_A		318	Kelch repeat and BTB domain-containing protein 10;	100.0
2uvk_A		357	YJHT; unknown function, hypothetical protein, sial	100.0
2zwa_A		695	Leucine carboxyl methyltransferase 2; HET: SAH CIT	100.0
2zwa_A		695	Leucine carboxyl methyltransferase 2; HET: SAH CIT	100.0
1k3i_A		656	Galactose oxidase precursor; blade beta propeller,	100.0
1k3i_A		656	Galactose oxidase precursor; blade beta propeller,	100.0
3dsm_A		328	Uncharacterized protein bacuni_02894; seven_blated	98.39
3dsm_A		328	Uncharacterized protein bacuni_02894; seven_blated	97.97
2ovr_B		445	FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40	97.79
3mbr_X		243	Glutamine cyclotransferase; beta-propeller; 1.44A	97.79
3mbr_X		243	Glutamine cyclotransferase; beta-propeller; 1.44A	97.75
3q7m_A		376	Lipoprotein YFGL, BAMB; beta-propeller, BAM comple	97.73
1l0q_A		391	Surface layer protein; SLP, S-layer, 7-bladed beta	97.73
1l0q_A		391	Surface layer protein; SLP, S-layer, 7-bladed beta	97.68
3bws_A		433	Protein LP49; two-domain, immunoglobulin-like, 7-b	97.58
3nol_A		262	Glutamine cyclotransferase; beta-propeller, glutam	97.55
3q7m_A		376	Lipoprotein YFGL, BAMB; beta-propeller, BAM comple	97.53
3bws_A		433	Protein LP49; two-domain, immunoglobulin-like, 7-b	97.48
3nol_A		262	Glutamine cyclotransferase; beta-propeller, glutam	97.45
1k8k_C		372	P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-	97.41
4ery_A		312	WD repeat-containing protein 5; WD40, WIN motif, b	97.4
3nok_A		268	Glutaminyl cyclase; beta-propeller, cyclotransfera	97.39
3vgz_A		353	Uncharacterized protein YNCE; beta-propeller, prot	97.37
2ovr_B		445	FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40	97.34
3jrp_A		379	Fusion protein of protein transport protein SEC13	97.33
4ery_A		312	WD repeat-containing protein 5; WD40, WIN motif, b	97.31
2hqs_A		415	Protein TOLB; TOLB, PAL, TOL, transport protein-li	97.3
1p22_A		435	F-BOX/WD-repeat protein 1A; ubiquitination, degrad	97.27
2ojh_A		297	Uncharacterized protein ATU1656/AGR_C_3050; TOLB,	97.27
2iwa_A		266	Glutamine cyclotransferase; pyroglutamate, acyltra	97.25
2iwa_A		266	Glutamine cyclotransferase; pyroglutamate, acyltra	97.24
1ri6_A		343	Putative isomerase YBHE; 7-bladed propeller, enzym	97.19
3vgz_A		353	Uncharacterized protein YNCE; beta-propeller, prot	97.16
4aez_A		401	CDC20, WD repeat-containing protein SLP1; cell cyc	97.13
3ow8_A		321	WD repeat-containing protein 61; structural genomi	97.12
1k8k_C		372	P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-	97.12
3e5z_A		296	Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco	97.1
1gxr_A		337	ESG1, transducin-like enhancer protein 1; transcri	97.02
2z2n_A		299	Virginiamycin B lyase; seven-bladed beta-propeller	97.02
4aez_A		401	CDC20, WD repeat-containing protein SLP1; cell cyc	97.01
1gxr_A		337	ESG1, transducin-like enhancer protein 1; transcri	97.0
1got_B		340	GT-beta; complex (GTP-binding/transducer), G prote	96.98
3v7d_B		464	Cell division control protein 4; WD 40 domain, pho	96.92
1r5m_A		425	SIR4-interacting protein SIF2; transcription corep	96.92
3ow8_A		321	WD repeat-containing protein 61; structural genomi	96.9
2z2n_A		299	Virginiamycin B lyase; seven-bladed beta-propeller	96.84
3v7d_B		464	Cell division control protein 4; WD 40 domain, pho	96.84
3hfq_A		347	Uncharacterized protein LP_2219; Q88V64_lacpl, NES	96.83
3scy_A		361	Hypothetical bacterial 6-phosphogluconolactonase;	96.8
3nok_A		268	Glutaminyl cyclase; beta-propeller, cyclotransfera	96.78
2xbg_A		327	YCF48-like protein; photosynthesis, photosystem II	96.74
1sq9_A		397	Antiviral protein SKI8; WD repeat, beta-transducin	96.73
3jrp_A		379	Fusion protein of protein transport protein SEC13	96.73
3jro_A		753	Fusion protein of protein transport protein SEC13	96.72
1r5m_A		425	SIR4-interacting protein SIF2; transcription corep	96.69
4gga_A		420	P55CDC, cell division cycle protein 20 homolog; ce	96.68
1got_B		340	GT-beta; complex (GTP-binding/transducer), G prote	96.67
1pjx_A		314	Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries	96.66
3u4y_A		331	Uncharacterized protein; structural genomics, PSI-	96.66
4gqb_B		344	Methylosome protein 50; TIM barrel, beta-propeller	96.65
3azo_A		662	Aminopeptidase; POP family, hydrolase; 2.00A {Stre	96.62
3hfq_A		347	Uncharacterized protein LP_2219; Q88V64_lacpl, NES	96.6
1rwi_B		270	Serine/threonine-protein kinase PKND; beta propell	96.59
3v9f_A		781	Two-component system sensor histidine kinase/RESP	96.58
1kb0_A		677	Quinohemoprotein alcohol dehydrogenase; beta-prope	96.57
3zwl_B		369	Eukaryotic translation initiation factor 3 subuni;	96.57
2xbg_A		327	YCF48-like protein; photosynthesis, photosystem II	96.56
3mkq_A		814	Coatomer beta'-subunit; beta-propeller, alpha-sole	96.56
1jmx_B		349	Amine dehydrogenase; oxidoreductase; HET: TRQ HEC;	96.55
2z3z_A		706	Dipeptidyl aminopeptidase IV; peptidase family S9,	96.52
2hqs_A		415	Protein TOLB; TOLB, PAL, TOL, transport protein-li	96.51
3vl1_A		420	26S proteasome regulatory subunit RPN14; beta-prop	96.5
3mkq_A		814	Coatomer beta'-subunit; beta-propeller, alpha-sole	96.48
3vl1_A		420	26S proteasome regulatory subunit RPN14; beta-prop	96.46
4g56_B		357	MGC81050 protein; protein arginine methyltransfera	96.45
3u4y_A		331	Uncharacterized protein; structural genomics, PSI-	96.4
1p22_A		435	F-BOX/WD-repeat protein 1A; ubiquitination, degrad	96.38
1sq9_A		397	Antiviral protein SKI8; WD repeat, beta-transducin	96.36
2ojh_A		297	Uncharacterized protein ATU1656/AGR_C_3050; TOLB,	96.35
2ecf_A		741	Dipeptidyl peptidase IV; prolyl oligopeptidase fam	96.34
3g4e_A		297	Regucalcin; six bladed beta-propeller, gluconolcat	96.33
2dg1_A		333	DRP35, lactonase; beta propeller, hydrolase; 1.72A	96.32
2qc5_A		300	Streptogramin B lactonase; beta propeller, lyase;	96.31
2z3z_A		706	Dipeptidyl aminopeptidase IV; peptidase family S9,	96.29
3odt_A		313	Protein DOA1; ubiquitin, nuclear protein; HET: MSE	96.28
2ynn_A		304	Coatomer subunit beta'; protein transport, peptide	96.26
3scy_A		361	Hypothetical bacterial 6-phosphogluconolactonase;	96.26
4e54_B		435	DNA damage-binding protein 2; beta barrel, double	96.25
3pe7_A		388	Oligogalacturonate lyase; seven-bladed beta-propel	96.23
4aow_A		340	Guanine nucleotide-binding protein subunit beta-2;	96.2
3dwl_C		377	Actin-related protein 2/3 complex subunit 1; prope	96.2
2pbi_B		354	Guanine nucleotide-binding protein subunit beta 5;	96.16
2vdu_B		450	TRNA (guanine-N(7)-)-methyltransferase- associated	96.14
2qc5_A		300	Streptogramin B lactonase; beta propeller, lyase;	96.13
3mmy_A		368	MRNA export factor; mRNA export, nuclear protein;	96.09
2hes_X		330	YDR267CP; beta-propeller, WD40 repeat, biosyntheti	96.09
2xdw_A		710	Prolyl endopeptidase; alpha/beta-hydrolase, amnesi	96.07
4a2l_A		795	BT_4663, two-component system sensor histidine kin	96.07
1yiq_A		689	Quinohemoprotein alcohol dehydrogenase; electron t	96.06
1kb0_A		677	Quinohemoprotein alcohol dehydrogenase; beta-prope	96.06
1vyh_C		410	Platelet-activating factor acetylhydrolase IB alph	96.05
2xdw_A		710	Prolyl endopeptidase; alpha/beta-hydrolase, amnesi	96.03
3jro_A		753	Fusion protein of protein transport protein SEC13	96.01
3k26_A		366	Polycomb protein EED; WD40, structural genomics, N	96.0
3iz6_a		380	40S ribosomal protein RACK1 (RACK1); eukaryotic ri	96.0
4a2l_A		795	BT_4663, two-component system sensor histidine kin	95.99
2ghs_A		326	AGR_C_1268P; regucalcin, structural genomics, join	95.99
2ecf_A		741	Dipeptidyl peptidase IV; prolyl oligopeptidase fam	95.98
3fvz_A		329	Peptidyl-glycine alpha-amidating monooxygenase; be	95.94
4a11_B		408	DNA excision repair protein ERCC-8; DNA binding pr	95.94
1yfq_A		342	Cell cycle arrest protein BUB3; WD repeat WD40 rep	95.93
3fm0_A		345	Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r	95.92
1nir_A		543	Nitrite reductase; hemoprotein, denitrification, d	95.92
1q7f_A		286	NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL	95.89
2pbi_B		354	Guanine nucleotide-binding protein subunit beta 5;	95.88
3v9f_A		781	Two-component system sensor histidine kinase/RESP	95.88
4a11_B		408	DNA excision repair protein ERCC-8; DNA binding pr	95.87
1ri6_A		343	Putative isomerase YBHE; 7-bladed propeller, enzym	95.86
1q7f_A		286	NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL	95.82
2aq5_A		402	Coronin-1A; WD40 repeat, 7-bladed beta-propeller,	95.79
3dr2_A		305	Exported gluconolactonase; gluconolactonase SMP-30	95.76
3azo_A		662	Aminopeptidase; POP family, hydrolase; 2.00A {Stre	95.74
2pm7_B		297	Protein transport protein SEC13, protein transport	95.74
4gqb_B		344	Methylosome protein 50; TIM barrel, beta-propeller	95.69
3pe7_A		388	Oligogalacturonate lyase; seven-bladed beta-propel	95.66
2ad6_A		571	Methanol dehydrogenase subunit 1; PQQ configuratio	95.64
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	95.57
1qks_A		567	Cytochrome CD1 nitrite reductase; enzyme, oxidored	95.54
1pby_B		337	Quinohemoprotein amine dehydrogenase 40 kDa subuni	95.49
1qhu_A		460	Protein (hemopexin); beta propeller, HAEM binding	95.47
3odt_A		313	Protein DOA1; ubiquitin, nuclear protein; HET: MSE	95.46
2pm9_A		416	Protein WEB1, protein transport protein SEC31; bet	95.44
1pby_B		337	Quinohemoprotein amine dehydrogenase 40 kDa subuni	95.44
4gga_A		420	P55CDC, cell division cycle protein 20 homolog; ce	95.38
1erj_A		393	Transcriptional repressor TUP1; beta-propeller, tr	95.36
1yiq_A		689	Quinohemoprotein alcohol dehydrogenase; electron t	95.35
2pm9_A		416	Protein WEB1, protein transport protein SEC31; bet	95.33
3f3f_A		351	Nucleoporin SEH1; structural protein, protein comp	95.31
3dwl_C		377	Actin-related protein 2/3 complex subunit 1; prope	95.3
1yr2_A		741	Prolyl oligopeptidase; prolyl endopeptidase, mecha	95.24
4g56_B		357	MGC81050 protein; protein arginine methyltransfera	95.08
1nir_A		543	Nitrite reductase; hemoprotein, denitrification, d	95.06
3fm0_A		345	Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r	95.06
1pgu_A		615	Actin interacting protein 1; WD repeat, seven-blad	94.98
1kv9_A		668	Type II quinohemoprotein alcohol dehydrogenase; el	94.98
3zwl_B		369	Eukaryotic translation initiation factor 3 subuni;	94.97
1vyh_C		410	Platelet-activating factor acetylhydrolase IB alph	94.93
2ad6_A		571	Methanol dehydrogenase subunit 1; PQQ configuratio	94.89
3c5m_A		396	Oligogalacturonate lyase; blade-shaped beta-propel	94.88
3e5z_A		296	Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco	94.85
3c5m_A		396	Oligogalacturonate lyase; blade-shaped beta-propel	94.84
1w6s_A		599	Methanol dehydrogenase subunit 1; anisotropic, ele	94.83
2bkl_A		695	Prolyl endopeptidase; mechanistic study, celiac sp	94.78
3ei3_B		383	DNA damage-binding protein 2; UV-damage, DDB, nucl	94.76
1pgu_A		615	Actin interacting protein 1; WD repeat, seven-blad	94.75
2aq5_A		402	Coronin-1A; WD40 repeat, 7-bladed beta-propeller,	94.69
4ggc_A		318	P55CDC, cell division cycle protein 20 homolog; ce	94.67
1rwi_B		270	Serine/threonine-protein kinase PKND; beta propell	94.67
3no2_A		276	Uncharacterized protein; six-bladed beta-propeller	94.62
2ynn_A		304	Coatomer subunit beta'; protein transport, peptide	94.61
3ei3_B		383	DNA damage-binding protein 2; UV-damage, DDB, nucl	94.52
3gre_A		437	Serine/threonine-protein kinase VPS15; seven-blade	94.48
4e54_B		435	DNA damage-binding protein 2; beta barrel, double	94.44
3g4e_A		297	Regucalcin; six bladed beta-propeller, gluconolcat	94.4
2vdu_B		450	TRNA (guanine-N(7)-)-methyltransferase- associated	94.33
1yr2_A		741	Prolyl oligopeptidase; prolyl endopeptidase, mecha	94.31
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	94.27
3ol1_A		119	Vimentin; structural genomics, PSI-2, protein stru	94.23
2mad_H		373	Methylamine dehydrogenase (heavy subunit); oxidore	94.22
1flg_A		582	Protein (quinoprotein ethanol dehydrogenase); supe	94.2
3iuj_A		693	Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas	94.2
2bkl_A		695	Prolyl endopeptidase; mechanistic study, celiac sp	94.17
3dm0_A		694	Maltose-binding periplasmic protein fused with RAC	94.14
3frx_A		319	Guanine nucleotide-binding protein subunit beta- l	94.09
3lrv_A		343	PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu	94.08
1jmx_B		349	Amine dehydrogenase; oxidoreductase; HET: TRQ HEC;	94.05
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	94.05
2hes_X		330	YDR267CP; beta-propeller, WD40 repeat, biosyntheti	94.04
3bg1_A		316	Protein SEC13 homolog; NPC, transport, WD repeat,	94.03
3lrv_A		343	PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu	94.0
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	94.0
1pjx_A		314	Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries	93.97
2xyi_A		430	Probable histone-binding protein CAF1; transcripti	93.92
1qks_A		567	Cytochrome CD1 nitrite reductase; enzyme, oxidored	93.91
3dm0_A		694	Maltose-binding periplasmic protein fused with RAC	93.82
2pm7_B		297	Protein transport protein SEC13, protein transport	93.65
1npe_A		267	Nidogen, entactin; glycoprotein, basement membrane	93.57
3no2_A		276	Uncharacterized protein; six-bladed beta-propeller	93.38
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	93.19
1yfq_A		342	Cell cycle arrest protein BUB3; WD repeat WD40 rep	93.01
2oiz_A		361	Aromatic amine dehydrogenase, large subunit; oxido	93.0
3iz6_a		380	40S ribosomal protein RACK1 (RACK1); eukaryotic ri	92.99
1kv9_A		668	Type II quinohemoprotein alcohol dehydrogenase; el	92.88
2fxo_A		129	Myosin heavy chain, cardiac muscle beta isoform; c	92.83
3i2n_A		357	WD repeat-containing protein 92; WD40 repeats, str	92.77
3f3f_A		351	Nucleoporin SEH1; structural protein, protein comp	92.73
1w6s_A		599	Methanol dehydrogenase subunit 1; anisotropic, ele	92.69
3fvz_A		329	Peptidyl-glycine alpha-amidating monooxygenase; be	92.58
3hrp_A		409	Uncharacterized protein; NP_812590.1, structural g	92.41
2ymu_A		577	WD-40 repeat protein; unknown function, two domain	92.38
4aow_A		340	Guanine nucleotide-binding protein subunit beta-2;	92.34
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	92.25
1erj_A		393	Transcriptional repressor TUP1; beta-propeller, tr	92.19
1pex_A		207	Collagenase-3, MMP-13; C-terminal hemopexin-like d	92.16
2dg1_A		333	DRP35, lactonase; beta propeller, hydrolase; 1.72A	92.04
1ic2_A		81	Tropomyosin alpha chain, skeletal muscle; alpha-he	92.03
1flg_A		582	Protein (quinoprotein ethanol dehydrogenase); supe	91.87
2ymu_A		577	WD-40 repeat protein; unknown function, two domain	91.83
4h5i_A		365	Guanine nucleotide-exchange factor SEC12; copii ve	91.77
3ott_A		758	Two-component system sensor histidine kinase; beta	91.77
1qhu_A		460	Protein (hemopexin); beta propeller, HAEM binding	91.59
3i2n_A		357	WD repeat-containing protein 92; WD40 repeats, str	91.58
2xyi_A		430	Probable histone-binding protein CAF1; transcripti	91.56
3b7f_A		394	Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop	91.56
2xzm_R		343	RACK1; ribosome, translation; 3.93A {Tetrahymena t	91.47
2p4o_A		306	Hypothetical protein; putative lactonase, structur	91.28
2fp8_A		322	Strictosidine synthase; six bladed beta propeller	91.19
3u59_A		101	Tropomyosin beta chain; muscle contraction, actin,	91.12
3u1c_A		101	Tropomyosin alpha-1 chain; anti-parallel coiled co	90.9
2cn3_A		737	Xyloglucanase, beta-1,4-xyloglucan hydrolase; glyc	90.6
3bg1_A		316	Protein SEC13 homolog; NPC, transport, WD repeat,	90.6
3b7f_A		394	Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop	90.56
3o4h_A		582	Acylamino-acid-releasing enzyme; alpha/beta hydrol	90.44
1k32_A		1045	Tricorn protease; protein degradation, substrate g	90.28
3c75_H		426	MADH, methylamine dehydrogenase heavy chain; coppe	90.07
3gre_A		437	Serine/threonine-protein kinase VPS15; seven-blade	89.9
3iuj_A		693	Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas	89.88
1itv_A		195	MMP9; adaptive molecular recognition, beta propell	89.85
3k26_A		366	Polycomb protein EED; WD40, structural genomics, N	89.84
2ocy_A		154	RAB guanine nucleotide exchange factor SEC2; RAB,	89.83
3dr2_A		305	Exported gluconolactonase; gluconolactonase SMP-30	89.81
3mmy_A		368	MRNA export factor; mRNA export, nuclear protein;	89.79
4ggc_A		318	P55CDC, cell division cycle protein 20 homolog; ce	89.72
2gop_A		347	Trilobed protease; beta propeller, open velcro, hy	89.54
1k32_A		1045	Tricorn protease; protein degradation, substrate g	89.46
2ghs_A		326	AGR_C_1268P; regucalcin, structural genomics, join	89.08
4h5i_A		365	Guanine nucleotide-exchange factor SEC12; copii ve	88.83
1c1g_A		284	Tropomyosin; contractIle protein; 7.00A {Sus scrof	88.69
2fp8_A		322	Strictosidine synthase; six bladed beta propeller	88.45
2mad_H		373	Methylamine dehydrogenase (heavy subunit); oxidore	88.21
3ott_A		758	Two-component system sensor histidine kinase; beta	88.2
3o4h_A		582	Acylamino-acid-releasing enzyme; alpha/beta hydrol	87.56
2p4o_A		306	Hypothetical protein; putative lactonase, structur	87.24
1nr0_A		611	Actin interacting protein 1; beta propeller, WD40	87.14
3u1c_A		101	Tropomyosin alpha-1 chain; anti-parallel coiled co	86.65
1pex_A		207	Collagenase-3, MMP-13; C-terminal hemopexin-like d	86.19
1c1g_A		284	Tropomyosin; contractIle protein; 7.00A {Sus scrof	86.17
3vkg_A		3245	Dynein heavy chain, cytoplasmic; AAA+ protein, mol	85.39
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	85.34
1xfd_A		723	DIP, dipeptidyl aminopeptidase-like protein 6, dip	85.31
3c75_H		426	MADH, methylamine dehydrogenase heavy chain; coppe	85.18
2gop_A		347	Trilobed protease; beta propeller, open velcro, hy	85.1
1ic2_A		81	Tropomyosin alpha chain, skeletal muscle; alpha-he	84.7
1itv_A		195	MMP9; adaptive molecular recognition, beta propell	84.52
2efr_A		155	General control protein GCN4 and tropomyosin 1 Al;	84.45
1sqj_A		789	OXG-RCBH, oligoxyloglucan reducing-END-specific ce	83.88
2no2_A		107	HIP-I, huntingtin-interacting protein 1; clathrin	83.63
1xfd_A		723	DIP, dipeptidyl aminopeptidase-like protein 6, dip	83.46
3a0f_A		763	Xyloglucanase; beta-propeller, hydrolase; 2.50A {G	83.18
3na7_A		256	HP0958; flagellar biogenesis, flagellum export, C4	83.12
3vkg_A		3245	Dynein heavy chain, cytoplasmic; AAA+ protein, mol	82.95
1ci6_A		63	Transcription factor ATF-4; BZIP; 2.60A {Homo sapi	82.64
3hnw_A		138	Uncharacterized protein; coiled-coil, structural g	82.43
3u59_A		101	Tropomyosin beta chain; muscle contraction, actin,	82.39
3na7_A		256	HP0958; flagellar biogenesis, flagellum export, C4	82.38
3frx_A		319	Guanine nucleotide-binding protein subunit beta- l	82.36
3c7x_A		196	Matrix metalloproteinase-14; membrane protein inte	82.33
2oiz_A		361	Aromatic amine dehydrogenase, large subunit; oxido	81.0
3uux_B		242	Mitochondrial division protein 1; tetratricopeptid	80.62
1gen_A		218	Gelatinase A; hydrolase, hemopexin domain, metallo	80.57
3ni0_A		99	Bone marrow stromal antigen 2; coiled-coil, antivi	80.25
2xe4_A		751	Oligopeptidase B; hydrolase-inhibitor complex, hyd	80.15

>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens}	Back alignment and structure

Probab=100.00  E-value=1.8e-43  Score=373.76  Aligned_cols=292  Identities=16%  Similarity=0.210  Sum_probs=248.7

Q ss_pred             CCCccCCCCCEEEEEcCCCCCCCCccccccccccCCCCCCCCCeEEeeecCCCCCCcceeEEEEECCEEEEEcccCCCCC
Q 005043           33 PKRNSNPNSECVAPSSNHADDRDCECTIAGPEVSNGTSGNSENWMVLSIAGDKPIPRFNHAAAVIGNKMIVVGGESGNGL  112 (717)
Q Consensus        33 ~~r~s~~~~~~i~l~GG~~~~~~~~~~~~~~~~~~~~~~~s~~W~~l~~~g~~P~~R~~haav~~~~~lyV~GG~~~~~~  112 (717)
                      .+|..+..++.||++||.....  ......|++      .++.|..++   ++|.+|.+|+++.++++|||+||.++...
T Consensus         7 ~~r~~~~~~~~i~v~GG~~~~~--~~~~~~~d~------~~~~W~~~~---~~p~~r~~~~~~~~~~~lyv~GG~~~~~~   75 (302)
T 2xn4_A            7 RLRTPMNLPKLMVVVGGQAPKA--IRSVECYDF------KEERWHQVA---ELPSRRCRAGMVYMAGLVFAVGGFNGSLR   75 (302)
T ss_dssp             --------CEEEEEECCBSSSB--CCCEEEEET------TTTEEEEEC---CCSSCCBSCEEEEETTEEEEESCBCSSSB
T ss_pred             cCCcccCCCCEEEEECCCCCCC--CCcEEEEcC------cCCcEeEcc---cCCcccccceEEEECCEEEEEeCcCCCcc
Confidence            4566677778899999954421  122233554      788999997   89999999999999999999999988778


Q ss_pred             cccEEEEEcCCCceEEccccccCCCCCCCCCCCcccceEEEEECCEEEEEeccCCCCCCceEEEEEECCCCcEEEeeecC
Q 005043          113 LDDVQVLNFDRFSWTAASSKLYLSPSSLPLKIPACRGHSLISWGKKVLLVGGKTDSGSDRVSVWTFDTETECWSVVEAKG  192 (717)
Q Consensus       113 ~~~v~~yd~~t~~W~~l~~~~~~~~~~~~~~~p~r~~hs~v~~~~~Iyv~GG~~~~~~~~~~v~~yD~~t~~W~~l~~~g  192 (717)
                      ++++++||+.+++|..++++           +.+|..|++++++++||++||... ....+++|+||+.+++|+.++   
T Consensus        76 ~~~~~~~d~~~~~W~~~~~~-----------p~~r~~~~~~~~~~~iyv~GG~~~-~~~~~~~~~~d~~~~~W~~~~---  140 (302)
T 2xn4_A           76 VRTVDSYDPVKDQWTSVANM-----------RDRRSTLGAAVLNGLLYAVGGFDG-STGLSSVEAYNIKSNEWFHVA---  140 (302)
T ss_dssp             CCCEEEEETTTTEEEEECCC-----------SSCCBSCEEEEETTEEEEEEEECS-SCEEEEEEEEETTTTEEEEEC---
T ss_pred             ccceEEECCCCCceeeCCCC-----------CccccceEEEEECCEEEEEcCCCC-CccCceEEEEeCCCCeEeecC---
Confidence            89999999999999999873           346778999999999999999864 345789999999999999997   


Q ss_pred             CCCCCceeeEEEEECCEEEEEccccCCC-CCcCcEEEEEcCCCceEeccCCCCCCCCCcccEEEEECCcEEEEEcCCCCC
Q 005043          193 DIPVARSGHTVVRASSVLILFGGEDGKR-RKLNDLHMFDLKSLTWLPLHCTGTGPSPRSNHVAALYDDKNLLIFGGSSKS  271 (717)
Q Consensus       193 ~~P~~R~~hs~~~~~~~Lyv~GG~~~~~-~~~~~v~~yD~~t~~W~~l~~~g~~P~~R~~~aa~~~~~~~lyV~GG~~~~  271 (717)
                      .+|.+|.+|++++++++||++||.+... ..++++++||+.+++|+.+.   ++|.+|..|++++++++ |||+||.+..
T Consensus       141 ~~p~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~yd~~~~~W~~~~---~~p~~r~~~~~~~~~~~-iyv~GG~~~~  216 (302)
T 2xn4_A          141 PMNTRRSSVGVGVVGGLLYAVGGYDVASRQCLSTVECYNATTNEWTYIA---EMSTRRSGAGVGVLNNL-LYAVGGHDGP  216 (302)
T ss_dssp             CCSSCCBSCEEEEETTEEEEECCEETTTTEECCCEEEEETTTTEEEEEC---CCSSCCBSCEEEEETTE-EEEECCBSSS
T ss_pred             CCCCcccCceEEEECCEEEEEeCCCCCCCccccEEEEEeCCCCcEEECC---CCccccccccEEEECCE-EEEECCCCCC
Confidence            4899999999999999999999997653 35789999999999999997   88999999999999888 9999999887


Q ss_pred             CCCCeEEEEECCCCcEEEeecCCCCCCCCcceEEEEECCEEEEEecCCCCCccCeEEEEECCCCcEEEeecCCCCCCCCC
Q 005043          272 KTLNDLYSLDFETMIWTRIKIRGFHPSPRAGCCGVLCGTKWYIAGGGSRKKRHAETLIFDILKGEWSVAITSPSSSVTSN  351 (717)
Q Consensus       272 ~~~ndv~~yd~~t~~W~~v~~~g~~P~~R~~~sav~~~~~IyV~GG~~~~~~~~dv~~yD~~t~~W~~l~~~p~~~~~~r  351 (717)
                      ...+++++||+.+++|+.+..+   |.+|.+|+++.++++|||+||.+.....+++++||+.+++|+.++   ..++.+|
T Consensus       217 ~~~~~~~~yd~~~~~W~~~~~~---~~~r~~~~~~~~~~~i~v~GG~~~~~~~~~v~~yd~~~~~W~~~~---~~~~~~r  290 (302)
T 2xn4_A          217 LVRKSVEVYDPTTNAWRQVADM---NMCRRNAGVCAVNGLLYVVGGDDGSCNLASVEYYNPTTDKWTVVS---SCMSTGR  290 (302)
T ss_dssp             SBCCCEEEEETTTTEEEEECCC---SSCCBSCEEEEETTEEEEECCBCSSSBCCCEEEEETTTTEEEECS---SCCSSCC
T ss_pred             cccceEEEEeCCCCCEeeCCCC---CCccccCeEEEECCEEEEECCcCCCcccccEEEEcCCCCeEEECC---cccCccc
Confidence            7789999999999999999754   889999999999999999999987777899999999999999985   2456789


Q ss_pred             cceEEEEEE
Q 005043          352 KGFTLVLVQ  360 (717)
Q Consensus       352 ~g~s~v~v~  360 (717)
                      .+|+++++.
T Consensus       291 ~~~~~~~~~  299 (302)
T 2xn4_A          291 SYAGVTVID  299 (302)
T ss_dssp             BSCEEEEEE
T ss_pred             ccceEEEec
Confidence            999999883

PyMOL of 2xn4

>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A	Back alignment and structure

>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A	Back alignment and structure

>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens}	Back alignment and structure

>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens}	Back alignment and structure

>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens}	Back alignment and structure

>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens}	Back alignment and structure

>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus}	Back alignment and structure

>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens}	Back alignment and structure

>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens}	Back alignment and structure

>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens}	Back alignment and structure

>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli}	Back alignment and structure

>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus}	Back alignment and structure

>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli}	Back alignment and structure

>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A*	Back alignment and structure

>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A*	Back alignment and structure

>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A	Back alignment and structure

>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A	Back alignment and structure

>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis}	Back alignment and structure

>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis}	Back alignment and structure

>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B*	Back alignment and structure

>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris}	Back alignment and structure

>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris}	Back alignment and structure

>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A	Back alignment and structure

>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3	Back alignment and structure

>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3	Back alignment and structure

>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans}	Back alignment and structure

>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A	Back alignment and structure

>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A	Back alignment and structure

>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans}	Back alignment and structure

>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A	Back alignment and structure

>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C	Back alignment and structure

>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ...	Back alignment and structure

>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus}	Back alignment and structure

>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A*	Back alignment and structure

>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B*	Back alignment and structure

>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ...	Back alignment and structure

>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A	Back alignment and structure

>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1	Back alignment and structure

>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str}	Back alignment and structure

>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A*	Back alignment and structure

>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A*	Back alignment and structure

>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1	Back alignment and structure

>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A*	Back alignment and structure

>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe}	Back alignment and structure

>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens}	Back alignment and structure

>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C	Back alignment and structure

>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans}	Back alignment and structure

>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A	Back alignment and structure

>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A*	Back alignment and structure

>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe}	Back alignment and structure

>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A	Back alignment and structure

>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B*	Back alignment and structure

>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B*	Back alignment and structure

>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae}	Back alignment and structure

>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens}	Back alignment and structure

>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A*	Back alignment and structure

>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B*	Back alignment and structure

>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum}	Back alignment and structure

>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A	Back alignment and structure

>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus}	Back alignment and structure

>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus}	Back alignment and structure

>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X	Back alignment and structure

>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae}	Back alignment and structure

>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae}	Back alignment and structure

>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A	Back alignment and structure

>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B*	Back alignment and structure

>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ...	Back alignment and structure

>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans}	Back alignment and structure

>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens}	Back alignment and structure

>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A	Back alignment and structure

>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum}	Back alignment and structure

>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A	Back alignment and structure

>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron}	Back alignment and structure

>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1	Back alignment and structure

>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae}	Back alignment and structure

>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus}	Back alignment and structure

>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A	Back alignment and structure

>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B*	Back alignment and structure

>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A*	Back alignment and structure

>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A	Back alignment and structure

>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A	Back alignment and structure

>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A	Back alignment and structure

>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A	Back alignment and structure

>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis}	Back alignment and structure

>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans}	Back alignment and structure

>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1	Back alignment and structure

>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X	Back alignment and structure

>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str}	Back alignment and structure

>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia}	Back alignment and structure

>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B	Back alignment and structure

>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A	Back alignment and structure

>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii}	Back alignment and structure

>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A*	Back alignment and structure

>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae}	Back alignment and structure

>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A	Back alignment and structure

>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A	Back alignment and structure

>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B*	Back alignment and structure

>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp}	Back alignment and structure

>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a	Back alignment and structure

>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe}	Back alignment and structure

>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus}	Back alignment and structure

>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii}	Back alignment and structure

>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens}	Back alignment and structure

>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae}	Back alignment and structure

>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A*	Back alignment and structure

>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A*	Back alignment and structure

>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida}	Back alignment and structure

>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1	Back alignment and structure

>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1	Back alignment and structure

>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A*	Back alignment and structure

>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae}	Back alignment and structure

>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A	Back alignment and structure

>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum}	Back alignment and structure

>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A*	Back alignment and structure

>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1	Back alignment and structure

>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia}	Back alignment and structure

>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A*	Back alignment and structure

>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens}	Back alignment and structure

>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A	Back alignment and structure

>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens}	Back alignment and structure

>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A*	Back alignment and structure

>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1	Back alignment and structure

>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus}	Back alignment and structure

>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron}	Back alignment and structure

>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens}	Back alignment and structure

>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1	Back alignment and structure

>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1	Back alignment and structure

>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A	Back alignment and structure

>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV}	Back alignment and structure

>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A	Back alignment and structure

>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A	Back alignment and structure

>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens}	Back alignment and structure

>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp}	Back alignment and structure

>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A*	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A*	Back alignment and structure

>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A*	Back alignment and structure

>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B*	Back alignment and structure

>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A*	Back alignment and structure

>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae}	Back alignment and structure

>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae}	Back alignment and structure

>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B*	Back alignment and structure

>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A	Back alignment and structure

>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1	Back alignment and structure

>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida}	Back alignment and structure

>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae}	Back alignment and structure

>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A	Back alignment and structure

>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe}	Back alignment and structure

>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum}	Back alignment and structure

>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis}	Back alignment and structure

>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A*	Back alignment and structure

>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens}	Back alignment and structure

>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A	Back alignment and structure

>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1	Back alignment and structure

>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae}	Back alignment and structure

>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1	Back alignment and structure

>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A*	Back alignment and structure

>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633}	Back alignment and structure

>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans}	Back alignment and structure

>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633}	Back alignment and structure

>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A*	Back alignment and structure

>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus}	Back alignment and structure

>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B*	Back alignment and structure

>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A	Back alignment and structure

>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A	Back alignment and structure

>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens}	Back alignment and structure

>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A	Back alignment and structure

>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae}	Back alignment and structure

>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A	Back alignment and structure

>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B*	Back alignment and structure

>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae}	Back alignment and structure

>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B*	Back alignment and structure

>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B	Back alignment and structure

>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum}	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A	Back alignment and structure

>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H*	Back alignment and structure

>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1	Back alignment and structure

>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A*	Back alignment and structure

>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus}	Back alignment and structure

>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli}	Back alignment and structure

>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R*	Back alignment and structure

>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B*	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A*	Back alignment and structure

>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae}	Back alignment and structure

>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A	Back alignment and structure

>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A	Back alignment and structure

>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ...	Back alignment and structure

>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B	Back alignment and structure

>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A*	Back alignment and structure

>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli}	Back alignment and structure

>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A	Back alignment and structure

>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1	Back alignment and structure

>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A	Back alignment and structure

>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ...	Back alignment and structure

>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum}	Back alignment and structure

>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1	Back alignment and structure

>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A	Back alignment and structure

>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens}	Back alignment and structure

>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A	Back alignment and structure

>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A*	Back alignment and structure

>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A*	Back alignment and structure

>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482}	Back alignment and structure

>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme}	Back alignment and structure

>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus}	Back alignment and structure

>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1	Back alignment and structure

>1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1	Back alignment and structure

>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A	Back alignment and structure

>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1	Back alignment and structure

>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1	Back alignment and structure

>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme}	Back alignment and structure

>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A	Back alignment and structure

>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A	Back alignment and structure

>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A*	Back alignment and structure

>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens}	Back alignment and structure

>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B	Back alignment and structure

>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha}	Back alignment and structure

>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R	Back alignment and structure

>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3	Back alignment and structure

>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A*	Back alignment and structure

>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus}	Back alignment and structure

>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A	Back alignment and structure

>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A	Back alignment and structure

>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha}	Back alignment and structure

>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A	Back alignment and structure

>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A*	Back alignment and structure

>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus}	Back alignment and structure

>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae}	Back alignment and structure

>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A*	Back alignment and structure

>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1	Back alignment and structure

>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A	Back alignment and structure

>2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1	Back alignment and structure

>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV}	Back alignment and structure

>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens}	Back alignment and structure

>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens}	Back alignment and structure

>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus}	Back alignment and structure

>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A*	Back alignment and structure

>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1	Back alignment and structure

>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A	Back alignment and structure

>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A	Back alignment and structure

>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A*	Back alignment and structure

>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H*	Back alignment and structure

>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A	Back alignment and structure

>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A	Back alignment and structure

>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3	Back alignment and structure

>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A	Back alignment and structure

>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A	Back alignment and structure

>1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1	Back alignment and structure

>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A	Back alignment and structure

>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A*	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus}	Back alignment and structure

>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24	Back alignment and structure

>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus}	Back alignment and structure

>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus}	Back alignment and structure

>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1	Back alignment and structure

>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1	Back alignment and structure

>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A	Back alignment and structure

>1sqj_A OXG-RCBH, oligoxyloglucan reducing-END-specific cellobiohydrolase; beta-propeller; 2.20A {Geotrichum SP} SCOP: b.69.13.1 b.69.13.1 PDB: 2ebs_A*	Back alignment and structure

>2no2_A HIP-I, huntingtin-interacting protein 1; clathrin light chain binding, HIP1 coiled-coil domain, endocytosis, clathrin SELF-assembly, cell adhesion; 2.80A {Homo sapiens}	Back alignment and structure

>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24	Back alignment and structure

>3a0f_A Xyloglucanase; beta-propeller, hydrolase; 2.50A {Geotrichum SP}	Back alignment and structure

>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori}	Back alignment and structure

>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A*	Back alignment and structure

>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1	Back alignment and structure

>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens}	Back alignment and structure

>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus}	Back alignment and structure

>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori}	Back alignment and structure

>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R*	Back alignment and structure

>3c7x_A Matrix metalloproteinase-14; membrane protein interaction, Pro-MMP-2, TIMP-2, metastasis, calcium, cleavage on PAIR of basic residues, hydrolase; 1.70A {Homo sapiens}	Back alignment and structure

>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ...	Back alignment and structure

>3uux_B Mitochondrial division protein 1; tetratricopeptide repeat, mitochondrial fission, mitochondri cytoplasm, apoptosis; 3.90A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>1gen_A Gelatinase A; hydrolase, hemopexin domain, metalloprotease, hydrolase (metalloprotease); 2.15A {Homo sapiens} SCOP: b.66.1.1 PDB: 1rtg_A	Back alignment and structure

>3ni0_A Bone marrow stromal antigen 2; coiled-coil, antiviral defense, immune system, GPI anchor; 1.60A {Mus musculus}	Back alignment and structure

>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		717
d1zgka1		288	b.68.11.1 (A:322-609) Kelch-like ECH-associated pr	8e-16
d1zgka1		288	b.68.11.1 (A:322-609) Kelch-like ECH-associated pr	3e-12
d1zgka1		288	b.68.11.1 (A:322-609) Kelch-like ECH-associated pr	1e-08
d1zgka1		288	b.68.11.1 (A:322-609) Kelch-like ECH-associated pr	3e-08
d1k3ia3		387	b.69.1.1 (A:151-537) Galactose oxidase, central do	7e-08
d1k3ia3		387	b.69.1.1 (A:151-537) Galactose oxidase, central do	1e-05
d1k3ia3		387	b.69.1.1 (A:151-537) Galactose oxidase, central do	1e-04

>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288	Back information, alignment and structure


class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 76.5 bits (186), Expect = 8e-16
 Identities = 47/264 (17%), Positives = 78/264 (29%), Gaps = 22/264 (8%)

Query: 76  WMVLSIAGDKPIPRFNHAAAVIGNKMIVVGGESGNGLLDDVQVLNFDRFSWTAASSKLYL 135
           W+ L+   D  +PR   A  V+G  +  VGG + +   +            T   S    
Sbjct: 31  WLRLA---DLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCA- 86

Query: 136 SPSSLPLKIPACRGHSLISWGKKVLLVGGKTDSGSDRVSVWTFDTETECWSVVEAKGDIP 195
                   +   R    +      +   G +       SV  ++ E + W +      + 
Sbjct: 87  -------PMSVPRNRIGVGVIDGHIYAVGGSHGCIHHNSVERYEPERDEWHL---VAPML 136

Query: 196 VARSGHTVVRASSVLILFGGEDGKRRKLNDLHMFDLKSLTWLPLHCTGTGPSPRSNHVAA 255
             R G  V   + +L   GG D    +LN    +  +   W  +    T  S        
Sbjct: 137 TRRIGVGVAVLNRLLYAVGGFD-GTNRLNSAECYYPERNEWRMITAMNTIRSGAGVC--- 192

Query: 256 LYDDKNLLIFGGSSKSKTLNDLYSLDFETMIWTRIKIRGFHPSPRAGCCGVLCGTKWYIA 315
                 +   GG      LN +   D ET  WT +         R+     +   + Y+ 
Sbjct: 193 -VLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVA---PMKHRRSALGITVHQGRIYVL 248

Query: 316 GGGSRKKRHAETLIFDILKGEWSV 339
           GG            +D     WS 
Sbjct: 249 GGYDGHTFLDSVECYDPDTDTWSE 272

PyMOL of d1zgka1

>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288	Back information, alignment and structure

>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288	Back information, alignment and structure

>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288	Back information, alignment and structure

>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387	Back information, alignment and structure

>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387	Back information, alignment and structure

>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		717
d1zgka1		288	Kelch-like ECH-associated protein 1, KEAP1 {Human	100.0
d1zgka1		288	Kelch-like ECH-associated protein 1, KEAP1 {Human	100.0
d1k3ia3		387	Galactose oxidase, central domain {Fungi (Fusarium	99.96
d1k3ia3		387	Galactose oxidase, central domain {Fungi (Fusarium	99.96
d2ovrb2		342	F-box/WD repeat-containing protein 7, FBXW7 {Human	97.2
d1nr0a1		311	Actin interacting protein 1 {Nematode (Caenorhabdi	96.82
d1nr0a1		311	Actin interacting protein 1 {Nematode (Caenorhabdi	96.58
d1gxra_		337	Groucho/tle1, C-terminal domain {Human (Homo sapie	96.47
d1l0qa2		301	Surface layer protein {Archaeon Methanosarcina maz	96.38
d2ghsa1		295	Regucalcin {Agrobacterium tumefaciens [TaxId: 358]	96.37
d1l0qa2		301	Surface layer protein {Archaeon Methanosarcina maz	96.32
d2ovrb2		342	F-box/WD repeat-containing protein 7, FBXW7 {Human	96.24
d1k8kc_		371	Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur	96.23
d1nr0a2		299	Actin interacting protein 1 {Nematode (Caenorhabdi	96.22
d2ghsa1		295	Regucalcin {Agrobacterium tumefaciens [TaxId: 358]	95.68
d1nexb2		355	Cdc4 propeller domain {Baker's yeast (Saccharomyce	95.55
d1gxra_		337	Groucho/tle1, C-terminal domain {Human (Homo sapie	95.46
d2dg1a1		319	Lactonase Drp35 {Staphylococcus aureus [TaxId: 128	95.45
d1erja_		388	Tup1, C-terminal domain {Baker's yeast (Saccharomy	95.4
d1tbga_		340	beta1-subunit of the signal-transducing G protein	95.35
d1nexb2		355	Cdc4 propeller domain {Baker's yeast (Saccharomyce	95.2
d1pgua1		325	Actin interacting protein 1 {Baker's yeast (Saccha	94.81
d1k8kc_		371	Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur	94.6
d1tbga_		340	beta1-subunit of the signal-transducing G protein	94.6
d1pbyb_		337	Quinohemoprotein amine dehydrogenase B chain {Para	94.58
d1pexa_		192	Collagenase-3 (MMP-13), C-terminal domain {Human (	94.5
d1nr0a2		299	Actin interacting protein 1 {Nematode (Caenorhabdi	94.39
d1k32a3		360	Tricorn protease domain 2 {Archaeon Thermoplasma a	94.23
d1kv9a2		560	Quinoprotein alcohol dehydrogenase, N-terminal dom	94.05
d1pjxa_		314	Diisopropylfluorophosphatase (phosphotriesterase,	93.62
d1su3a2		195	Collagenase (MMP1), C-terminal domain {Human (Homo	93.53
d1jmxb_		346	Quinohemoprotein amine dehydrogenase B chain {Pseu	93.42
d1k32a3		360	Tricorn protease domain 2 {Archaeon Thermoplasma a	93.38
d1kb0a2		573	Quinoprotein alcohol dehydrogenase, N-terminal dom	93.38
d1kb0a2		573	Quinoprotein alcohol dehydrogenase, N-terminal dom	93.14
d1pgua1		325	Actin interacting protein 1 {Baker's yeast (Saccha	93.03
d1itva_		195	Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId:	92.95
d1p22a2		293	F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom	92.94
d1vyhc1		317	Platelet-activating factor acetylhydrolase IB subu	92.85
d1vyhc1		317	Platelet-activating factor acetylhydrolase IB subu	92.29
d1kv9a2		560	Quinoprotein alcohol dehydrogenase, N-terminal dom	92.01
d1erja_		388	Tup1, C-terminal domain {Baker's yeast (Saccharomy	91.97
d1pexa_		192	Collagenase-3 (MMP-13), C-terminal domain {Human (	91.09
d1k32a2		281	Tricorn protease N-terminal domain {Archaeon Therm	91.08
d1q7fa_		279	Brain tumor cg10719-pa {Fruit fly (Drosophila mela	90.99
d1pjxa_		314	Diisopropylfluorophosphatase (phosphotriesterase,	90.66
d1q7fa_		279	Brain tumor cg10719-pa {Fruit fly (Drosophila mela	89.66
d2p4oa1		302	Hypothetical protein All0351 homologue {Nostoc pun	89.33
d1su3a2		195	Collagenase (MMP1), C-terminal domain {Human (Homo	88.16
d1qksa2		432	C-terminal (heme d1) domain of cytochrome cd1-nitr	86.88
d2dg1a1		319	Lactonase Drp35 {Staphylococcus aureus [TaxId: 128	85.36
d1qksa2		432	C-terminal (heme d1) domain of cytochrome cd1-nitr	84.71
d1jmxb_		346	Quinohemoprotein amine dehydrogenase B chain {Pseu	84.71
d2p4oa1		302	Hypothetical protein All0351 homologue {Nostoc pun	83.81
d1itva_		195	Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId:	83.41
d1p22a2		293	F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom	83.05
d1pbyb_		337	Quinohemoprotein amine dehydrogenase B chain {Para	82.14
d1v0ea1		516	Endo-alpha-sialidase {Bacteriophage K1F [TaxId: 34	81.99

>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=2.9e-38  Score=326.99  Aligned_cols=282  Identities=18%  Similarity=0.266  Sum_probs=245.7

Q ss_pred             CCCCEEEEEcCCCCCCCCccccccccccCCCCCCCCCeEEeeecCCCCCCcceeEEEEECCEEEEEcccCC----CCCcc
Q 005043           39 PNSECVAPSSNHADDRDCECTIAGPEVSNGTSGNSENWMVLSIAGDKPIPRFNHAAAVIGNKMIVVGGESG----NGLLD  114 (717)
Q Consensus        39 ~~~~~i~l~GG~~~~~~~~~~~~~~~~~~~~~~~s~~W~~l~~~g~~P~~R~~haav~~~~~lyV~GG~~~----~~~~~  114 (717)
                      .+|+.||++||.....  .....+|++      .+++|..++   ++|.+|.+|++++++++|||+||...    ...++
T Consensus         2 ~~g~~iyv~GG~~~~~--~~~~~~yd~------~t~~W~~~~---~~p~~R~~~~~~~~~~~iyv~GG~~~~~~~~~~~~   70 (288)
T d1zgka1           2 KVGRLIYTAGGYFRQS--LSYLEAYNP------SNGTWLRLA---DLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSS   70 (288)
T ss_dssp             CCCCCEEEECCBSSSB--CCCEEEEET------TTTEEEECC---CCSSCCBSCEEEEETTEEEEECCEEEETTEEEECC
T ss_pred             CcCCEEEEECCcCCCC--CceEEEEEC------CCCeEEECC---CCCCccceeEEEEECCEEEEEeCcccCCCCccccc
Confidence            3577899999965432  233455776      889999997   89999999999999999999999642    23578


Q ss_pred             cEEEEEcCCCceEEccccccCCCCCCCCCCCcccceEEEEECCEEEEEeccCCCCCCceEEEEEECCCCcEEEeeecCCC
Q 005043          115 DVQVLNFDRFSWTAASSKLYLSPSSLPLKIPACRGHSLISWGKKVLLVGGKTDSGSDRVSVWTFDTETECWSVVEAKGDI  194 (717)
Q Consensus       115 ~v~~yd~~t~~W~~l~~~~~~~~~~~~~~~p~r~~hs~v~~~~~Iyv~GG~~~~~~~~~~v~~yD~~t~~W~~l~~~g~~  194 (717)
                      ++|+||+.+++|..++++           +.+|..|++++++++||++||... ....++++.||+.++.|...+   .+
T Consensus        71 ~~~~yd~~~~~w~~~~~~-----------p~~r~~~~~~~~~~~i~~~gg~~~-~~~~~~~~~~~~~~~~~~~~~---~~  135 (288)
T d1zgka1          71 ALDCYNPMTNQWSPCAPM-----------SVPRNRIGVGVIDGHIYAVGGSHG-CIHHNSVERYEPERDEWHLVA---PM  135 (288)
T ss_dssp             CEEEEETTTTEEEECCCC-----------SSCCBTCEEEEETTEEEEECCEET-TEECCCEEEEETTTTEEEECC---CC
T ss_pred             hhhhcccccccccccccc-----------cceecceeccccceeeEEecceec-ccccceeeeeccccCcccccc---cc
Confidence            999999999999999873           356889999999999999999854 345678999999999999877   48


Q ss_pred             CCCceeeEEEEECCEEEEEccccCCCCCcCcEEEEEcCCCceEeccCCCCCCCCCcccEEEEECCcEEEEEcCCCCCCCC
Q 005043          195 PVARSGHTVVRASSVLILFGGEDGKRRKLNDLHMFDLKSLTWLPLHCTGTGPSPRSNHVAALYDDKNLLIFGGSSKSKTL  274 (717)
Q Consensus       195 P~~R~~hs~~~~~~~Lyv~GG~~~~~~~~~~v~~yD~~t~~W~~l~~~g~~P~~R~~~aa~~~~~~~lyV~GG~~~~~~~  274 (717)
                      +.+|.+|+++.+++.+|++||.+.. ....+++.||+.+++|....   ..+.++..++++.++++ |+++||......+
T Consensus       136 ~~~r~~~~~~~~~~~~~~~GG~~~~-~~~~~~~~~d~~~~~~~~~~---~~~~~~~~~~~~~~~~~-i~i~GG~~~~~~~  210 (288)
T d1zgka1         136 LTRRIGVGVAVLNRLLYAVGGFDGT-NRLNSAECYYPERNEWRMIT---AMNTIRSGAGVCVLHNC-IYAAGGYDGQDQL  210 (288)
T ss_dssp             SSCCBSCEEEEETTEEEEECCBCSS-CBCCCEEEEETTTTEEEECC---CCSSCCBSCEEEEETTE-EEEECCBCSSSBC
T ss_pred             ccccccceeeeeeecceEecCcccc-cccceEEEeecccccccccc---ccccccccccccceeee-EEEecCccccccc
Confidence            8899999999999999999998765 46788999999999999887   77888999999999988 9999999888889


Q ss_pred             CeEEEEECCCCcEEEeecCCCCCCCCcceEEEEECCEEEEEecCCCCCccCeEEEEECCCCcEEEeecCCCCCCCCCcce
Q 005043          275 NDLYSLDFETMIWTRIKIRGFHPSPRAGCCGVLCGTKWYIAGGGSRKKRHAETLIFDILKGEWSVAITSPSSSVTSNKGF  354 (717)
Q Consensus       275 ndv~~yd~~t~~W~~v~~~g~~P~~R~~~sav~~~~~IyV~GG~~~~~~~~dv~~yD~~t~~W~~l~~~p~~~~~~r~g~  354 (717)
                      +++++||+.+++|+.++..   |.+|.+|+++.++++|||+||.+....++++++||+.+++|+.+..    +|.+|.+|
T Consensus       211 ~~~~~~~~~~~~~~~~~~~---p~~r~~~~~~~~~~~l~v~GG~~~~~~~~~v~~yd~~~~~W~~~~~----~p~~R~~~  283 (288)
T d1zgka1         211 NSVERYDVETETWTFVAPM---KHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTR----MTSGRSGV  283 (288)
T ss_dssp             CCEEEEETTTTEEEECCCC---SSCCBSCEEEEETTEEEEECCBCSSCBCCEEEEEETTTTEEEEEEE----CSSCCBSC
T ss_pred             cceeeeeecceeeecccCc---cCcccceEEEEECCEEEEEecCCCCeecceEEEEECCCCEEEECCC----CCCCcEeE
Confidence            9999999999999999754   8899999999999999999999888888999999999999999973    45689999


Q ss_pred             EEEE
Q 005043          355 TLVL  358 (717)
Q Consensus       355 s~v~  358 (717)
                      ++++
T Consensus       284 ~~~~  287 (288)
T d1zgka1         284 GVAV  287 (288)
T ss_dssp             EEEE
T ss_pred             EEEE
Confidence            8775

PyMOL of d1zgka1

>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]}	Back information, alignment and structure

>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]}	Back information, alignment and structure

>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]}	Back information, alignment and structure

>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]}	Back information, alignment and structure

>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]}	Back information, alignment and structure

>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]}	Back information, alignment and structure

>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]}	Back information, alignment and structure

>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]}	Back information, alignment and structure

>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]}	Back information, alignment and structure

>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]}	Back information, alignment and structure

>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]}	Back information, alignment and structure

>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]}	Back information, alignment and structure

>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1v0ea1 b.68.1.2 (A:245-760) Endo-alpha-sialidase {Bacteriophage K1F [TaxId: 344021]}	Back information, alignment and structure