Citrus Sinensis ID: 005071

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-----
MAAKRESGSGGGSILQFAPFQSSVDEGFWHRLSSLKLNKLGIDESPIPITGFYAPCSHLQVSNHLSLLTESLPSDSDEQSSTAEISRGSRNKCTVPGTLYNSNTLESFYTIDKQSLLKQEAKKIWEDIHSGKAVEDSTVLSRFLVISFADLKKWSFHYWFAFPALVLDPPATVVDLKPASLWFSSQEAESVSAACSDWRNSSLTADVPYFLLTIAPNSRATIRHLKDWEACEGDGQKLLFGFYDPCHLQNHPGWPLRNFLALILTRWKLKSVLFLCYRENRGFTDLGLSLVGEALITVPQGWGDHQCVPNTVGWELNKGRKVPRCISLAKSMDPTRLAISAADLNLKLMRWRQLPSLNLDILSSRKCLLLGAGTLGCQVARMLMAWGVRKITLLDNGRVAMSNPLRQSLYTLDDCLNGGDFKAMAAVKSLERIFPAVAAEGVVMAIPMPGHPVPCQEEDSVLDDCRRLTDLILSHDVIFLLTDTRESRWLPTLLCANTNKITITAALGFDSFLVMRHGPGPFSITHDVKTEAVNGLSADMDNLGLNNRDGGQRLGCYFCNDVVAPTDSTANRTLDQQCTVTRPGLAPIASALAVELFVGVLHHPKGIYAGAEFANSIDSGSSEQPLGILPHQIRGSLSQFSQMTLVGHSSNSCTACCSTVVSEYRKRGMEFILQAINHPTYLEDLTGLTELKKSANSFHVDWDYESDNEDDCVEI
ccccccccccccccEEEccccccccHHHHHHHHHccccccccccccEEEEEEEccccccccccccEEcccccccccccccHHHHHccccccEEEEEEEEEEcccHHHHHHccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHccccccccEEEEEEEEEccccccccEEEccccccccccHHHHHHHHHHHHHHHHccccccccEEEEEEccccccEEEcccccHHHcccccEEEEEEEccccccccccHHHHHHHHHHHHcccccEEEEEEEEccccccccccEEEEEEEEEcccccccccccccEEEEEEcccccccEEEcccccccHHHHHHHHHHHHHHHHcHHccccccHHHHHcccEEEEcccccHHHHHHHHHHHcccEEEEEEccEEcccccccccccccccccccccHHHHHHHHHHHHHccccEEEEEEEEcccccccccccccHHHHHHHHHHHHHHHcccEEEEccccHHHHHHHHHHHHHccccEEEEEEcEEEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccEEEEEEccccccccccHHHHHHHHHcHHHHHHHHHccccHHHHcccHHHHHHHHcccccccccccccccccccc
cccccccccccccEEEEEcccccccHHHHHHHHHHcHcHcccccccccEEEEEcccccccccccEEEEccccccccccccHccccccccccccccEEEEEEcccHHHHHHccHHHHHHHHHHHHHHHHHcccccccHHHHHHEEEEEHHHHHccEEEEEEEccccccccccEEcccccccccccHHHHHHHHHHHHHHHHHcccccccEEEEEEccccEEEEccHHHHHHcccccccEEEEEEccccccccccHHHHHHHHHHHHHccccEEEEEEEEcccccccccEEEEEEEEcccccccccccccccEEEEEcccccccccEEEcHHcccHHHHHHHHHHHHHHHHHHHEcccccHHHHHHcEEEEEcccHHHHHHHHHHHHccccEEEEEEccEEEcccccccccccHHHHcccccHHHHHHHHHHHHHcccccEEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHcccEEEEEEccHHHcHHHHHHHHHcccEEEEEEccccEEEEEEccccccccccccccccccccccccccccccccccccccEEEEccccEcccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHccHcccccEEEccccccccccccHHHHHHHHHccHHHHHHHHcccHHHHHHccHHHHHHHHHHHHHHccccccccccEEEc
maakresgsgggsilqfapfqssvdeGFWHRLSSLklnklgidespipitgfyapcshlqvsnHLSLlteslpsdsdeqsstaeisrgsrnkctvpgtlynsntlesfyTIDKQSLLKQEAKKIWEDIhsgkavedsTVLSRFLVISFADLKKWSFHYWfafpalvldppatvvdlkpaslwfssqeAESVSAACSdwrnssltadvpYFLLtiapnsratirhlkdweacegdgqkllfgfydpchlqnhpgwplRNFLALILTRWKLKSVLFLCYRENRGFTDLGLSLVGEAlitvpqgwgdhqcvpntvgwelnkgrkvprcislaksmdptrLAISAADLNLKLMRWrqlpslnldilssrKCLLLGAGTLGCQVARMLMAWGVRKITlldngrvamsnplrqslytlddclnggdFKAMAAVKSLERIFPAvaaegvvmaipmpghpvpcqeedsvldDCRRLTDLILSHDVIFLLtdtresrwlptllcantNKITITAAlgfdsflvmrhgpgpfsithdVKTEAVNGlsadmdnlglnnrdggqrlgcyfcndvvaptdstanrtldqqctvtrpglapIASALAVELFVGVlhhpkgiyagaefansidsgsseqplgilphqirgslsqfsqmtlvghssnsctaCCSTVVSEYRKRGMEFILQAInhptyledltgltelkksansfhvdwdyesdneddcvei
maakresgsgggsiLQFAPFQSSVDEGFWHRLSSLKLNKLGIDESPIPITGFYAPCSHLQVSNHLSLLTESLPSDSDEQSstaeisrgsrnkctvpgtlynsntleSFYTIDKQSLLKQEAKKIWEDIhsgkavedstvLSRFLVISFADLKKWSFHYWFAFPALVLDPPATVVDLKPASLWFSSQEAESVSAACSDWRNSSLTADVPYFLLTIAPNSRATIRHLKDWEACEGDGQKLLFGFYDPCHLQNHPGWPLRNFLALILTRWKLKSVLFLCYRENRGFTDLGLSLVGEALITVPQGWGDHQCVPntvgwelnkgrkVPRCISlaksmdptrlAISAADLNLKLMRWRQLPSLNLDILSSRKCLLLGAGTLGCQVARMLMAWGVRKITLLDNGRVAMSNPLRQSLYTLDDCLNGGDFKAMAAVKSLERIFPAVAAEGVVMAIPMPGHPVPCQEEDSVLDDCRRLTDLILSHDVIflltdtresrwlpTLLCANTNKITITAALGFDSFLVMRHGPGPFSITHDVKTEAVNGLSADMDNLGLNNRDGGQRLGCYFCNDVVAPTDSTANRTLDQQCTVTRPGLAPIASALAVELFVGVLHHPKGIYAGAEFANSIDSGSSEQPLGILPHQIRGSLSQFSQMTLvghssnsctACCSTVVSEYRKRGMEFILQAINHPTYLEDLTGLTELKKSAnsfhvdwdyesdneddcvei
MAAKRESGSGGGSILQFAPFQSSVDEGFWHRLSSLKLNKLGIDESPIPITGFYAPCSHLQVSNHLSLLTESLPSDSDEQSSTAEISRGSRNKCTVPGTLYNSNTLESFYTIDKQSLLKQEAKKIWEDIHSGKAVEDSTVLSRFLVISFADLKKWSFHYWFAFPALVLDPPATVVDLKPASLWFSSQEAESVSAACSDWRNSSLTADVPYFLLTIAPNSRATIRHLKDWEACEGDGQKLLFGFYDPCHLQNHPGWPLRNFLALILTRWKLKSVLFLCYRENRGFTDLGLSLVGEALITVPQGWGDHQCVPNTVGWELNKGRKVPRCISLAKSMDPTRLAISAADLNLKLMRWRQLPSLNLDILSSRKCLLLGAGTLGCQVARMLMAWGVRKITLLDNGRVAMSNPLRQSLYTLDDCLNGGDFKAMAAVKSLERIFPAVAAEGVVMAIPMPGHPVPCQEEDSVLDDCRRLTDLILSHDVIFLLTDTRESRWLPTLLCANTNKITITAALGFDSFLVMRHGPGPFSITHDVKTEAVNGLSADMDNLGLNNRDGGQRLGCYFCNDVVAPTDSTANRTLDQQCTVTRPGLAPIASALAVELFVGVLHHPKGIYAGAEFANSIDSGSSEQPLGILPHQIRGSLSQFSQMTLVGHSSNSCTACCSTVVSEYRKRGMEFILQAINHPTYLEDLTGLTELKKSANSFHVDWDYESDNEDDCVEI
**********************SVDEGFWHRLSSLKLNKLGIDESPIPITGFYAPCSHLQVSNHLSL*************************CTVPGTLYNSNTLESFYTIDKQSLLKQEAKKIWEDIHSGKAVEDSTVLSRFLVISFADLKKWSFHYWFAFPALVLDPPATVVDLKPASLWFSSQEAESVSAACSDWRNSSLTADVPYFLLTIAPNSRATIRHLKDWEACEGDGQKLLFGFYDPCHLQNHPGWPLRNFLALILTRWKLKSVLFLCYRENRGFTDLGLSLVGEALITVPQGWGDHQCVPNTVGWELNKGRKVPRCISLAKSMDPTRLAISAADLNLKLMRWRQLPSLNLDILSSRKCLLLGAGTLGCQVARMLMAWGVRKITLLDNGRVAMSNPLRQSLYTLDDCLNGGDFKAMAAVKSLERIFPAVAAEGVVMAIPMPGHPVPCQEEDSVLDDCRRLTDLILSHDVIFLLTDTRESRWLPTLLCANTNKITITAALGFDSFLVMRHGPGPFSITHDVKTEAVNGLSADMDNLGLNNRDGGQRLGCYFCNDVVAPTDSTANRTLDQQCTVTRPGLAPIASALAVELFVGVLHHPKGIYAGAEFAN************ILPHQIRGSLSQFSQMTLVGHSSNSCTACCSTVVSEYRKRGMEFILQAINHPTYLEDLTGLTELKKSANSFHVDWDY***********
**************LQFAPFQSSVDEGFWHRLSSLKLNKLGIDESPIPITGFYAPCSHL******SL***SL****************SRNKCTVPGTLYNSNTLESFYTIDKQSLLKQEAKKIWEDIHSGKAVEDSTVLSRFLVISFADLKKWSFHYWFAFPALVLDPPA***********FSSQEAESVSAACSDWRNSSLTADVPYFLLTIAPNSRATIRHLKDWEACEGDGQKLLFGFYDPCHLQNHPGWPLRNFLALILTRWKLKSVLFLCYRENRGFTDLGLSLVGEALITV*******QCVPNTVGWELNKGR****CI***************ADLNLKLMRWRQLPSLNLDILSSRKCLLLGAGTLGCQVARMLMAWGVRKITLLDNGRVAMSNPLRQSLYTLDDCLNGGDFKAMAAVKSLERIFPAVAAEGVVMAIPMPGHPVPCQEEDSVLDDCRRLTDLILSHDVIFLLTDTRESRWLPTLLCANTNKITITAALGFDSFLVMRHGPGPFSITHDVKTEA***********GLNNRDGGQRLGCYFCNDVVAPTDSTANRTLDQQCTVTRPGLAPIASALAVELFVGVLHHPKG********************GILPHQIRGSLSQFSQMTLVGHSSNSCTACCSTVVSEYRKRGMEFILQAINHPTYLEDLTGLTELKKSANSFHVDWDYESDNEDDCVEI
***********GSILQFAPFQSSVDEGFWHRLSSLKLNKLGIDESPIPITGFYAPCSHLQVSNHLSLLTES******************RNKCTVPGTLYNSNTLESFYTIDKQSLLKQEAKKIWEDIHSGKAVEDSTVLSRFLVISFADLKKWSFHYWFAFPALVLDPPATVVDLKPASLWF************SDWRNSSLTADVPYFLLTIAPNSRATIRHLKDWEACEGDGQKLLFGFYDPCHLQNHPGWPLRNFLALILTRWKLKSVLFLCYRENRGFTDLGLSLVGEALITVPQGWGDHQCVPNTVGWELNKGRKVPRCISLAKSMDPTRLAISAADLNLKLMRWRQLPSLNLDILSSRKCLLLGAGTLGCQVARMLMAWGVRKITLLDNGRVAMSNPLRQSLYTLDDCLNGGDFKAMAAVKSLERIFPAVAAEGVVMAIPMPGHPVPCQEEDSVLDDCRRLTDLILSHDVIFLLTDTRESRWLPTLLCANTNKITITAALGFDSFLVMRHGPGPFSITHDVKTEAVNGLSADMDNLGLNNRDGGQRLGCYFCNDVVAPTDSTANRTLDQQCTVTRPGLAPIASALAVELFVGVLHHPKGIYAGAEFANSIDSGSSEQPLGILPHQIRGSLSQFSQMTLVGHSSNSCTACCSTVVSEYRKRGMEFILQAINHPTYLEDLTGLTELKKSANSFHVDWDYES*********
**********GGSILQFAPFQSSVDEGFWHRLSSLKLNKLGIDESPIPITGFYAPCSHLQVSNHLSLLTESLP****************RNKCTVPGTLYNSNTLESFYTIDKQSLLKQEAKKIWEDIHSGKAVEDSTVLSRFLVISFADLKKWSFHYWFAFPALVLDPPATVVDLKPASLWFSSQEAESVSAACSDWRNSSLTADVPYFLLTIAPNSRATIRHLKDWEACEGDGQKLLFGFYDPCHLQNHPGWPLRNFLALILTRWKLKSVLFLCYRENRGFTDLGLSLVGEALITVPQGWGDHQCVPNTVGWELNKGRKVPRCISLAKSMDPTRLAISAADLNLKLMRWRQLPSLNLDILSSRKCLLLGAGTLGCQVARMLMAWGVRKITLLDNGRVAMSNPLRQSLYTLDDCLNGGDFKAMAAVKSLERIFPAVAAEGVVMAIPMPGHPVPCQEEDSVLDDCRRLTDLILSHDVIFLLTDTRESRWLPTLLCANTNKITITAALGFDSFLVMRHG*********************************QRLGCYFCNDVVAPTDSTANRTLDQQCTVTRPGLAPIASALAVELFVGVLHHPK*****************EQPLGILPHQIRGSLSQFSQMTLVGHSSNSCTACCSTVVSEYRKRGMEFILQAINHPTYLEDLTGLTELKKSANSFHVDWDYESD*ED*CVEI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAKRESGSGGGSILQFAPFQSSVDEGFWHRLSSLKLNKLGIDESPIPITGFYAPCSHLQVSNHLSLLTESLPSDSDEQSSTAEISRGSRNKCTVPGTLYNSNTLESFYTIDKQSLLKQEAKKIWEDIHSGKAVEDSTVLSRFLVISFADLKKWSFHYWFAFPALVLDPPATVVDLKPASLWFSSQEAESVSAACSDWRNSSLTADVPYFLLTIAPNSRATIRHLKDWEACEGDGQKLLFGFYDPCHLQNHPGWPLRNFLALILTRWKLKSVLFLCYRENRGFTDLGLSLVGEALITVPQGWGDHQCVPNTVGWELNKGRKVPRCISLAKSMDPTRLAISAADLNLKLMRWRQLPSLNLDILSSRKCLLLGAGTLGCQVARMLMAWGVRKITLLDNGRVAMSNPLRQSLYTLDDCLNGGDFKAMAAVKSLERIFPAVAAEGVVMAIPMPGHPVPCQEEDSVLDDCRRLTDLILSHDVIFLLTDTRESRWLPTLLCANTNKITITAALGFDSFLVMRHGPGPFSITHDVKTEAVNGLSADMDNLGLNNRDGGQRLGCYFCNDVVAPTDSTANRTLDQQCTVTRPGLAPIASALAVELFVGVLHHPKGIYAGAEFANSIDSGSSEQPLGILPHQIRGSLSQFSQMTLVGHSSNSCTACCSTVVSEYRKRGMEFILQAINHPTYLEDLTGLTELKKSANSFHVDWDYESDNEDDCVEI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query715 2.2.26 [Sep-21-2011]
Q94CD5697 Ubiquitin-like modifier-a yes no 0.938 0.962 0.713 0.0
Q5ZKY2709 Ubiquitin-like modifier-a yes no 0.939 0.947 0.464 1e-167
O95352703 Ubiquitin-like modifier-a yes no 0.941 0.957 0.459 1e-166
Q641Y5698 Ubiquitin-like modifier-a yes no 0.937 0.959 0.462 1e-163
Q9D906698 Ubiquitin-like modifier-a yes no 0.938 0.961 0.458 1e-162
A7KAL8702 Ubiquitin-like modifier-a yes no 0.906 0.923 0.402 1e-140
Q86CR9707 Ubiquitin-like modifier-a yes no 0.925 0.936 0.406 1e-140
A7EI75683 Ubiquitin-like modifier-a N/A no 0.889 0.931 0.393 1e-138
Q52CS0714 Ubiquitin-like modifier-a N/A no 0.918 0.920 0.392 1e-138
P0CM38675 Ubiquitin-like modifier-a yes no 0.921 0.976 0.408 1e-137
>sp|Q94CD5|ATG7_ARATH Ubiquitin-like modifier-activating enzyme atg7 OS=Arabidopsis thaliana GN=ATG7 PE=1 SV=1 Back     alignment and function desciption
 Score = 1016 bits (2628), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/688 (71%), Positives = 573/688 (83%), Gaps = 17/688 (2%)

Query: 14  ILQFAPFQSSVDEGFWHRLSSLKLNKLGIDESPIPITGFYAPCSHLQVSNHLSLLTESLP 73
           ILQFAP  SSVDEGFWH  SSLKL+KLGID+SPI ITGFY PC H QVSNHL+LL+ESLP
Sbjct: 10  ILQFAPLNSSVDEGFWHSFSSLKLDKLGIDDSPISITGFYGPCGHPQVSNHLTLLSESLP 69

Query: 74  SDSDEQSSTAEISRGSRNKCTVPGTLYNSNTLESFYTIDKQSLLKQEAKKIWEDIHSGKA 133
            D  EQS  A  S G+RNKC VPG LYN+NT+ESF  +DKQSLLK EA KIWEDI SGKA
Sbjct: 70  LD--EQSLIASTSHGNRNKCPVPGILYNTNTVESFNKLDKQSLLKAEANKIWEDIQSGKA 127

Query: 134 VEDSTVLSRFLVISFADLKKWSFHYWFAFPALVLDPPATVVDLKPASLWFSSQEAESVSA 193
           +ED +VL RFLVISFADLKKWSF YWFAFPA VLDPP ++++LKPAS +FSS+EAESVSA
Sbjct: 128 LEDPSVLPRFLVISFADLKKWSFRYWFAFPAFVLDPPVSLIELKPASEYFSSEEAESVSA 187

Query: 194 ACSDWRNSSLTADVPYFLLTIAPNSRATIRHLKDWEACEGDGQKLLFGFYDPCHLQNHPG 253
           AC+DWR+S LT DVP+FL++++ +S+A+IRHLKD EAC+GD QKLLFGFYDPCHL ++PG
Sbjct: 188 ACNDWRDSDLTTDVPFFLVSVSSDSKASIRHLKDLEACQGDHQKLLFGFYDPCHLPSNPG 247

Query: 254 WPLRNFLALILTRWKLKSVLFLCYRENRGFTDLGLSLVGEALITVPQGWGDHQCVPNTVG 313
           WPLRN+LALI +RW L++V F CYRE+RGF DL LSLVG+A IT+  G    + VPN+VG
Sbjct: 248 WPLRNYLALIRSRWNLETVWFFCYRESRGFADLNLSLVGQASITLSSG-ESAETVPNSVG 306

Query: 314 WELNKGRKVPRCISLAKSMDPTRLAISAADLNLKLMRWRQLPSLNLDILSSRKCLLLGAG 373
           WELNKG++VPR ISLA SMDPTRLA+SA DLNLKLMRWR LPSLNL++LSS KCLLLGAG
Sbjct: 307 WELNKGKRVPRSISLANSMDPTRLAVSAVDLNLKLMRWRALPSLNLNVLSSVKCLLLGAG 366

Query: 374 TLGCQVARMLMAWGVRKITLLDNGRVAMSNPLRQSLYTLDDCLNGGDFKAMAAVKSLERI 433
           TLGCQVAR LM WG+R IT +D G+VAMSNP+RQSLY  +DCL  G+FKA+AAVKSL++I
Sbjct: 367 TLGCQVARTLMGWGIRNITFVDYGKVAMSNPVRQSLYNFEDCLGRGEFKAVAAVKSLKQI 426

Query: 434 FPAVAAEGVVMAIPMPGHPVPCQEEDSVLDDCRRLTDLILSHDVIFLLTDTRESRWLPTL 493
           FPA+   GVVMAIPMPGHP+  QEEDSVL DC+RL++LI SHD +FLLTDTRESRWLP+L
Sbjct: 427 FPAMETSGVVMAIPMPGHPISSQEEDSVLGDCKRLSELIESHDAVFLLTDTRESRWLPSL 486

Query: 494 LCANTNKITITAALGFDSFLVMRHGPGPFSITHDVKTEAVNGLSADMDNLGLNNRDGGQR 553
           LCAN NKI I AALGFDS++VMRHG GP S            LS DM NL + N+   QR
Sbjct: 487 LCANANKIAINAALGFDSYMVMRHGAGPTS------------LSDDMQNLDI-NKTNTQR 533

Query: 554 LGCYFCNDVVAPTDSTANRTLDQQCTVTRPGLAPIASALAVELFVGVLHHPKGIYAGAEF 613
           LGCYFCNDVVAP DS  +RTLDQQCTVTRPGLAPIA ALAVEL VGVL HP GI A  + 
Sbjct: 534 LGCYFCNDVVAPQDSMTDRTLDQQCTVTRPGLAPIAGALAVELLVGVLQHPLGINAKGDN 593

Query: 614 ANSIDSGSS-EQPLGILPHQIRGSLSQFSQMTLVGHSSNSCTACCSTVVSEYRKRGMEFI 672
           ++  ++G++ + PLGILPHQIRGS+SQFSQ+TL+G +SNSCTAC  TV+SEYR+RG  FI
Sbjct: 594 SSLSNTGNNDDSPLGILPHQIRGSVSQFSQITLLGQASNSCTACSETVISEYRERGNSFI 653

Query: 673 LQAINHPTYLEDLTGLTELKKSANSFHV 700
           L+AINHPTYLEDLTGLTELKK+ANSF++
Sbjct: 654 LEAINHPTYLEDLTGLTELKKAANSFNL 681
E1-like activating enzyme involved in the 2 ubiquitin-like systems required for cytoplasm to vacuole transport (Cvt) and autophagy. Activates ATG12 for its conjugation with ATG5 and ATG8 for its conjugation with phosphatidylethanolamine. Both systems are needed for the ATG8 association to Cvt vesicles and autophagosomes. Involved in the senescence process.
Arabidopsis thaliana (taxid: 3702)
>sp|Q5ZKY2|ATG7_CHICK Ubiquitin-like modifier-activating enzyme ATG7 OS=Gallus gallus GN=ATG7 PE=2 SV=1 Back     alignment and function description
>sp|O95352|ATG7_HUMAN Ubiquitin-like modifier-activating enzyme ATG7 OS=Homo sapiens GN=ATG7 PE=1 SV=1 Back     alignment and function description
>sp|Q641Y5|ATG7_RAT Ubiquitin-like modifier-activating enzyme ATG7 OS=Rattus norvegicus GN=Atg7 PE=2 SV=1 Back     alignment and function description
>sp|Q9D906|ATG7_MOUSE Ubiquitin-like modifier-activating enzyme ATG7 OS=Mus musculus GN=Atg7 PE=1 SV=1 Back     alignment and function description
>sp|A7KAL8|ATG7_PENCW Ubiquitin-like modifier-activating enzyme atg7 OS=Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-1255) GN=atg7 PE=3 SV=1 Back     alignment and function description
>sp|Q86CR9|ATG7_DICDI Ubiquitin-like modifier-activating enzyme atg7 OS=Dictyostelium discoideum GN=atg7 PE=3 SV=1 Back     alignment and function description
>sp|A7EI75|ATG7_SCLS1 Ubiquitin-like modifier-activating enzyme atg7 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=atg7 PE=3 SV=1 Back     alignment and function description
>sp|Q52CS0|ATG7_MAGO7 Ubiquitin-like modifier-activating enzyme ATG7 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ATG7 PE=3 SV=2 Back     alignment and function description
>sp|P0CM38|ATG7_CRYNJ Ubiquitin-like modifier-activating enzyme ATG7 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ATG7 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query715
297740493787 unnamed protein product [Vitis vinifera] 0.970 0.881 0.814 0.0
359483679711 PREDICTED: ubiquitin-like modifier-activ 0.970 0.976 0.814 0.0
255563122710 autophagy protein, putative [Ricinus com 0.991 0.998 0.786 0.0
224076978715 predicted protein [Populus trichocarpa] 0.951 0.951 0.780 0.0
363806674686 ubiquitin-like modifier-activating enzym 0.955 0.995 0.770 0.0
449433756694 PREDICTED: ubiquitin-like modifier-activ 0.941 0.969 0.735 0.0
297794669697 hypothetical protein ARALYDRAFT_916858 [ 0.938 0.962 0.719 0.0
18422607697 ubiquitin-like modifier-activating enzym 0.938 0.962 0.713 0.0
9758937678 ubiquitin activating enzyme E1-like prot 0.911 0.961 0.693 0.0
449527869649 PREDICTED: LOW QUALITY PROTEIN: ubiquiti 0.885 0.975 0.725 0.0
>gi|297740493|emb|CBI30675.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1181 bits (3056), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 565/694 (81%), Positives = 618/694 (89%)

Query: 7   SGSGGGSILQFAPFQSSVDEGFWHRLSSLKLNKLGIDESPIPITGFYAPCSHLQVSNHLS 66
           +G   G++LQFAPFQSSVDEGFWHRLSSLKLNKLGID+SPI ITGFYAPCSH QVSNHL+
Sbjct: 78  AGQESGAVLQFAPFQSSVDEGFWHRLSSLKLNKLGIDDSPISITGFYAPCSHSQVSNHLT 137

Query: 67  LLTESLPSDSDEQSSTAEISRGSRNKCTVPGTLYNSNTLESFYTIDKQSLLKQEAKKIWE 126
           LL ESLP +  EQSST  ISRG+RN+C+VPG LYN+NTLESF+ +DKQSLLK EA+KIW 
Sbjct: 138 LLAESLPPEPSEQSSTPPISRGNRNRCSVPGILYNTNTLESFHALDKQSLLKAEAEKIWN 197

Query: 127 DIHSGKAVEDSTVLSRFLVISFADLKKWSFHYWFAFPALVLDPPATVVDLKPASLWFSSQ 186
           DIHSG+A ED +VLSRFL+ISFADLKKWSFHYWFAFPALVLDPPAT+VDLKPAS WFS +
Sbjct: 198 DIHSGRAEEDCSVLSRFLLISFADLKKWSFHYWFAFPALVLDPPATLVDLKPASQWFSLE 257

Query: 187 EAESVSAACSDWRNSSLTADVPYFLLTIAPNSRATIRHLKDWEACEGDGQKLLFGFYDPC 246
           EAESVSAAC++WRNSS TADVP+FL++IA NSRATIRHLKDWEAC+ DG KLLFGFYDPC
Sbjct: 258 EAESVSAACNEWRNSSSTADVPFFLVSIASNSRATIRHLKDWEACQEDGHKLLFGFYDPC 317

Query: 247 HLQNHPGWPLRNFLALILTRWKLKSVLFLCYRENRGFTDLGLSLVGEALITVPQGWGDHQ 306
           HL  +PGWPLRNFL LI +RW +K V FLCYRENRGF DLGLSLVGEA I+ PQ W D  
Sbjct: 318 HLPKNPGWPLRNFLVLIYSRWNIKKVQFLCYRENRGFADLGLSLVGEAQISAPQEWRDEL 377

Query: 307 CVPNTVGWELNKGRKVPRCISLAKSMDPTRLAISAADLNLKLMRWRQLPSLNLDILSSRK 366
            VPN VGWELN+G+KV RCISLAKSMDPTRLAISAADLNLKLMRWR LPSLNL+ILS+ K
Sbjct: 378 HVPNVVGWELNRGKKVYRCISLAKSMDPTRLAISAADLNLKLMRWRALPSLNLNILSTMK 437

Query: 367 CLLLGAGTLGCQVARMLMAWGVRKITLLDNGRVAMSNPLRQSLYTLDDCLNGGDFKAMAA 426
           CLLLGAGTLGCQVARMLMAWGVRKITLLDNG+VAMSNPLRQSLYTLDDCLNGG+FKA+AA
Sbjct: 438 CLLLGAGTLGCQVARMLMAWGVRKITLLDNGKVAMSNPLRQSLYTLDDCLNGGEFKALAA 497

Query: 427 VKSLERIFPAVAAEGVVMAIPMPGHPVPCQEEDSVLDDCRRLTDLILSHDVIFLLTDTRE 486
           V SL+RIFPAV AEGVVMAIPMPGHPVP QEE+SVLDDCR L +LI SHD +FLLTDTRE
Sbjct: 498 VNSLKRIFPAVEAEGVVMAIPMPGHPVPSQEEESVLDDCRCLCELIESHDAVFLLTDTRE 557

Query: 487 SRWLPTLLCANTNKITITAALGFDSFLVMRHGPGPFSITHDVKTEAVNGLSADMDNLGLN 546
           SRWLPTLLCAN NK+TITAALGFDSFLVMRHG GP S T D + EA+N LSADM      
Sbjct: 558 SRWLPTLLCANANKMTITAALGFDSFLVMRHGAGPLSSTIDNRAEAMNALSADMSKFSPT 617

Query: 547 NRDGGQRLGCYFCNDVVAPTDSTANRTLDQQCTVTRPGLAPIASALAVELFVGVLHHPKG 606
           + DGGQRLGCYFCNDVVAP DST+NRTLDQQCTVTRPGLAPIASALAVEL VG+LHHP G
Sbjct: 618 DSDGGQRLGCYFCNDVVAPVDSTSNRTLDQQCTVTRPGLAPIASALAVELLVGILHHPHG 677

Query: 607 IYAGAEFANSIDSGSSEQPLGILPHQIRGSLSQFSQMTLVGHSSNSCTACCSTVVSEYRK 666
           I+A  + ANS  +G +EQPLGILPHQIRGSL+QFSQMTLVGHSSNSCTACC TVVSEYRK
Sbjct: 678 IFAEGDIANSSSNGINEQPLGILPHQIRGSLAQFSQMTLVGHSSNSCTACCDTVVSEYRK 737

Query: 667 RGMEFILQAINHPTYLEDLTGLTELKKSANSFHV 700
           RGM+FILQAINHPTYLEDLTGLTEL KSA+SF +
Sbjct: 738 RGMDFILQAINHPTYLEDLTGLTELMKSASSFKL 771

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359483679|ref|XP_002273902.2| PREDICTED: ubiquitin-like modifier-activating enzyme atg7-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255563122|ref|XP_002522565.1| autophagy protein, putative [Ricinus communis] gi|223538256|gb|EEF39865.1| autophagy protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224076978|ref|XP_002305077.1| predicted protein [Populus trichocarpa] gi|222848041|gb|EEE85588.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|363806674|ref|NP_001242518.1| ubiquitin-like modifier-activating enzyme atg7-like [Glycine max] gi|256542212|dbj|BAH98059.1| autophagy protein ATG7 [Glycine max] Back     alignment and taxonomy information
>gi|449433756|ref|XP_004134663.1| PREDICTED: ubiquitin-like modifier-activating enzyme atg7-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297794669|ref|XP_002865219.1| hypothetical protein ARALYDRAFT_916858 [Arabidopsis lyrata subsp. lyrata] gi|297311054|gb|EFH41478.1| hypothetical protein ARALYDRAFT_916858 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18422607|ref|NP_568652.1| ubiquitin-like modifier-activating enzyme atg7 [Arabidopsis thaliana] gi|75165232|sp|Q94CD5.1|ATG7_ARATH RecName: Full=Ubiquitin-like modifier-activating enzyme atg7; AltName: Full=ATG12-activating enzyme E1 atg7; AltName: Full=Autophagy-related protein 7; Short=AtAPG7 gi|21636960|gb|AAM70190.1|AF492761_1 autophagy APG7 [Arabidopsis thaliana] gi|14334508|gb|AAK59451.1| putative ubiquitin activating enzyme E1 [Arabidopsis thaliana] gi|19912147|dbj|BAB88385.1| autophagy 7 [Arabidopsis thaliana] gi|23297572|gb|AAN12897.1| putative ubiquitin-activating enzyme E1 [Arabidopsis thaliana] gi|332007930|gb|AED95313.1| ubiquitin-like modifier-activating enzyme atg7 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|9758937|dbj|BAB09318.1| ubiquitin activating enzyme E1-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449527869|ref|XP_004170931.1| PREDICTED: LOW QUALITY PROTEIN: ubiquitin-like modifier-activating enzyme atg7-like, partial [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query715
TAIR|locus:2152375697 APG7 "AUTOPHAGY 7" [Arabidopsi 0.958 0.982 0.706 6.6e-271
UNIPROTKB|Q5ZKY2709 ATG7 "Ubiquitin-like modifier- 0.946 0.954 0.475 1.3e-155
UNIPROTKB|O95352703 ATG7 "Ubiquitin-like modifier- 0.953 0.970 0.468 5.1e-154
RGD|1304817698 Atg7 "autophagy related 7" [Ra 0.945 0.968 0.466 3.2e-152
UNIPROTKB|Q641Y5698 Atg7 "Ubiquitin-like modifier- 0.945 0.968 0.466 3.2e-152
UNIPROTKB|F1PI66704 ATG7 "Uncharacterized protein" 0.946 0.961 0.464 3.7e-151
MGI|MGI:1921494698 Atg7 "autophagy related 7" [Mu 0.946 0.969 0.462 7.6e-151
UNIPROTKB|E1BNN7703 ATG7 "Uncharacterized protein" 0.951 0.967 0.456 1.6e-150
UNIPROTKB|G5E627699 ATG7 "Uncharacterized protein" 0.941 0.962 0.455 4.8e-149
UNIPROTKB|F1N8C1698 ATG7 "Ubiquitin-like modifier- 0.934 0.957 0.463 1.7e-146
TAIR|locus:2152375 APG7 "AUTOPHAGY 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2605 (922.1 bits), Expect = 6.6e-271, P = 6.6e-271
 Identities = 497/703 (70%), Positives = 583/703 (82%)

Query:    14 ILQFAPFQSSVDEGFWHRLSSLKLNKLGIDESPIPITGFYAPCSHLQVSNHLSLLTESLP 73
             ILQFAP  SSVDEGFWH  SSLKL+KLGID+SPI ITGFY PC H QVSNHL+LL+ESLP
Sbjct:    10 ILQFAPLNSSVDEGFWHSFSSLKLDKLGIDDSPISITGFYGPCGHPQVSNHLTLLSESLP 69

Query:    74 SDSDEQSSTAEISRGSRNKCTVPGTLYNSNTLESFYTIDKQSLLKQEAKKIWEDIHSGKA 133
              D  EQS  A  S G+RNKC VPG LYN+NT+ESF  +DKQSLLK EA KIWEDI SGKA
Sbjct:    70 LD--EQSLIASTSHGNRNKCPVPGILYNTNTVESFNKLDKQSLLKAEANKIWEDIQSGKA 127

Query:   134 VEDSTVLSRFLVISFADLKKWSFHYWFAFPALVLDPPATVVDLKPASLWFSSQEAESVSA 193
             +ED +VL RFLVISFADLKKWSF YWFAFPA VLDPP ++++LKPAS +FSS+EAESVSA
Sbjct:   128 LEDPSVLPRFLVISFADLKKWSFRYWFAFPAFVLDPPVSLIELKPASEYFSSEEAESVSA 187

Query:   194 ACSDWRNSSLTADVPYFLLTIAPNSRATIRHLKDWEACEGDGQKLLFGFYDPCHLQNHPG 253
             AC+DWR+S LT DVP+FL++++ +S+A+IRHLKD EAC+GD QKLLFGFYDPCHL ++PG
Sbjct:   188 ACNDWRDSDLTTDVPFFLVSVSSDSKASIRHLKDLEACQGDHQKLLFGFYDPCHLPSNPG 247

Query:   254 WPLRNFLALILTRWKLKSVLFLCYRENRGFTDLGLSLVGEALITVPQGWGDHQCVPNTVG 313
             WPLRN+LALI +RW L++V F CYRE+RGF DL LSLVG+A IT+  G    + VPN+VG
Sbjct:   248 WPLRNYLALIRSRWNLETVWFFCYRESRGFADLNLSLVGQASITLSSG-ESAETVPNSVG 306

Query:   314 WELNKGRKVPRCISLAKSMDPTRLAISAADLNLKLMRWRQLPSLNLDILSSRKCLLLGAG 373
             WELNKG++VPR ISLA SMDPTRLA+SA DLNLKLMRWR LPSLNL++LSS KCLLLGAG
Sbjct:   307 WELNKGKRVPRSISLANSMDPTRLAVSAVDLNLKLMRWRALPSLNLNVLSSVKCLLLGAG 366

Query:   374 TLGCQVARMLMAWGVRKITLLDNGRVAMSNPLRQSLYTLDDCLNGGDFKAMAAVKSLERI 433
             TLGCQVAR LM WG+R IT +D G+VAMSNP+RQSLY  +DCL  G+FKA+AAVKSL++I
Sbjct:   367 TLGCQVARTLMGWGIRNITFVDYGKVAMSNPVRQSLYNFEDCLGRGEFKAVAAVKSLKQI 426

Query:   434 FPAVAAEGVVMAIPMPGHPVPCQEEDSVLDDCRRLTDLILSHDVIFLLTDTRESRWLPTL 493
             FPA+   GVVMAIPMPGHP+  QEEDSVL DC+RL++LI SHD +FLLTDTRESRWLP+L
Sbjct:   427 FPAMETSGVVMAIPMPGHPISSQEEDSVLGDCKRLSELIESHDAVFLLTDTRESRWLPSL 486

Query:   494 LCANTNKITITAALGFDSFLVMRHGPGPFSITHDVKTEAVNGLSADMDNLGLNNRDGGQR 553
             LCAN NKI I AALGFDS++VMRHG GP S            LS DM NL +N +   QR
Sbjct:   487 LCANANKIAINAALGFDSYMVMRHGAGPTS------------LSDDMQNLDIN-KTNTQR 533

Query:   554 LGCYFCNDVVAPTDSTANRTLDQQCTVTRPGLAPIASALAVELFVGVLHHPKGIYAGAEF 613
             LGCYFCNDVVAP DS  +RTLDQQCTVTRPGLAPIA ALAVEL VGVL HP GI A  + 
Sbjct:   534 LGCYFCNDVVAPQDSMTDRTLDQQCTVTRPGLAPIAGALAVELLVGVLQHPLGINAKGDN 593

Query:   614 ANSIDSGSSEQ-PLGILPHQIRGSLSQFSQMTLVGHSSNSCTACCSTVVSEYRKRGMEFI 672
             ++  ++G+++  PLGILPHQIRGS+SQFSQ+TL+G +SNSCTAC  TV+SEYR+RG  FI
Sbjct:   594 SSLSNTGNNDDSPLGILPHQIRGSVSQFSQITLLGQASNSCTACSETVISEYRERGNSFI 653

Query:   673 LQAINHPTYLEDLTGLTELKKSANSFHVDWDYESDNEDDCVEI 715
             L+AINHPTYLEDLTGLTELKK+ANSF++DW+ + D +DD V +
Sbjct:   654 LEAINHPTYLEDLTGLTELKKAANSFNLDWE-DDDTDDDDVAV 695
GO:0000166 "nucleotide binding" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0006497 "protein lipidation" evidence=ISS
GO:0006914 "autophagy" evidence=ISS
GO:0019779 "APG8 activating enzyme activity" evidence=ISS
GO:0010150 "leaf senescence" evidence=IMP;TAS
GO:0005829 "cytosol" evidence=IDA
GO:0050832 "defense response to fungus" evidence=IEP
GO:0007568 "aging" evidence=RCA
GO:0010260 "organ senescence" evidence=RCA
GO:0016036 "cellular response to phosphate starvation" evidence=RCA
GO:0019375 "galactolipid biosynthetic process" evidence=RCA
GO:0042631 "cellular response to water deprivation" evidence=RCA
UNIPROTKB|Q5ZKY2 ATG7 "Ubiquitin-like modifier-activating enzyme ATG7" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|O95352 ATG7 "Ubiquitin-like modifier-activating enzyme ATG7" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1304817 Atg7 "autophagy related 7" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q641Y5 Atg7 "Ubiquitin-like modifier-activating enzyme ATG7" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1PI66 ATG7 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1921494 Atg7 "autophagy related 7" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1BNN7 ATG7 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|G5E627 ATG7 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1N8C1 ATG7 "Ubiquitin-like modifier-activating enzyme ATG7" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9D906ATG7_MOUSENo assigned EC number0.45860.93840.9613yesno
Q756G8ATG7_ASHGONo assigned EC number0.36240.85170.9744yesno
Q6CXW3ATG7_KLULANo assigned EC number0.35240.82790.9817yesno
Q6BGV9ATG7_DEBHANo assigned EC number0.37640.85590.9386yesno
Q6FQY7ATG7_CANGANo assigned EC number0.36560.83630.9598yesno
Q6CBC3ATG7_YARLINo assigned EC number0.34730.80690.9648yesno
P0CM38ATG7_CRYNJNo assigned EC number0.40870.92160.9762yesno
O43069ATG7_SCHPONo assigned EC number0.39210.86710.9553yesno
A3LPA1ATG7_PICSTNo assigned EC number0.36880.85450.9371yesno
P38862ATG7_YEASTNo assigned EC number0.37620.84750.9619yesno
O95352ATG7_HUMANNo assigned EC number0.45990.94120.9573yesno
Q5ZKY2ATG7_CHICKNo assigned EC number0.46440.93980.9478yesno
Q5AWA2ATG7_EMENINo assigned EC number0.40310.87970.9501yesno
O93922ATG7_PICPANo assigned EC number0.36860.85590.9357yesno
Q94CD5ATG7_ARATHNo assigned EC number0.71360.93840.9626yesno
Q641Y5ATG7_RATNo assigned EC number0.46210.93700.9598yesno
A7KAL8ATG7_PENCWNo assigned EC number0.40210.90620.9230yesno
Q86CR9ATG7_DICDINo assigned EC number0.40600.92580.9363yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query715
TIGR01381664 TIGR01381, E1_like_apg7, E1-like protein-activatin 0.0
cd01486307 cd01486, Apg7, Apg7 is an E1-like protein, that ac 1e-171
pfam00899134 pfam00899, ThiF, ThiF family 6e-27
cd01483143 cd01483, E1_enzyme_family, Superfamily of activati 4e-19
cd00757228 cd00757, ThiF_MoeB_HesA_family, ThiF_MoeB_HesA 3e-14
COG0476254 COG0476, ThiF, Dinucleotide-utilizing enzymes invo 6e-14
PRK07688339 PRK07688, PRK07688, thiamine/molybdopterin biosynt 5e-11
TIGR02356202 TIGR02356, adenyl_thiF, thiazole biosynthesis aden 6e-10
PRK05690245 PRK05690, PRK05690, molybdopterin biosynthesis pro 9e-10
TIGR02355240 TIGR02355, moeB, molybdopterin synthase sulfurylas 2e-09
PRK12475338 PRK12475, PRK12475, thiamine/molybdopterin biosynt 1e-07
PRK08644212 PRK08644, PRK08644, thiamine biosynthesis protein 2e-06
PRK05600370 PRK05600, PRK05600, thiamine biosynthesis protein 4e-05
PRK08762376 PRK08762, PRK08762, molybdopterin biosynthesis pro 1e-04
cd01487174 cd01487, E1_ThiF_like, E1_ThiF_like 2e-04
PRK05597355 PRK05597, PRK05597, molybdopterin biosynthesis pro 5e-04
cd01484234 cd01484, E1-2_like, Ubiquitin activating enzyme (E 6e-04
cd01488291 cd01488, Uba3_RUB, Ubiquitin activating enzyme (E1 0.002
pfam01488133 pfam01488, Shikimate_DH, Shikimate / quinate 5-deh 0.002
cd05213311 cd05213, NAD_bind_Glutamyl_tRNA_reduct, NADP-bindi 0.004
TIGR02354200 TIGR02354, thiF_fam2, thiamine biosynthesis protei 0.004
>gnl|CDD|233388 TIGR01381, E1_like_apg7, E1-like protein-activating enzyme Gsa7p/Apg7p Back     alignment and domain information 
 Score =  879 bits (2273), Expect = 0.0
 Identities = 302/697 (43%), Positives = 393/697 (56%), Gaps = 36/697 (5%)

Query: 17  FAPFQSSVDEGFWHRLSSLKLNKLGIDESPIPITGFYAPCSHLQVSNHLSLLTESLPSDS 76
           F PF S VD GFW+ +S LKLNK  +D++P  I+G  +         HLSL  +SL S  
Sbjct: 1   FVPFVSCVDTGFWNEVSKLKLNKWKLDDTPKCISGQLSLHQTEGFKCHLSLSYDSLSSL- 59

Query: 77  DEQSSTAEISRGSRNKCTVPGTLYNSNTLESFYTIDKQSLLKQEAKKIWEDIHSGKAVED 136
            E ++             V G L N NT+ESF  +DK  LL+ EA+KIWE I + K ++D
Sbjct: 60  -ESTTGTHAQLS------VSGILLNYNTVESFKKVDKSDLLRSEAEKIWESIQTRKWLQD 112

Query: 137 STVLSRFLVISFADLKKWSFHYWFAFPALVLDPPATVVDLKPASLWFSSQEAESVSAACS 196
            ++LS+F +ISFADLKK+ F+YWF FPALV       +     S+       ES+ A   
Sbjct: 113 PSLLSQFFIISFADLKKFKFYYWFCFPALVYPSKVNKLSGLTESIKQEITPLESLGADHK 172

Query: 197 DWRNSSLTADVPYFLLTIAPNSRATIRHLKDWEACEGDGQKLLFGFYDPCHLQNHPGWPL 256
              +     + P+FL +   +    +  L++    +    +L  GF DP  +    GW L
Sbjct: 173 ILFDFYRKNNFPFFLYSKQSSKMLELSELENNTNPD---DELCVGFADPSPVAYSAGWML 229

Query: 257 RNFLALILTRW-KLKSVLFLCYRENRGFTDLGLSLVGEALITVPQGWGDHQCVPNTVGWE 315
           RN LA +       K V     R         L         +    G    VP  VGWE
Sbjct: 230 RNVLAAVAHLHPTWKHVHIFSLRSADSIGIKYLWTTLLPSAELSSD-GAQNAVPKAVGWE 288

Query: 316 LNK-GRKVPRCISLAKSMDPTRLAISAADLNLKLMRWRQLPSLNLDILSSRKCLLLGAGT 374
            N  G+  P  + L+K  DP RLA  + DLNLKLM+WR  P L L+  S  K LLLGAGT
Sbjct: 289 RNANGKLQPISVDLSKEFDPKRLAERSVDLNLKLMKWRLHPDLQLERYSQLKVLLLGAGT 348

Query: 375 LGCQVARMLMAWGVRKITLLDNGRVAMSNPLRQSLYTLDDCLNGGDFKAMAAVKSLERIF 434
           LGC VAR L+ WGVR IT +DNG+V+ SNP+RQSL   +DCL GG  KA  A K+L+RIF
Sbjct: 349 LGCNVARCLIGWGVRHITFVDNGKVSYSNPVRQSLSNFEDCLLGGRGKAETAQKALKRIF 408

Query: 435 PAVAAEGVVMAIPMPGHPVPCQEEDSVLDDCRRLTDLILSHDVIFLLTDTRESRWLPTLL 494
           P++ A G  + +PMPGHP+  ++   +  D  RL  LI  HDV+FLL D+RE+RWLPT+L
Sbjct: 409 PSIQATGHRLTVPMPGHPIDEKDVPELEKDIARLEQLIKDHDVVFLLLDSREARWLPTVL 468

Query: 495 CANTNKITITAALGFDSFLVMRHGPGPFSITHDVKTEAVNGLSADMDNLGLNNRDGGQRL 554
           C+   KI I+AALGFDS++VMRHG G             +   +D+ +          RL
Sbjct: 469 CSRHKKIAISAALGFDSYVVMRHGIGR------------SESVSDVSSSDSVPY---SRL 513

Query: 555 GCYFCNDVVAPTDSTANRTLDQQCTVTRPGLAPIASALAVELFVGVLHHPKGIYAGAEFA 614
           GCYFCNDV AP DST +RTLDQQCTVTRPG A IAS LAVEL V VL HP          
Sbjct: 514 GCYFCNDVTAPGDSTTDRTLDQQCTVTRPGTAMIASGLAVELLVSVLQHPLPSKT----P 569

Query: 615 NSIDSGSSEQPLGILPHQIRGSLSQFSQMTLVGHSSNSCTACCSTVVSEYRKRGMEFILQ 674
            S D  ++   LG LPHQIRG L +F Q+ L     + C AC   V +EY++RG +F+  
Sbjct: 570 ASHDDNTT--VLGALPHQIRGFLGRFQQILLSVKRFDQCVACSDAVAAEYQQRGWKFVRD 627

Query: 675 AINHPTYLEDLTGLTELKKSANSFHVDW-DYESDNED 710
           A+N P YLEDLTGLTELK  ++   +D  D+ESD++D
Sbjct: 628 AMNSPGYLEDLTGLTELKNESSVNAIDIQDFESDDDD 664

This model represents a family of eukaryotic proteins found in animals, plants, and yeasts, including Apg7p (YHR171W) from Saccharomyces cerevisiae and GSA7 from Pichia pastoris. Members are about 650 to 700 residues in length and include a central domain of about 150 residues shared with the ThiF/MoeB/HesA family of proteins. A low level of similarity to ubiquitin-activating enzyme E1 is described in a paper on peroxisome autophagy mediated by GSA7, and is the basis of the name ubiquitin activating enzyme E1-like protein. Members of the family appear to be involved in protein lipidation events analogous to ubiquitination and required for membrane fusion events during autophagy. Length = 664
>gnl|CDD|238763 cd01486, Apg7, Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively Back     alignment and domain information
>gnl|CDD|216180 pfam00899, ThiF, ThiF family Back     alignment and domain information
>gnl|CDD|238760 cd01483, E1_enzyme_family, Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>gnl|CDD|238386 cd00757, ThiF_MoeB_HesA_family, ThiF_MoeB_HesA Back     alignment and domain information
>gnl|CDD|223552 COG0476, ThiF, Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 2 [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|181084 PRK07688, PRK07688, thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>gnl|CDD|162820 TIGR02356, adenyl_thiF, thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>gnl|CDD|180204 PRK05690, PRK05690, molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>gnl|CDD|131408 TIGR02355, moeB, molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>gnl|CDD|183547 PRK12475, PRK12475, thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>gnl|CDD|236320 PRK08644, PRK08644, thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>gnl|CDD|235528 PRK05600, PRK05600, thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>gnl|CDD|236337 PRK08762, PRK08762, molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>gnl|CDD|238764 cd01487, E1_ThiF_like, E1_ThiF_like Back     alignment and domain information
>gnl|CDD|235526 PRK05597, PRK05597, molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>gnl|CDD|238761 cd01484, E1-2_like, Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>gnl|CDD|238765 cd01488, Uba3_RUB, Ubiquitin activating enzyme (E1) subunit UBA3 Back     alignment and domain information
>gnl|CDD|216527 pfam01488, Shikimate_DH, Shikimate / quinate 5-dehydrogenase Back     alignment and domain information
>gnl|CDD|133452 cd05213, NAD_bind_Glutamyl_tRNA_reduct, NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>gnl|CDD|162819 TIGR02354, thiF_fam2, thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 715
KOG2337669 consensus Ubiquitin activating E1 enzyme-like prot 100.0
TIGR01381664 E1_like_apg7 E1-like protein-activating enzyme Gsa 100.0
cd01486307 Apg7 Apg7 is an E1-like protein, that activates tw 100.0
KOG2017427 consensus Molybdopterin synthase sulfurylase [Coen 100.0
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 100.0
PRK07411390 hypothetical protein; Validated 100.0
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 100.0
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 100.0
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 100.0
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 100.0
PRK08223287 hypothetical protein; Validated 100.0
PRK05600370 thiamine biosynthesis protein ThiF; Validated 100.0
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Vali 100.0
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 100.0
PRK08328231 hypothetical protein; Provisional 100.0
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 100.0
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 100.0
COG0476254 ThiF Dinucleotide-utilizing enzymes involved in mo 100.0
TIGR03603318 cyclo_dehy_ocin bacteriocin biosynthesis cyclodehy 100.0
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 100.0
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 100.0
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 100.0
cd01488291 Uba3_RUB Ubiquitin activating enzyme (E1) subunit 100.0
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 99.97
PRK14852 989 hypothetical protein; Provisional 99.97
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 99.97
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 99.97
PRK14851 679 hypothetical protein; Provisional 99.97
PRK07877 722 hypothetical protein; Provisional 99.97
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 99.96
cd01491286 Ube1_repeat1 Ubiquitin activating enzyme (E1), rep 99.96
cd01489312 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit 99.96
TIGR01408 1008 Ube1 ubiquitin-activating enzyme E1. This model re 99.96
cd01490 435 Ube1_repeat2 Ubiquitin activating enzyme (E1), rep 99.95
KOG2015422 consensus NEDD8-activating complex, catalytic comp 99.95
KOG2013 603 consensus SMT3/SUMO-activating complex, catalytic 99.94
cd01483143 E1_enzyme_family Superfamily of activating enzymes 99.94
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 99.94
PRK15116268 sulfur acceptor protein CsdL; Provisional 99.94
KOG2336422 consensus Molybdopterin biosynthesis-related prote 99.94
cd01493425 APPBP1_RUB Ubiquitin activating enzyme (E1) subuni 99.93
TIGR01408 1008 Ube1 ubiquitin-activating enzyme E1. This model re 99.92
PRK06153393 hypothetical protein; Provisional 99.92
COG1179263 Dinucleotide-utilizing enzymes involved in molybdo 99.92
TIGR03736244 PRTRC_ThiF PRTRC system ThiF family protein. A nov 99.91
KOG2012 1013 consensus Ubiquitin activating enzyme UBA1 [Posttr 99.87
PTZ00245287 ubiquitin activating enzyme; Provisional 99.85
KOG2018430 consensus Predicted dinucleotide-utilizing enzyme 99.82
KOG2014331 consensus SMT3/SUMO-activating complex, AOS1/RAD31 99.79
TIGR03693 637 ocin_ThiF_like putative thiazole-containing bacter 99.69
KOG2012 1013 consensus Ubiquitin activating enzyme UBA1 [Posttr 99.69
KOG2016 523 consensus NEDD8-activating complex, APP-BP1/UBA5 c 99.62
PF0523784 MoeZ_MoeB: MoeZ/MoeB domain; InterPro: IPR007901 T 99.22
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 98.09
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 98.08
PRK12549284 shikimate 5-dehydrogenase; Reviewed 97.96
COG4015217 Predicted dinucleotide-utilizing enzyme of the Thi 97.59
PF03435386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 97.56
PRK12548289 shikimate 5-dehydrogenase; Provisional 97.54
PRK14027283 quinate/shikimate dehydrogenase; Provisional 97.41
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 97.26
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 97.25
PRK06718202 precorrin-2 dehydrogenase; Reviewed 97.18
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 97.15
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 97.0
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 96.96
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 96.93
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 96.89
PRK13940414 glutamyl-tRNA reductase; Provisional 96.87
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 96.78
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 96.76
TIGR03882193 cyclo_dehyd_2 bacteriocin biosynthesis cyclodehydr 96.75
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 96.65
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 96.65
PRK06719157 precorrin-2 dehydrogenase; Validated 96.55
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 96.52
COG1086588 Predicted nucleoside-diphosphate sugar epimerases 96.51
COG0569225 TrkA K+ transport systems, NAD-binding component [ 96.38
PLN00203519 glutamyl-tRNA reductase 96.33
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 96.25
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 96.21
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 96.21
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 96.2
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 96.17
PRK05562223 precorrin-2 dehydrogenase; Provisional 96.11
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 95.99
PRK14982340 acyl-ACP reductase; Provisional 95.97
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 95.91
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 95.82
PRK08618325 ornithine cyclodeaminase; Validated 95.79
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 95.78
PLN02928347 oxidoreductase family protein 95.77
PRK09242257 tropinone reductase; Provisional 95.74
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 95.68
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 95.65
PRK06197306 short chain dehydrogenase; Provisional 95.6
PRK07063260 short chain dehydrogenase; Provisional 95.59
PRK06141314 ornithine cyclodeaminase; Validated 95.5
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 95.45
PRK07062265 short chain dehydrogenase; Provisional 95.4
PRK07831262 short chain dehydrogenase; Provisional 95.39
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 95.37
PF03949255 Malic_M: Malic enzyme, NAD binding domain; InterPr 95.34
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 95.33
PRK05854313 short chain dehydrogenase; Provisional 95.31
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.29
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.27
PRK05875276 short chain dehydrogenase; Provisional 95.24
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 95.19
PRK12550272 shikimate 5-dehydrogenase; Reviewed 95.18
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 95.18
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 95.17
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 95.14
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 95.12
PRK07574385 formate dehydrogenase; Provisional 95.1
PRK08291330 ectoine utilization protein EutC; Validated 95.08
PRK09186256 flagellin modification protein A; Provisional 95.07
PRK06436303 glycerate dehydrogenase; Provisional 95.05
cd05312279 NAD_bind_1_malic_enz NAD(P) binding domain of mali 95.04
PRK13243333 glyoxylate reductase; Reviewed 95.02
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 95.0
PRK07340304 ornithine cyclodeaminase; Validated 95.0
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 94.97
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 94.96
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 94.94
PRK07523255 gluconate 5-dehydrogenase; Provisional 94.93
PF02719293 Polysacc_synt_2: Polysaccharide biosynthesis prote 94.93
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 94.86
cd00762254 NAD_bind_malic_enz NAD(P) binding domain of malic 94.85
PRK06932314 glycerate dehydrogenase; Provisional 94.84
KOG0069336 consensus Glyoxylate/hydroxypyruvate reductase (D- 94.83
PRK06194287 hypothetical protein; Provisional 94.8
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 94.79
PLN02780320 ketoreductase/ oxidoreductase 94.79
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.74
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 94.74
PRK06487317 glycerate dehydrogenase; Provisional 94.7
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 94.7
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 94.69
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 94.66
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 94.62
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 94.57
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 94.54
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.54
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 94.54
PRK13403335 ketol-acid reductoisomerase; Provisional 94.54
PRK05866293 short chain dehydrogenase; Provisional 94.48
PRK06476258 pyrroline-5-carboxylate reductase; Reviewed 94.47
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 94.44
PRK00048257 dihydrodipicolinate reductase; Provisional 94.4
PLN03209 576 translocon at the inner envelope of chloroplast su 94.38
PLN02688266 pyrroline-5-carboxylate reductase 94.33
KOG4169261 consensus 15-hydroxyprostaglandin dehydrogenase an 94.31
PRK07680273 late competence protein ComER; Validated 94.31
PLN03139386 formate dehydrogenase; Provisional 94.3
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.3
PRK12480330 D-lactate dehydrogenase; Provisional 94.29
PRK08339263 short chain dehydrogenase; Provisional 94.25
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 94.23
PRK04148134 hypothetical protein; Provisional 94.23
PRK07478254 short chain dehydrogenase; Provisional 94.2
PRK05867253 short chain dehydrogenase; Provisional 94.17
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 94.16
PRK06949258 short chain dehydrogenase; Provisional 94.13
PRK12939250 short chain dehydrogenase; Provisional 94.04
PRK05708305 2-dehydropantoate 2-reductase; Provisional 94.02
PRK08277278 D-mannonate oxidoreductase; Provisional 93.97
PRK15438378 erythronate-4-phosphate dehydrogenase PdxB; Provis 93.97
PLN02427386 UDP-apiose/xylose synthase 93.95
PRK08251248 short chain dehydrogenase; Provisional 93.95
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 93.91
PLN02602350 lactate dehydrogenase 93.88
PTZ00142 470 6-phosphogluconate dehydrogenase; Provisional 93.85
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 93.85
PRK06138252 short chain dehydrogenase; Provisional 93.84
PTZ00075476 Adenosylhomocysteinase; Provisional 93.83
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 93.8
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.76
PRK12921305 2-dehydropantoate 2-reductase; Provisional 93.76
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 93.74
PLN02306386 hydroxypyruvate reductase 93.72
PLN02494477 adenosylhomocysteinase 93.7
PRK13304265 L-aspartate dehydrogenase; Reviewed 93.68
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 93.68
PRK07576264 short chain dehydrogenase; Provisional 93.67
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 93.67
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 93.64
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 93.6
PTZ00345365 glycerol-3-phosphate dehydrogenase; Provisional 93.59
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.59
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.56
PRK07326237 short chain dehydrogenase; Provisional 93.56
PRK12439341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 93.56
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 93.5
PRK05876275 short chain dehydrogenase; Provisional 93.47
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 93.45
PRK06172253 short chain dehydrogenase; Provisional 93.44
PLN02240352 UDP-glucose 4-epimerase 93.42
PRK10637 457 cysG siroheme synthase; Provisional 93.4
PRK06928277 pyrroline-5-carboxylate reductase; Reviewed 93.39
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 93.37
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 93.35
PTZ00325321 malate dehydrogenase; Provisional 93.34
PRK14620326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 93.32
PRK07502307 cyclohexadienyl dehydrogenase; Validated 93.28
PRK06125259 short chain dehydrogenase; Provisional 93.27
PRK05479330 ketol-acid reductoisomerase; Provisional 93.26
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 93.24
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 93.23
PRK08213259 gluconate 5-dehydrogenase; Provisional 93.23
PRK07774250 short chain dehydrogenase; Provisional 93.18
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 93.16
PTZ00117319 malate dehydrogenase; Provisional 93.03
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 93.0
TIGR03376342 glycerol3P_DH glycerol-3-phosphate dehydrogenase ( 92.98
PRK06139330 short chain dehydrogenase; Provisional 92.98
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 92.95
PRK06181263 short chain dehydrogenase; Provisional 92.94
PRK08265261 short chain dehydrogenase; Provisional 92.93
PRK07453322 protochlorophyllide oxidoreductase; Validated 92.9
PRK08229341 2-dehydropantoate 2-reductase; Provisional 92.85
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 92.82
TIGR00465314 ilvC ketol-acid reductoisomerase. This is the seco 92.8
PRK06198260 short chain dehydrogenase; Provisional 92.76
PRK08589272 short chain dehydrogenase; Validated 92.74
PTZ00082321 L-lactate dehydrogenase; Provisional 92.73
PRK13302271 putative L-aspartate dehydrogenase; Provisional 92.71
PRK06199379 ornithine cyclodeaminase; Validated 92.7
PRK09496 453 trkA potassium transporter peripheral membrane com 92.69
PRK06196315 oxidoreductase; Provisional 92.69
PRK06500249 short chain dehydrogenase; Provisional 92.62
PRK07890258 short chain dehydrogenase; Provisional 92.56
PRK06940275 short chain dehydrogenase; Provisional 92.54
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.53
PRK05717255 oxidoreductase; Validated 92.52
PRK07109334 short chain dehydrogenase; Provisional 92.49
PRK07102243 short chain dehydrogenase; Provisional 92.47
PLN02253280 xanthoxin dehydrogenase 92.47
PRK08605332 D-lactate dehydrogenase; Validated 92.45
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 92.43
PLN00106323 malate dehydrogenase 92.42
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 92.42
PRK06914280 short chain dehydrogenase; Provisional 92.42
PRK05872296 short chain dehydrogenase; Provisional 92.4
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 92.35
PRK12828239 short chain dehydrogenase; Provisional 92.29
PRK05855582 short chain dehydrogenase; Validated 92.27
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 92.22
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 92.2
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 92.17
PRK09496453 trkA potassium transporter peripheral membrane com 92.16
PRK12937245 short chain dehydrogenase; Provisional 92.13
PRK08303305 short chain dehydrogenase; Provisional 92.13
PRK07067257 sorbitol dehydrogenase; Provisional 92.11
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Rev 92.1
PRK12829264 short chain dehydrogenase; Provisional 92.08
PRK06057255 short chain dehydrogenase; Provisional 92.01
PRK08374336 homoserine dehydrogenase; Provisional 92.0
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 91.98
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 91.95
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 91.89
PRK07074257 short chain dehydrogenase; Provisional 91.84
PRK06270341 homoserine dehydrogenase; Provisional 91.84
TIGR02622349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 91.82
PRK07097265 gluconate 5-dehydrogenase; Provisional 91.79
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 91.79
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 91.76
PRK06124256 gluconate 5-dehydrogenase; Provisional 91.74
PRK08267260 short chain dehydrogenase; Provisional 91.74
PTZ00431260 pyrroline carboxylate reductase; Provisional 91.73
PRK08085254 gluconate 5-dehydrogenase; Provisional 91.72
PRK07814263 short chain dehydrogenase; Provisional 91.72
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 91.71
PRK09880343 L-idonate 5-dehydrogenase; Provisional 91.69
cd02201304 FtsZ_type1 FtsZ is a GTPase that is similar to the 91.68
PRK07035252 short chain dehydrogenase; Provisional 91.67
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 91.66
PRK13529563 malate dehydrogenase; Provisional 91.65
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 91.61
cd01337310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 91.58
PRK12748256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 91.56
PRK12746254 short chain dehydrogenase; Provisional 91.56
PRK06046326 alanine dehydrogenase; Validated 91.56
PRK06841255 short chain dehydrogenase; Provisional 91.49
PRK12938246 acetyacetyl-CoA reductase; Provisional 91.48
PRK07806248 short chain dehydrogenase; Provisional 91.48
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 91.48
PRK06128300 oxidoreductase; Provisional 91.39
PRK13581526 D-3-phosphoglycerate dehydrogenase; Provisional 91.38
TIGR00036266 dapB dihydrodipicolinate reductase. 91.3
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 91.28
PRK06545359 prephenate dehydrogenase; Validated 91.25
TIGR01757387 Malate-DH_plant malate dehydrogenase, NADP-depende 91.25
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 91.16
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 91.13
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 91.11
PTZ00188 506 adrenodoxin reductase; Provisional 91.08
PRK02705 459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.08
TIGR00065349 ftsZ cell division protein FtsZ. This family consi 91.07
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 91.04
PRK07792306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 91.04
PRK08703239 short chain dehydrogenase; Provisional 91.03
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 91.02
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 91.01
PRK08324681 short chain dehydrogenase; Validated 91.0
PRK12779 944 putative bifunctional glutamate synthase subunit b 90.99
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 90.96
PLN02896353 cinnamyl-alcohol dehydrogenase 90.95
PLN02852 491 ferredoxin-NADP+ reductase 90.93
TIGR02632676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 90.93
PRK06407301 ornithine cyclodeaminase; Provisional 90.91
COG0300265 DltE Short-chain dehydrogenases of various substra 90.9
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 90.87
KOG0024354 consensus Sorbitol dehydrogenase [Secondary metabo 90.87
TIGR00872298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 90.85
PRK07454241 short chain dehydrogenase; Provisional 90.8
PF02423313 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-cryst 90.77
PRK12744257 short chain dehydrogenase; Provisional 90.75
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 90.75
PRK07825273 short chain dehydrogenase; Provisional 90.72
TIGR01772312 MDH_euk_gproteo malate dehydrogenase, NAD-dependen 90.7
PRK02472447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.7
PRK15181348 Vi polysaccharide biosynthesis protein TviC; Provi 90.67
PRK08278273 short chain dehydrogenase; Provisional 90.66
PRK12859256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 90.62
PRK09291257 short chain dehydrogenase; Provisional 90.59
PRK07024257 short chain dehydrogenase; Provisional 90.58
PRK09072263 short chain dehydrogenase; Provisional 90.54
PRK11908347 NAD-dependent epimerase/dehydratase family protein 90.53
PRK06523260 short chain dehydrogenase; Provisional 90.49
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 90.44
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 90.42
COG2085211 Predicted dinucleotide-binding enzymes [General fu 90.39
PLN02650351 dihydroflavonol-4-reductase 90.39
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 90.37
PRK08628258 short chain dehydrogenase; Provisional 90.31
PRK08643256 acetoin reductase; Validated 90.27
PRK12862 763 malic enzyme; Reviewed 90.26
TIGR01850346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 90.24
COG1712255 Predicted dinucleotide-utilizing enzyme [General f 90.23
PRK00676338 hemA glutamyl-tRNA reductase; Validated 90.22
PRK08655437 prephenate dehydrogenase; Provisional 90.2
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 90.15
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 90.12
PRK06720169 hypothetical protein; Provisional 90.11
COG0281432 SfcA Malic enzyme [Energy production and conversio 90.11
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 90.07
TIGR02415254 23BDH acetoin reductases. One member of this famil 90.06
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 90.02
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 90.01
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 89.97
PRK03562621 glutathione-regulated potassium-efflux system prot 89.97
PRK07677252 short chain dehydrogenase; Provisional 89.92
PRK12771564 putative glutamate synthase (NADPH) small subunit; 89.83
PRK10538248 malonic semialdehyde reductase; Provisional 89.82
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 89.81
PRK08306296 dipicolinate synthase subunit A; Reviewed 89.76
PLN03129581 NADP-dependent malic enzyme; Provisional 89.74
PRK05650270 short chain dehydrogenase; Provisional 89.72
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 89.7
PF0262996 CoA_binding: CoA binding domain; InterPro: IPR0037 89.69
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 89.66
TIGR02371325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 89.64
PRK12827249 short chain dehydrogenase; Provisional 89.64
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehy 89.63
PRK07201657 short chain dehydrogenase; Provisional 89.57
PRK12367245 short chain dehydrogenase; Provisional 89.51
PRK07904253 short chain dehydrogenase; Provisional 89.47
PRK11730715 fadB multifunctional fatty acid oxidation complex 89.46
PRK07775274 short chain dehydrogenase; Provisional 89.46
PRK06114254 short chain dehydrogenase; Provisional 89.4
PLN02653340 GDP-mannose 4,6-dehydratase 89.37
PRK07791286 short chain dehydrogenase; Provisional 89.2
PRK13018378 cell division protein FtsZ; Provisional 89.18
PRK07589346 ornithine cyclodeaminase; Validated 89.12
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 89.05
PRK08340259 glucose-1-dehydrogenase; Provisional 89.03
PRK08226263 short chain dehydrogenase; Provisional 89.02
PRK09330384 cell division protein FtsZ; Validated 89.0
PRK06223307 malate dehydrogenase; Reviewed 88.97
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 88.93
PRK07985294 oxidoreductase; Provisional 88.9
TIGR01759323 MalateDH-SF1 malate dehydrogenase. This model repr 88.88
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 88.88
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 88.88
PRK11259376 solA N-methyltryptophan oxidase; Provisional 88.86
COG0240329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 88.85
TIGR01289314 LPOR light-dependent protochlorophyllide reductase 88.84
TIGR02437714 FadB fatty oxidation complex, alpha subunit FadB. 88.82
KOG1205282 consensus Predicted dehydrogenase [Secondary metab 88.72
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 88.72
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 88.69
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 88.68
CHL00194317 ycf39 Ycf39; Provisional 88.68
TIGR01181317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 88.64
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 88.63
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 88.61
PRK12935247 acetoacetyl-CoA reductase; Provisional 88.61
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 88.55
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 88.53
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 88.51
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 88.49
PLN02740381 Alcohol dehydrogenase-like 88.43
PRK00141 473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 88.42
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 88.4
TIGR00561511 pntA NAD(P) transhydrogenase, alpha subunit. In so 88.32
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 88.26
PRK09135249 pteridine reductase; Provisional 88.24
PRK05884223 short chain dehydrogenase; Provisional 88.23
PF03447117 NAD_binding_3: Homoserine dehydrogenase, NAD bindi 88.23
PRK08862227 short chain dehydrogenase; Provisional 88.21
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 88.18
PRK08936261 glucose-1-dehydrogenase; Provisional 88.14
COG1250307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo 88.01
PRK08264238 short chain dehydrogenase; Validated 88.0
KOG1201300 consensus Hydroxysteroid 17-beta dehydrogenase 11 87.92
TIGR00873 467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 87.91
PRK06249313 2-dehydropantoate 2-reductase; Provisional 87.88
PLN02214342 cinnamoyl-CoA reductase 87.85
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 87.79
PLN02986322 cinnamyl-alcohol dehydrogenase family protein 87.71
PRK12490299 6-phosphogluconate dehydrogenase-like protein; Rev 87.65
PLN02350 493 phosphogluconate dehydrogenase (decarboxylating) 87.63
PRK06947248 glucose-1-dehydrogenase; Provisional 87.62
cd05297423 GH4_alpha_glucosidase_galactosidase Glycoside Hydr 87.58
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 87.46
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 87.38
PRK06567 1028 putative bifunctional glutamate synthase subunit b 87.38
PRK12743256 oxidoreductase; Provisional 87.32
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 87.32
PRK06823315 ornithine cyclodeaminase; Validated 87.3
PRK06182273 short chain dehydrogenase; Validated 87.29
TIGR02279 503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 87.28
PRK07370258 enoyl-(acyl carrier protein) reductase; Validated 87.27
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisiona 87.27
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 87.19
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 87.18
PRK12742237 oxidoreductase; Provisional 87.17
PRK07424406 bifunctional sterol desaturase/short chain dehydro 87.14
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 87.05
PRK05599246 hypothetical protein; Provisional 87.05
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 87.03
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 87.0
PRK15461296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 86.99
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 86.98
PRK13303265 L-aspartate dehydrogenase; Provisional 86.97
TIGR01472343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 86.96
COG0039313 Mdh Malate/lactate dehydrogenases [Energy producti 86.92
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 86.89
PRK06392326 homoserine dehydrogenase; Provisional 86.84
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 86.8
PF08659181 KR: KR domain; InterPro: IPR013968 This domain is 86.79
COG0345266 ProC Pyrroline-5-carboxylate reductase [Amino acid 86.78
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 86.77
PRK07856252 short chain dehydrogenase; Provisional 86.5
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 86.36
TIGR01771299 L-LDH-NAD L-lactate dehydrogenase. This model repr 86.31
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 86.29
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 86.26
PLN00198338 anthocyanidin reductase; Provisional 86.22
PRK07069251 short chain dehydrogenase; Validated 86.21
PRK04207341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 86.07
PLN02968381 Probable N-acetyl-gamma-glutamyl-phosphate reducta 86.04
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 85.94
cd05296 419 GH4_P_beta_glucosidase Glycoside Hydrolases Family 85.9
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 85.89
COG1062366 AdhC Zn-dependent alcohol dehydrogenases, class II 85.83
TIGR02441737 fa_ox_alpha_mit fatty acid oxidation complex, alph 85.82
PRK07832272 short chain dehydrogenase; Provisional 85.8
PRK05225487 ketol-acid reductoisomerase; Validated 85.74
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 85.73
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisiona 85.7
PRK04690 468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 85.7
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 85.7
PRK12814 652 putative NADPH-dependent glutamate synthase small 85.64
PRK15076 431 alpha-galactosidase; Provisional 85.64
PRK06701290 short chain dehydrogenase; Provisional 85.61
PLN02206442 UDP-glucuronate decarboxylase 85.54
PRK03659601 glutathione-regulated potassium-efflux system prot 85.53
TIGR01500256 sepiapter_red sepiapterin reductase. This model de 85.47
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 85.43
PRK09134258 short chain dehydrogenase; Provisional 85.3
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 85.25
PRK00811283 spermidine synthase; Provisional 85.15
PRK00257381 erythronate-4-phosphate dehydrogenase; Validated 85.11
PRK06349426 homoserine dehydrogenase; Provisional 85.11
PLN02827378 Alcohol dehydrogenase-like 85.08
PF1008797 DUF2325: Uncharacterized protein conserved in bact 84.94
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 84.87
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 84.75
PRK07060245 short chain dehydrogenase; Provisional 84.61
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 84.46
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 84.43
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisiona 84.4
PRK12770352 putative glutamate synthase subunit beta; Provisio 84.38
TIGR01179328 galE UDP-glucose-4-epimerase. This enzyme intercon 84.37
TIGR01214287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 84.33
PRK08818370 prephenate dehydrogenase; Provisional 84.33
cd02191303 FtsZ FtsZ is a GTPase that is similar to the eukar 84.25
PRK02318381 mannitol-1-phosphate 5-dehydrogenase; Provisional 84.11
>KOG2337 consensus Ubiquitin activating E1 enzyme-like protein [Coenzyme transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=6.9e-179  Score=1434.42  Aligned_cols=661  Identities=52%  Similarity=0.875  Sum_probs=591.4

Q ss_pred             CCceeeecCccCCChhhHHHHHhCCccccCCCCCCeeEEEEecCCCCCCCcceEEEecCCCCCCCcccccccccccCCCc
Q 005071           12 GSILQFAPFQSSVDEGFWHRLSSLKLNKLGIDESPIPITGFYAPCSHLQVSNHLSLLTESLPSDSDEQSSTAEISRGSRN   91 (715)
Q Consensus        12 ~~~l~f~p~~s~vd~~Fw~~L~~~KL~~~kLd~~~~~i~g~~~~~~~~~~~~~l~Ld~~SF~~~~~~~~~~~~~~~~~~~   91 (715)
                      +.+|||+||.|++|++|||+|+++|||+|||||+|+.|+|+|.+.+..+  +++++++.||+....            ..
T Consensus         5 ~~~LqFaPf~S~lD~~FWhels~~KLd~~kLD~sP~~I~~~~~~~~~sg--~~lsl~~~~~~~~~~------------~~   70 (669)
T KOG2337|consen    5 EIILQFAPFESFLDTGFWHELSELKLDKLKLDDSPKSITGHLTNRNASG--CLLSLSYGAFNSLAN------------TP   70 (669)
T ss_pred             cceeeecchhhhcchHHHHHHHhhhcchhcccCCcceeeceeccCCCcc--ceEEEecccccccCC------------CC
Confidence            3689999999999999999999999999999999999999999987766  899999999986532            12


Q ss_pred             eeeeeeeEEeccchHHhhccCHHHHHHHHHHHHHHhhhcCCcccCcccccchheeeeeccCCcEEEEEEEeeccCCCCCe
Q 005071           92 KCTVPGTLYNSNTLESFYTIDKQSLLKQEAKKIWEDIHSGKAVEDSTVLSRFLVISFADLKKWSFHYWFAFPALVLDPPA  171 (715)
Q Consensus        92 ~~~~~G~l~n~NTie~fk~~DK~~lL~~~g~~Iw~~i~~g~~~~~p~~l~~F~~ltfaDLKky~f~YwfafPa~~~~~~~  171 (715)
                      .+++.|+|||+||+|+||++||+.|++++|++||++|++|++++||++|++|+||||||||||+||||||||||+.+.+.
T Consensus        71 ~~~a~Gtl~N~NT~esFk~lDK~~ll~~ea~eiwesi~sG~aledP~lL~rFliisFADLKky~fyYW~~fPal~~~~~~  150 (669)
T KOG2337|consen   71 GCPAIGTLYNTNTLESFKNLDKQLLLEQEAEEIWESIKSGKALEDPNLLSRFLIISFADLKKYKFYYWFCFPALVLPEPV  150 (669)
T ss_pred             CCccceeeeccccHHHHhhhhHHHHHHHHHHHHHHhhccCccccChhhhhhhhhhhhhhhhhheeEEEeecchhhcCCcc
Confidence            38999999999999999999999999999999999999999999999999999999999999999999999988887664


Q ss_pred             eeeccCcccccCChHHHHHHHHHHhhhhhcCCCCCccEEEEEeecCCcceeccccchhhhcCCC-cceEEEEecCCCCCC
Q 005071          172 TVVDLKPASLWFSSQEAESVSAACSDWRNSSLTADVPYFLLTIAPNSRATIRHLKDWEACEGDG-QKLLFGFYDPCHLQN  250 (715)
Q Consensus       172 ~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~F~l~~~~~~~~~~~~~l~~~~~~~~~~-~~~~~~f~Dps~~~~  250 (715)
                      ......|.++.++...  .+.++++.|+........|||+++.+++..+.+.+|++.+.+..+. +.++ +++|||..++
T Consensus       151 ~~I~~~p~~~~~s~~~--~l~~~~~~~~d~~~~~~~pffl~s~ss~~~~~~~~l~~ld~c~~~~~k~~~-~~~D~~~la~  227 (669)
T KOG2337|consen  151 SLIKDLPPSQEFSPKG--SLGAACNILFDTARVYNFPFFLLSKSSDDESKILELSELDNCQGNHTKICL-VVYDPSQLAS  227 (669)
T ss_pred             hhhcccCchhccCccc--chHHHHHHHHhhhcccccceEEEEccccchhhhhhhhhhhhcccCCceEEE-Eecccccccc
Confidence            4333455556666655  5667888999887778999999999887788888899888876654 4566 9999999999


Q ss_pred             CCChhHHHHHHHHHhhcCceeEEEEEEEcCCCcc-cCCCceEEEEEeecCCCCCCCCCCcccccEEec-CCcccceEecc
Q 005071          251 HPGWPLRNFLALILTRWKLKSVLFLCYRENRGFT-DLGLSLVGEALITVPQGWGDHQCVPNTVGWELN-KGRKVPRCISL  328 (715)
Q Consensus       251 ~pgw~lRN~l~~~~~~~~~~~~~v~~~R~~~~~~-~~~~S~~~~~~~~~~~~~~~~~~~~~~~gwe~~-~gkl~pr~~dl  328 (715)
                      +||||+||+|++++++|.++.+.++|||++++.- +++.++.+.+..+..   ...+..|+++|||+| +||++||+|||
T Consensus       228 ~pgwplrN~La~~~~~~~~~~i~~~~lR~~~~~~~~~s~~~~~~~~~~~~---~s~~~~~k~VGWErN~~Gkl~PR~V~L  304 (669)
T KOG2337|consen  228 YPGWPLRNFLALAAHRWPLKHIHFFLLRDRQNMGIDLSLVIKFAVTLACD---LSQNAVPKAVGWERNKNGKLGPRMVDL  304 (669)
T ss_pred             cCChhhHHHHHHHHhhcccceeEEEEEEeccccCccceeEEEEEEecccc---ccccCCccccceeeccCCCcCceEEeh
Confidence            9999999999999999999999999999976433 554555555555542   234578999999999 89999999999


Q ss_pred             cCCCChhhhhhhhhhhhhhhhhhhcCCchhHHhhccCeEEEEcCChHHHHHHHHHHHhcCCeEEEEeCCcccccCCCcCC
Q 005071          329 AKSMDPTRLAISAADLNLKLMRWRQLPSLNLDILSSRKCLLLGAGTLGCQVARMLMAWGVRKITLLDNGRVAMSNPLRQS  408 (715)
Q Consensus       329 ~~~~dp~~la~~a~dlnlry~R~rllp~~gq~kL~~~kVlIvGaGgLGs~VA~~La~~GVg~ItLVD~D~Ve~sNl~RQ~  408 (715)
                      +.+|||.+|+|+++|+|+++||||++|+++++++++.|||++|||+|||+|||+|++|||+||||||+++|++||++||.
T Consensus       305 s~~mDP~~LaessVdLNLkLMkWRlvPdLnLd~is~~KcLLLGAGTLGC~VAR~Ll~WGvRhITFvDn~kVsySNPVRQs  384 (669)
T KOG2337|consen  305 SDSMDPKKLAESSVDLNLKLMKWRLVPDLNLDIISQTKCLLLGAGTLGCNVARNLLGWGVRHITFVDNGKVSYSNPVRQS  384 (669)
T ss_pred             hhccChHHHhhhhcccchheeeeeecCccchhhhhcceeEEecCcccchHHHHHHHhhccceEEEEecCeeeccchhhhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCcchhcCCCCcHHHHHHHHHHhhCCCcEEEEEecccCCCCCCCCCccccccccchhhHHHhhccCCEEEEeCCChHHH
Q 005071          409 LYTLDDCLNGGDFKAMAAVKSLERIFPAVAAEGVVMAIPMPGHPVPCQEEDSVLDDCRRLTDLILSHDVIFLLTDTRESR  488 (715)
Q Consensus       409 L~~~~Di~~~G~~KAeaaa~~L~~inP~v~v~~~~~~Ipmpgh~~~~~~~~~~~~~~~~l~~li~~~DvV~~~tDs~esR  488 (715)
                      ||+++||.++|++||++|+++|++|||.++.+++.++||||||||+++.+++...+.+.++++|++||+||++||+||+|
T Consensus       385 Ly~FEDc~~~g~~KAe~Aa~rLk~IfP~m~atG~~lsIPMpGH~I~e~~~e~~~~D~~~Le~LI~~HDviFLLtDsRESR  464 (669)
T KOG2337|consen  385 LYTFEDCLGGGRPKAETAAQRLKEIFPSMEATGYVLSIPMPGHPIGESLLEQTKKDLKRLEQLIKDHDVIFLLTDSRESR  464 (669)
T ss_pred             hhhhhhhhccCCcchHHHHHHHHHhCccccccceEEeccCCCCccchhhHHHHHHHHHHHHHHHhhcceEEEEeccchhh
Confidence            99999998889999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhcCCeEEEeeeCCceEEEEEcCCCCCcccccccchhccCccccccccCCCCCCCCCCcCceeecccCCCCCC
Q 005071          489 WLPTLLCANTNKITITAALGFDSFLVMRHGPGPFSITHDVKTEAVNGLSADMDNLGLNNRDGGQRLGCYFCNDVVAPTDS  568 (715)
Q Consensus       489 ~li~~~~~~~~kp~I~aalG~~g~vv~~~g~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gCy~C~d~~aP~~s  568 (715)
                      |+++.+|..++|.+||+|+|||+|+|||||.++.......            .+.+ -..+++.++|||||+|++||+||
T Consensus       465 WLPtll~a~~~KivINaALGFDsylVMRHG~~~~~~~~d~------------q~s~-~~~i~~~qLGCYFCnDV~AP~nS  531 (669)
T KOG2337|consen  465 WLPTLLAAAKNKIVINAALGFDSYLVMRHGTGRKEASDDG------------QSSD-LKCINGDQLGCYFCNDVVAPGNS  531 (669)
T ss_pred             hhHHHHHhhhcceEeeeecccceeEEEecCCCCccccccc------------cccc-ccccCcccceeEeEcceecCCCc
Confidence            9999999999999999999999999999998863221111            1111 13456789999999999999999


Q ss_pred             CccccccccccccCcchHHHHHHHHHHHHHHHhcCCCCCCCCccccCCCCCCCCCCCCCceeEEEecCCCCeeeEEecCC
Q 005071          569 TANRTLDQQCTVTRPGLAPIASALAVELFVGVLHHPKGIYAGAEFANSIDSGSSEQPLGILPHQIRGSLSQFSQMTLVGH  648 (715)
Q Consensus       569 ~~drtLdq~CtV~~Pgv~~ias~~A~Ell~~ll~hp~g~~a~~~~~~~~~~~~~~~~Lg~~p~~irg~~~~f~~~~l~~~  648 (715)
                      +.||||||||||+|||+++||+++|||+|+++||||.|... +.. .+....+++++||..|||||||+++|+++++.++
T Consensus       532 l~DRTLDQqCTVtRPG~a~IA~alAVELlvslLQhP~~~a~-~~s-~~~~~n~~~tvLG~lPHQIRGfL~nFs~i~~~~~  609 (669)
T KOG2337|consen  532 LTDRTLDQQCTVTRPGVANIASALAVELLVSLLQHPLGYAQ-NSS-EETEENEPTTVLGILPHQIRGFLHNFSNILPSTQ  609 (669)
T ss_pred             ccccchhheeeccCCchhHHHHHHHHHHHHHHHhCcccccc-CCC-cccccCCCCcccccccHHHHHhhhhhhhhccccc
Confidence            99999999999999999999999999999999999977433 221 1122235678999999999999999999999999


Q ss_pred             CCCCCCCCChhHHHHHHHhCHHHHHHHhcCCchhhhccChhHHHHhhccccccccCCCC
Q 005071          649 SSNSCTACCSTVVSEYRKRGMEFILQAINHPTYLEDLTGLTELKKSANSFHVDWDYESD  707 (715)
Q Consensus       649 ~~~~C~aCs~~v~~~y~~~g~~f~~~~~~~~~~le~~~Gl~~~~~~~~~~~~~~~~~~~  707 (715)
                      +|++|+|||++|+++|+++||.||.++||+|+|||++|||+++|+++....+||+|||+
T Consensus       610 af~qC~ACS~~Vi~ey~~eGw~Fv~ka~n~p~yLEdltGL~elk~~~ns~~~d~eDdE~  668 (669)
T KOG2337|consen  610 AFDQCTACSEAVINEYKREGWAFVLKAFNSPKYLEDLTGLSELKQELNSEIIDFEDDES  668 (669)
T ss_pred             cccccchhhHHHHHHHHHhhHHHHHHHhcCccHHHHhhCHHHHHHHhccceeeccccCC
Confidence            99999999999999999999999999999999999999999999997776677876654

>TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p Back     alignment and domain information
>cd01486 Apg7 Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively Back     alignment and domain information
>KOG2017 consensus Molybdopterin synthase sulfurylase [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>COG0476 ThiF Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 2 [Coenzyme metabolism] Back     alignment and domain information
>TIGR03603 cyclo_dehy_ocin bacteriocin biosynthesis cyclodehydratase, SagC family Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>cd01488 Uba3_RUB Ubiquitin activating enzyme (E1) subunit UBA3 Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PRK14852 hypothetical protein; Provisional Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>PRK14851 hypothetical protein; Provisional Back     alignment and domain information
>PRK07877 hypothetical protein; Provisional Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 Back     alignment and domain information
>cd01489 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 Back     alignment and domain information
>TIGR01408 Ube1 ubiquitin-activating enzyme E1 Back     alignment and domain information
>cd01490 Ube1_repeat2 Ubiquitin activating enzyme (E1), repeat 2 Back     alignment and domain information
>KOG2015 consensus NEDD8-activating complex, catalytic component UBA3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2013 consensus SMT3/SUMO-activating complex, catalytic component UBA2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>KOG2336 consensus Molybdopterin biosynthesis-related protein [Coenzyme transport and metabolism] Back     alignment and domain information
>cd01493 APPBP1_RUB Ubiquitin activating enzyme (E1) subunit APPBP1 Back     alignment and domain information
>TIGR01408 Ube1 ubiquitin-activating enzyme E1 Back     alignment and domain information
>PRK06153 hypothetical protein; Provisional Back     alignment and domain information
>COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] Back     alignment and domain information
>TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein Back     alignment and domain information
>KOG2012 consensus Ubiquitin activating enzyme UBA1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00245 ubiquitin activating enzyme; Provisional Back     alignment and domain information
>KOG2018 consensus Predicted dinucleotide-utilizing enzyme involved in molybdopterin and thiamine biosynthesis [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2014 consensus SMT3/SUMO-activating complex, AOS1/RAD31 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03693 ocin_ThiF_like putative thiazole-containing bacteriocin maturation protein Back     alignment and domain information
>KOG2012 consensus Ubiquitin activating enzyme UBA1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2016 consensus NEDD8-activating complex, APP-BP1/UBA5 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05237 MoeZ_MoeB: MoeZ/MoeB domain; InterPro: IPR007901 This putative domain is found in the MoeZ protein and the MoeB protein Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>COG4015 Predicted dinucleotide-utilizing enzyme of the ThiF/HesA family [General function prediction only] Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>TIGR03882 cyclo_dehyd_2 bacteriocin biosynthesis cyclodehydratase domain Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PF03949 Malic_M: Malic enzyme, NAD binding domain; InterPro: IPR012302 Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate [], a reaction important in a number of metabolic pathways - e Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1 Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>cd00762 NAD_bind_malic_enz NAD(P) binding domain of malic enzyme Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>KOG4169 consensus 15-hydroxyprostaglandin dehydrogenase and related dehydrogenases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PRK10637 cysG siroheme synthase; Provisional Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK06199 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08374 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06270 homoserine dehydrogenase; Provisional Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PTZ00431 pyrroline carboxylate reductase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>cd02201 FtsZ_type1 FtsZ is a GTPase that is similar to the eukaryotic tubulins and is essential for cell division in prokaryotes Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PRK13529 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR00065 ftsZ cell division protein FtsZ Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK06407 ornithine cyclodeaminase; Provisional Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF02423 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-crystallin family; InterPro: IPR003462 This entry represents the bacterial ornithine cyclodeaminase enzyme family, which catalyse the deamination of ornithine to proline [] Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK12862 malic enzyme; Reviewed Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>PRK00676 hemA glutamyl-tRNA reductase; Validated Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>COG0281 SfcA Malic enzyme [Energy production and conversion] Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PLN03129 NADP-dependent malic enzyme; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PF02629 CoA_binding: CoA binding domain; InterPro: IPR003781 This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13018 cell division protein FtsZ; Provisional Back     alignment and domain information
>PRK07589 ornithine cyclodeaminase; Validated Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09330 cell division protein FtsZ; Validated Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>KOG1205 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PLN02740 Alcohol dehydrogenase-like Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>cd05297 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK06823 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06392 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>TIGR01771 L-LDH-NAD L-lactate dehydrogenase Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>cd05296 GH4_P_beta_glucosidase Glycoside Hydrolases Family 4; Phospho-beta-glucosidase Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05225 ketol-acid reductoisomerase; Validated Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK15076 alpha-galactosidase; Provisional Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PLN02827 Alcohol dehydrogenase-like Back     alignment and domain information
>PF10087 DUF2325: Uncharacterized protein conserved in bacteria (DUF2325); InterPro: IPR016772 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>cd02191 FtsZ FtsZ is a GTPase that is similar to the eukaryotic tubulins and is essential for cell division in prokaryotes Back     alignment and domain information
>PRK02318 mannitol-1-phosphate 5-dehydrogenase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query715
3vx8_D323 Crystal Structure Of Arabidopsis Thaliana Atg7ntd-A 1e-135
4gsl_A615 Crystal Structure Of An Atg7-Atg3 Crosslinked Compl 1e-116
3vh2_A616 Crystal Structure Of Saccharomyces Cerevisiae Atg7 1e-115
4gsk_A615 Crystal Structure Of An Atg7-Atg10 Crosslinked Comp 1e-115
3vh1_A598 Crystal Structure Of Saccharomyces Cerevisiae Atg7 1e-111
3t7e_A344 Atg8 Transfer From Atg7 To Atg3: A Distinctive E1-E 9e-92
3vh3_A340 Crystal Structure Of Atg7ctd-Atg8 Complex Length = 8e-90
3rui_A340 Crystal Structure Of Atg7c-Atg8 Complex Length = 34 2e-87
3ruj_A296 Crystal Structure Of N-Terminal Region Of Yeast Atg 2e-18
3t7g_A291 Atg8 Transfer From Atg7 To Atg3: A Distinctive E1-E 1e-17
3t7f_A291 Atg8 Transfer From Atg7 To Atg3: A Distinctive E1-E 5e-17
4gsj_A291 Crystal Structure Of Atg7 Ntd K14a F16a D18a Mutant 8e-17
3t7h_A291 Atg8 Transfer From Atg7 To Atg3: A Distinctive E1-E 1e-16
3vx6_A283 Crystal Structure Of Kluyveromyces Marxianus Atg7nt 7e-14
1jwb_B249 Structure Of The Covalent Acyl-Adenylate Form Of Th 2e-05
3h5n_A353 Crystal Structure Of E. Coli Mccb + Atp Length = 35 1e-04
3h5a_A358 Crystal Structure Of E. Coli Mccb Length = 358 1e-04
>pdb|3VX8|D Chain D, Crystal Structure Of Arabidopsis Thaliana Atg7ntd-Atg3 Complex Length = 323 Back     alignment and structure 
Iteration: 1

 Score =  477 bits (1228), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 228/319 (71%), Positives = 268/319 (84%), Gaps = 3/319 (0%)
Query: 14  ILQFAPFQSSVDEGFWHRLSSLKLNKLGIDESPIPITGFYAPCSHLQVSNHLSLLTESLP 73
           ILQFAP  SSVDEGFWH  SSLKL+KLGID+SPI ITGFY PC H QVSNHL+LL+ESLP
Sbjct: 8   ILQFAPLNSSVDEGFWHSFSSLKLDKLGIDDSPISITGFYGPCGHPQVSNHLTLLSESLP 67
Query: 74  SDSDEQSSTAEISRGSRNKCTVPGTLYNSNTLESFYTIDKQSLLKQEAKKIWEDIHSGKA 133
            D  EQS  A  S G+RNKC VPG LYN+NT+ESF  +DKQSLLK EA KIWEDI SGKA
Sbjct: 68  LD--EQSLIASTSHGNRNKCPVPGILYNTNTVESFNKLDKQSLLKAEANKIWEDIQSGKA 125
Query: 134 VEDSTVLSRFLVISFADLKKWSFHYWFAFPALVLDPPATVVDLKPASLWFSSQEAESVSA 193
           +ED +VL RFLVISFADLKKWSF YWFAFPA VLDPP ++++LKPAS +FSS+EAESVSA
Sbjct: 126 LEDPSVLPRFLVISFADLKKWSFRYWFAFPAFVLDPPVSLIELKPASEYFSSEEAESVSA 185
Query: 194 ACSDWRNSSLTADVPYFLLTIAPNSRATIRHLKDWEACEGDGQKLLFGFYDPCHLQNHPG 253
           AC+DWR+S LT DVP+FL++++ +S+A+IRHLKD EAC+GD QKLLFGFYDPCHL ++PG
Sbjct: 186 ACNDWRDSDLTTDVPFFLVSVSSDSKASIRHLKDLEACQGDHQKLLFGFYDPCHLPSNPG 245
Query: 254 WPLRNFLALILTRWKLKSVLFLCYRENRGFTDLGLSLVGEALITVPQGWGDHQCVPNTVG 313
           WPLRN+LALI +RW L++V F CYRE+RGF DL LSLVG+A IT+  G    + VPN+VG
Sbjct: 246 WPLRNYLALIRSRWNLETVWFFCYRESRGFADLNLSLVGQASITLSSG-ESAETVPNSVG 304
Query: 314 WELNKGRKVPRCISLAKSM 332
           WELNKG++VPR ISLA SM
Sbjct: 305 WELNKGKRVPRSISLANSM 323
>pdb|4GSL|A Chain A, Crystal Structure Of An Atg7-Atg3 Crosslinked Complex Length = 615 Back     alignment and structure
>pdb|3VH2|A Chain A, Crystal Structure Of Saccharomyces Cerevisiae Atg7 (1-613) Length = 616 Back     alignment and structure
>pdb|4GSK|A Chain A, Crystal Structure Of An Atg7-Atg10 Crosslinked Complex Length = 615 Back     alignment and structure
>pdb|3VH1|A Chain A, Crystal Structure Of Saccharomyces Cerevisiae Atg7 (1-595) Length = 598 Back     alignment and structure
>pdb|3T7E|A Chain A, Atg8 Transfer From Atg7 To Atg3: A Distinctive E1-E2 Architecture And Mechanism In The Autophagy Pathway Length = 344 Back     alignment and structure
>pdb|3VH3|A Chain A, Crystal Structure Of Atg7ctd-Atg8 Complex Length = 340 Back     alignment and structure
>pdb|3RUI|A Chain A, Crystal Structure Of Atg7c-Atg8 Complex Length = 340 Back     alignment and structure
>pdb|3RUJ|A Chain A, Crystal Structure Of N-Terminal Region Of Yeast Atg7 Length = 296 Back     alignment and structure
>pdb|3T7G|A Chain A, Atg8 Transfer From Atg7 To Atg3: A Distinctive E1-E2 Architecture And Mechanism In The Autophagy Pathway Length = 291 Back     alignment and structure
>pdb|3T7F|A Chain A, Atg8 Transfer From Atg7 To Atg3: A Distinctive E1-E2 Architecture And Mechanism In The Autophagy Pathway Length = 291 Back     alignment and structure
>pdb|4GSJ|A Chain A, Crystal Structure Of Atg7 Ntd K14a F16a D18a Mutant Length = 291 Back     alignment and structure
>pdb|3T7H|A Chain A, Atg8 Transfer From Atg7 To Atg3: A Distinctive E1-E2 Architecture And Mechanism In The Autophagy Pathway Length = 291 Back     alignment and structure
>pdb|3VX6|A Chain A, Crystal Structure Of Kluyveromyces Marxianus Atg7ntd Length = 283 Back     alignment and structure
>pdb|1JWB|B Chain B, Structure Of The Covalent Acyl-Adenylate Form Of The Moeb-Moad Protein Complex Length = 249 Back     alignment and structure
>pdb|3H5N|A Chain A, Crystal Structure Of E. Coli Mccb + Atp Length = 353 Back     alignment and structure
>pdb|3H5A|A Chain A, Crystal Structure Of E. Coli Mccb Length = 358 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query715
3vh1_A598 Ubiquitin-like modifier-activating enzyme ATG7; au 0.0
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 1e-139
3t7h_A291 Ubiquitin-like modifier-activating enzyme ATG7; au 4e-81
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 3e-11
1y8q_B 640 Anthracycline-, ubiquitin-like 2 activating enzyme 1e-10
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 3e-10
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 3e-10
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 2e-09
1y8q_A346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 7e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-09
3cmm_A 1015 Ubiquitin-activating enzyme E1 1; UBA1, protein tu 1e-08
3cmm_A 1015 Ubiquitin-activating enzyme E1 1; UBA1, protein tu 2e-06
1tt5_B434 Ubiquitin-activating enzyme E1C isoform 1; cell cy 1e-08
1tt5_A 531 APPBP1, amyloid protein-binding protein 1; cell cy 2e-07
2nvu_B805 Maltose binding protein/NEDD8-activating enzyme E1 7e-06
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Length = 598 Back     alignment and structure
 Score =  658 bits (1699), Expect = 0.0
 Identities = 241/670 (35%), Positives = 341/670 (50%), Gaps = 82/670 (12%)

Query: 13  SILQFAP-FQSSVDEGFWHRLSSLKLNKLGIDESPIPITGFYAPCSHLQVSNHLSLLTES 71
            +L +AP F+S +D  F+  LS LKL+ L +D +  P+T      +  + ++ + L    
Sbjct: 8   RVLSYAPAFKSFLDTSFFQELSRLKLDVLKLDSTCQPLTVNLDLHNIPKSADQVPL---- 63

Query: 72  LPSDSDEQSSTAEISRGSRNKCTVPGTLYNSNTLESFYTIDKQSLLKQEAKKIWEDIHSG 131
                    S  + +    N+  + G+++N N L+ F  +DKQ  L Q A + WED    
Sbjct: 64  ----FLTNRSFEKHNNKRTNEVPLQGSIFNFNVLDEFKNLDKQLFLHQRALECWED---- 115

Query: 132 KAVEDSTVLSRFLVISFADLKKWSFHYWFAFPALVLDPPATVVDLKPASLWFSSQEAESV 191
             ++D      F++ISFADLKK+ F+YW   P         +               + +
Sbjct: 116 -GIKDINKCVSFVIISFADLKKYRFYYWLGVPCFQRPSSTVLHVR-------PEPSLKGL 167

Query: 192 SAACSDWRNSSLTADVPYFLLTIAPNSRATIRHLKDWEACEGDGQKLLFGFYDPCHLQNH 251
            + C  W + + +     ++  +  +       + +++ C     K+     D   ++N 
Sbjct: 168 FSKCQKWFDVNYSK----WVCILDADD-----EIVNYDKCIIRKTKV-LAIRDTSTMENV 217

Query: 252 PGWPLRNFLALILTRW-KLKSVLFLCYRENRGFTDLGLSLVGEALITVPQGWGDHQCVPN 310
           P    +NFL+++      L     L  R+N G   L  +       ++            
Sbjct: 218 PSALTKNFLSVLQYDVPDLIDFKLLIIRQNEGSFALNATFA-----SIDPQSSSSNPDMK 272

Query: 311 TVGWELN-KGRKVPRCISLAKSMDPTRLAISAADLNLKLMRWRQLPSLNLDILSSRKCLL 369
             GWE N +G+  PR + L+  +DP ++A  + DLNLKLM+WR LP LNLDI+ + K LL
Sbjct: 273 VSGWERNVQGKLAPRVVDLSSLLDPLKIADQSVDLNLKLMKWRILPDLNLDIIKNTKVLL 332

Query: 370 LGAGTLGCQVARMLMAWGVRKITLLDNGRVAMSNPLRQSLYTLDDCLNGGDFKAMAAVKS 429
           LGAGTLGC V+R L+AWGVRKIT +DNG V+ SNP+RQ+LY  +DC   G  KA  A  S
Sbjct: 333 LGAGTLGCYVSRALIAWGVRKITFVDNGTVSYSNPVRQALYNFEDC---GKPKAELAAAS 389

Query: 430 LERIFPAVAAEGVVMAIPMPGHPVPCQEEDSVLDDCRRLTDLILSHDVIFLLTDTRESRW 489
           L+RIFP + A GV ++IPM GH +  +E      D  RL  LI  HD+IFLL D+RESRW
Sbjct: 390 LKRIFPLMDATGVKLSIPMIGHKLVNEEAQHK--DFDRLRALIKEHDIIFLLVDSRESRW 447

Query: 490 LPTLLCANTNKITITAALGFDSFLVMRHGPGPFSITHDVKTEAVNGLSADMDNLGLNNRD 549
           LP+LL    NK  I AALGFDS+LVMRHG                               
Sbjct: 448 LPSLLSNIENKTVINAALGFDSYLVMRHGNRDEQ-------------------------- 481

Query: 550 GGQRLGCYFCNDVVAPTDSTANRTLDQQCTVTRPGLAPIASALAVELFVGVLHHPKGIYA 609
             ++LGCYFC+DVVAPTDS  +RTLDQ CTVTRPG+A +AS+LAVEL   +L        
Sbjct: 482 SSKQLGCYFCHDVVAPTDSLTDRTLDQMCTVTRPGVAMMASSLAVELMTSLLQTK----- 536

Query: 610 GAEFANSIDSGSSEQPLGILPHQIRGSLSQFSQMTLVGHSSNSCTACCSTVVSEYRKRGM 669
                    SGS    LG +PHQIRG L  FS + L   +   C AC   V+  +   G 
Sbjct: 537 --------YSGSETTVLGDIPHQIRGFLHNFSILKLETPAYEHCPACSPKVIEAFTDLGW 588

Query: 670 EFILQAINHP 679
           EF+ +A+ HP
Sbjct: 589 EFVKKALEHP 598
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Length = 340 Back     alignment and structure
>3t7h_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, ligase; 1.60A {Saccharomyces cerevisiae} PDB: 3t7f_A 3t7g_A 3ruj_A Length = 291 Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Length = 353 Back     alignment and structure
>1y8q_B Anthracycline-, ubiquitin-like 2 activating enzyme E1B; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_B* 3kyc_B* 3kyd_B* 2px9_A Length = 640 Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Length = 292 Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Length = 251 Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Length = 249 Back     alignment and structure
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Length = 346 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Length = 1015 Back     alignment and structure
>3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Length = 1015 Back     alignment and structure
>1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Length = 434 Back     alignment and structure
>1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* Length = 531 Back     alignment and structure
>2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 Length = 805 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query715
4gsl_A615 Ubiquitin-like modifier-activating enzyme ATG7; ub 100.0
3vh1_A598 Ubiquitin-like modifier-activating enzyme ATG7; au 100.0
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 100.0
3vx8_D323 Ubiquitin-like modifier-activating enzyme ATG7; E1 100.0
3vx6_A283 E1; 2.60A {Kluyveromyces marxianus} PDB: 3vx7_A 100.0
3t7h_A291 Ubiquitin-like modifier-activating enzyme ATG7; au 100.0
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 100.0
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 100.0
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 100.0
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 100.0
1tt5_B434 Ubiquitin-activating enzyme E1C isoform 1; cell cy 100.0
2nvu_B805 Maltose binding protein/NEDD8-activating enzyme E1 100.0
1y8q_A346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 100.0
1y8q_B 640 Anthracycline-, ubiquitin-like 2 activating enzyme 99.98
1tt5_A 531 APPBP1, amyloid protein-binding protein 1; cell cy 99.97
3cmm_A 1015 Ubiquitin-activating enzyme E1 1; UBA1, protein tu 99.97
3cmm_A 1015 Ubiquitin-activating enzyme E1 1; UBA1, protein tu 99.95
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 98.05
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 97.85
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 97.84
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 97.63
4ina_A405 Saccharopine dehydrogenase; structural genomics, P 97.39
3abi_A365 Putative uncharacterized protein PH1688; L-lysine 97.35
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 97.33
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 97.27
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 97.19
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 97.13
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 97.12
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 97.07
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenas 97.0
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 96.87
1id1_A153 Putative potassium channel protein; RCK domain, E. 96.86
1lss_A140 TRK system potassium uptake protein TRKA homolog; 96.83
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 96.81
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 96.79
3c85_A183 Putative glutathione-regulated potassium-efflux S 96.79
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 96.78
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 96.72
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 96.67
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 96.58
2axq_A467 Saccharopine dehydrogenase; rossmann fold variant, 96.55
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 96.51
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 96.5
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 96.49
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 96.43
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 96.43
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 96.37
1ff9_A450 Saccharopine reductase; lysine biosynthesis, alpha 96.22
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 96.2
2ph5_A 480 Homospermidine synthase; alpha-beta protein, struc 96.19
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 96.18
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 96.17
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 96.13
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 96.06
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 95.98
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 95.97
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 95.95
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 95.93
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 95.92
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 95.91
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 95.88
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 95.88
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 95.83
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 95.83
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 95.8
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 95.8
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 95.78
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 95.77
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 95.77
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 95.73
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 95.66
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 95.65
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 95.64
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 95.62
3nzo_A399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 95.62
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 95.61
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 95.58
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 95.57
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 95.56
1x7d_A350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 95.56
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 95.48
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 95.45
2rir_A300 Dipicolinate synthase, A chain; structural genomic 95.43
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 95.42
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 95.35
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 95.34
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 95.32
1pjq_A 457 CYSG, siroheme synthase; rossman fold, nucleotide 95.32
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 95.3
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 95.29
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 95.28
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 95.28
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 95.25
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 95.24
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 95.23
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 95.23
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 95.23
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 95.23
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 95.2
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 95.18
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 95.15
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 95.11
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 95.1
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 95.08
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 95.07
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 95.04
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 95.03
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 95.01
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 95.01
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 94.99
1omo_A322 Alanine dehydrogenase; two-domain, beta-sandwich-d 94.96
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 94.95
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 94.95
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 94.93
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 94.91
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 94.89
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 94.89
3qlj_A322 Short chain dehydrogenase; structural genomics, se 94.88
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 94.87
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 94.86
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 94.86
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 94.85
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 94.85
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 94.83
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 94.82
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 94.78
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 94.77
3slg_A372 PBGP3 protein; structural genomics, seattle struct 94.77
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 94.77
3tjr_A301 Short chain dehydrogenase; structural genomics, se 94.74
3imf_A257 Short chain dehydrogenase; structural genomics, in 94.74
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 94.72
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 94.7
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 94.68
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 94.68
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 94.67
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 94.67
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 94.67
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 94.67
1np3_A338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 94.66
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 94.66
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 94.65
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 94.64
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 94.63
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 94.63
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 94.6
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 94.6
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 94.6
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 94.59
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 94.58
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 94.57
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 94.57
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 94.56
3hdj_A313 Probable ornithine cyclodeaminase; APC62486, borde 94.55
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 94.54
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 94.54
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 94.51
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 94.51
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 94.5
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 94.5
3l6d_A306 Putative oxidoreductase; structural genomics, prot 94.5
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 94.49
3tl2_A315 Malate dehydrogenase; center for structural genomi 94.48
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 94.48
1spx_A278 Short-chain reductase family member (5L265); paral 94.47
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 94.47
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 94.46
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 94.45
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 94.45
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 94.44
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 94.41
3tsc_A277 Putative oxidoreductase; structural genomics, seat 94.41
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 94.41
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 94.39
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 94.37
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 94.35
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 94.34
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 94.34
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 94.33
3rih_A293 Short chain dehydrogenase or reductase; structural 94.32
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 94.31
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 94.31
2d4a_B308 Malate dehydrogenase; archaea, hyperthermophIle, o 94.3
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 94.3
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 94.29
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 94.28
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 94.26
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 94.26
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 94.25
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 94.24
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 94.23
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 94.23
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 94.23
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 94.22
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 94.22
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 94.2
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 94.19
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 94.18
4g65_A 461 TRK system potassium uptake protein TRKA; structur 94.18
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 94.17
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 94.17
1vpd_A299 Tartronate semialdehyde reductase; structural geno 94.17
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 94.16
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 94.16
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 94.15
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 94.14
1xq1_A266 Putative tropinone reducatse; structural genomics, 94.1
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 94.1
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 94.1
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 94.08
3tox_A280 Short chain dehydrogenase; structural genomics, PS 94.08
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 94.07
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 94.06
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 94.06
4g65_A461 TRK system potassium uptake protein TRKA; structur 94.05
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 94.05
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 94.02
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 94.02
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 94.01
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 94.0
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 94.0
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 93.97
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 93.95
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 93.94
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 93.93
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 93.93
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 93.92
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 93.9
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 93.89
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 93.88
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 93.85
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 93.85
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 93.84
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 93.84
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 93.82
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 93.79
1pgj_A 478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 93.78
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 93.77
3ius_A286 Uncharacterized conserved protein; APC63810, silic 93.74
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 93.72
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 93.68
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 93.68
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 93.67
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 93.64
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 93.64
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 93.63
1nff_A260 Putative oxidoreductase RV2002; directed evolution 93.61
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 93.6
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 93.6
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 93.57
4dqx_A277 Probable oxidoreductase protein; structural genomi 93.57
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 93.56
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 93.56
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 93.55
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 93.53
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 93.52
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 93.51
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 93.5
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 93.49
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 93.48
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 93.46
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 93.46
2dvm_A439 Malic enzyme, 439AA long hypothetical malate oxido 93.45
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 93.45
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 93.44
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 93.44
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 93.4
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 93.4
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 93.37
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 93.36
2x0j_A294 Malate dehydrogenase; oxidoreductase, hyperthermop 93.35
3cxt_A291 Dehydrogenase with different specificities; rossma 93.33
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 93.33
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 93.32
4eso_A255 Putative oxidoreductase; NADP, structural genomics 93.32
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 93.31
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 93.3
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 93.29
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 93.26
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 93.25
3e03_A274 Short chain dehydrogenase; structural genomics, PS 93.23
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 93.22
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 93.22
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 93.2
1dih_A273 Dihydrodipicolinate reductase; oxidoreductase; HET 93.19
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 93.19
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 93.18
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 93.17
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 93.16
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 93.1
1xkq_A280 Short-chain reductase family member (5D234); parra 93.09
4ezb_A317 Uncharacterized conserved protein; structural geno 93.09
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 93.07
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 93.07
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 93.06
2wm3_A299 NMRA-like family domain containing protein 1; unkn 93.06
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 93.06
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 93.05
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 93.05
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 93.02
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 93.01
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 92.97
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 92.97
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 92.95
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 92.95
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 92.94
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 92.92
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 92.91
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 92.9
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 92.89
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 92.88
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 92.85
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 92.84
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 92.84
1mld_A314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 92.8
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 92.8
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 92.8
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 92.79
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 92.79
3qha_A296 Putative oxidoreductase; seattle structural genomi 92.77
3edm_A259 Short chain dehydrogenase; structural genomics, ox 92.77
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 92.77
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 92.76
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 92.75
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 92.74
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 92.73
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 92.72
1xq6_A253 Unknown protein; structural genomics, protein stru 92.72
1xhl_A297 Short-chain dehydrogenase/reductase family member 92.72
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 92.71
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 92.71
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 92.7
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 92.64
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 92.64
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 92.63
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 92.62
3q2i_A354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 92.56
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 92.56
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 92.55
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 92.51
1gy8_A397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 92.5
1yb4_A295 Tartronic semialdehyde reductase; structural genom 92.5
4f6c_A427 AUSA reductase domain protein; thioester reductase 92.49
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 92.46
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 92.44
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 92.4
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 92.38
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 92.36
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 92.35
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 92.29
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 92.28
3euw_A344 MYO-inositol dehydrogenase; protein structure init 92.26
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 92.25
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 92.24
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 92.2
3uuw_A308 Putative oxidoreductase with NAD(P)-binding rossm 92.2
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 92.19
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 92.18
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 92.16
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 92.12
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 92.04
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 92.03
3rc1_A350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 91.99
3fef_A 450 Putative glucosidase LPLD; gulosidase, structural 91.91
3mz0_A344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 91.88
1lnq_A336 MTHK channels, potassium channel related protein; 91.87
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 91.87
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 91.79
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 91.74
3u9l_A324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 91.69
2xxj_A310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 91.69
4hkt_A331 Inositol 2-dehydrogenase; structural genomics, nys 91.68
2z5l_A511 Tylkr1, tylactone synthase starter module and modu 91.67
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 91.62
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 91.58
3ec7_A357 Putative dehydrogenase; alpha-beta, structural gen 91.57
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 91.56
3fr7_A 525 Putative ketol-acid reductoisomerase (OS05G057370 91.54
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 91.53
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 91.44
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 91.43
4hb9_A412 Similarities with probable monooxygenase; flavin, 91.38
3kb6_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 91.37
3c7a_A404 Octopine dehydrogenase; L) stereospecific opine de 91.32
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 91.3
4fgw_A391 Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxi 91.27
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 91.25
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 91.25
1smk_A326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 91.25
2fr1_A486 Erythromycin synthase, eryai; short chain dehydrog 91.24
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 91.24
4f3y_A272 DHPR, dihydrodipicolinate reductase; structural ge 91.21
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 91.21
2glx_A332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 91.18
3db2_A354 Putative NADPH-dependent oxidoreductase; two domai 91.16
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 90.97
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 90.94
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 90.9
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 90.8
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 90.8
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 90.79
2y0c_A 478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 90.73
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 90.71
3nv9_A487 Malic enzyme; rossmann fold, oxidoreductase; 2.25A 90.71
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 90.6
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 90.59
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 90.54
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 90.53
3ijp_A288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 90.52
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 90.52
2ywl_A180 Thioredoxin reductase related protein; uncharacter 90.5
3gem_A260 Short chain dehydrogenase; structural genomics, AP 90.46
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 90.45
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 90.44
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 90.44
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 90.39
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 90.37
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 90.33
2c29_D337 Dihydroflavonol 4-reductase; flavonoids, short deh 90.32
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 90.27
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 90.25
2ixa_A 444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 90.14
3ezy_A344 Dehydrogenase; structural genomics, unknown functi 90.13
3e9m_A330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 90.05
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 89.99
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 89.93
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 89.9
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 89.88
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 89.88
4h7p_A345 Malate dehydrogenase; ssgcid, structural G seattle 89.87
2ho3_A325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 89.86
2vt3_A215 REX, redox-sensing transcriptional repressor REX; 89.83
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 89.81
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 89.74
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 89.72
1vkn_A351 N-acetyl-gamma-glutamyl-phosphate reductase; TM178 89.68
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 89.67
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 89.64
1b8p_A329 Protein (malate dehydrogenase); oxidoreductase; 1. 89.57
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 89.5
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 89.47
1obb_A 480 Maltase, alpha-glucosidase; glycosidase, sulfinic 89.24
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 89.21
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 89.12
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 89.1
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 89.09
3cea_A346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 88.97
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 88.89
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 88.88
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 88.87
3qp9_A525 Type I polyketide synthase pikaii; rossmann fold, 88.84
3st7_A369 Capsular polysaccharide synthesis enzyme CAP5F; ro 88.84
2ejw_A332 HDH, homoserine dehydrogenase; NAD-dependent, oxid 88.8
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 88.74
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 88.71
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 88.71
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 88.7
4gx0_A565 TRKA domain protein; membrane protein, ION channel 88.7
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 88.69
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 88.64
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 88.61
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 88.61
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 88.59
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 88.57
1s6y_A450 6-phospho-beta-glucosidase; hydrolase, structural 88.53
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 88.48
2aqj_A 538 Tryptophan halogenase, pRNA; flavin-dependent halo 88.37
4ea9_A220 Perosamine N-acetyltransferase; beta helix, acetyl 88.32
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 88.32
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 88.29
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 88.26
2o7s_A523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 88.25
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 88.23
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 88.2
3hhp_A312 Malate dehydrogenase; MDH, citric acid cycle, TCA 88.18
3o9z_A312 Lipopolysaccaride biosynthesis protein WBPB; oxido 88.14
1ydw_A362 AX110P-like protein; structural genomics, protein 88.14
3e18_A359 Oxidoreductase; dehydrogenase, NAD-binding, struct 88.13
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 88.12
3ohs_X334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 88.11
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 88.05
3mje_A496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 88.04
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 87.99
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 87.98
3r4v_A315 Putative uncharacterized protein; tubulin, unknown 87.91
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 87.9
1db3_A372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 87.89
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 87.85
5mdh_A333 Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH 87.84
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 87.84
3upl_A446 Oxidoreductase; rossmann fold, NADPH binding; 1.50 87.83
2e4g_A 550 Tryptophan halogenase; flavin-binding, rebeccamyci 87.75
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 87.61
3dme_A369 Conserved exported protein; structural genomics, P 87.59
2weu_A 511 Tryptophan 5-halogenase; regioselectivity, antifun 87.57
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 87.53
2cul_A232 Glucose-inhibited division protein A-related PROT 87.51
1udb_A338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 87.41
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 87.38
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 87.32
>4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A Back     alignment and structure
Probab=100.00  E-value=3.9e-146  Score=1242.26  Aligned_cols=602  Identities=41%  Similarity=0.693  Sum_probs=534.6

Q ss_pred             Cceeeec-CccCCChhhHHHHHhCCccccCCCCCCeeEEEEecCCC--CCCCcceEEEecCCCCCCCcccccccccccCC
Q 005071           13 SILQFAP-FQSSVDEGFWHRLSSLKLNKLGIDESPIPITGFYAPCS--HLQVSNHLSLLTESLPSDSDEQSSTAEISRGS   89 (715)
Q Consensus        13 ~~l~f~p-~~s~vd~~Fw~~L~~~KL~~~kLd~~~~~i~g~~~~~~--~~~~~~~l~Ld~~SF~~~~~~~~~~~~~~~~~   89 (715)
                      .+|||+| |+|+||++|||+|+++|||+|||||+|++|+|+|++++  ..+.+++++|+++||+++..          .+
T Consensus         7 ~~l~f~p~f~s~vd~~Fw~~l~~~Kl~~~kLd~~~~~i~g~~~~~~~~~~~~~~~~~~~~~sf~~~~~----------~~   76 (615)
T 4gsl_A            7 RVLSYAPAFKSFLDTSFFQELSRLKLDVLKLDSTCQPLTVNLDLHNIPKSADQVPLFLTNRSFEKHNN----------KR   76 (615)
T ss_dssp             EECCCBCSCEEEECHHHHHHHHHTTCTTSCCSEEEEEEEEEECTTCCCTTCSBCEEEECGGGGSSSCC----------CC
T ss_pred             CcceecCCcccccCchHHHHHHHhhcchhccCCCCeeEEEEEecCccccCCCCceEEEeHHHCCCccc----------CC
Confidence            4899999 99999999999999999999999999999999999986  77888999999999985421          23


Q ss_pred             CceeeeeeeEEeccchHHhhccCHHHHHHHHHHHHHHhhhcCCcccCcccccchheeeeeccCCcEEEEEEEeeccCCCC
Q 005071           90 RNKCTVPGTLYNSNTLESFYTIDKQSLLKQEAKKIWEDIHSGKAVEDSTVLSRFLVISFADLKKWSFHYWFAFPALVLDP  169 (715)
Q Consensus        90 ~~~~~~~G~l~n~NTie~fk~~DK~~lL~~~g~~Iw~~i~~g~~~~~p~~l~~F~~ltfaDLKky~f~YwfafPa~~~~~  169 (715)
                      .+.++++|+|+|+||||+||++||++||+++|++||++.     ++||++|++|+|||||||||||||||||||||++++
T Consensus        77 ~~~~~~~G~l~n~Nt~e~fk~~dk~~ll~~~~~~i~~~~-----~~~~~~l~~F~~lsfaDLKky~f~ywfafP~~~~~~  151 (615)
T 4gsl_A           77 TNEVPLQGSIFNFNVLDEFKNLDKQLFLHQRALECWEDG-----IKDINKCVSFVIISFADLKKYRFYYWLGVPCFQRPS  151 (615)
T ss_dssp             TTCEEEEEEEEEESSHHHHHTSCHHHHHHHHHHHHHHHH-----TTCGGGCCCEEEEEEEETTTTEEEEEEEEEEEESST
T ss_pred             CCceEEEEEEEEeccHHHHhhcCHHHHHHHHHHHHHHcc-----ccCHHHHhhHHHHHHHhhhcceEEEEEEEcccCCCc
Confidence            567899999999999999999999999999999999963     789999999999999999999999999999999999


Q ss_pred             CeeeeccCcccccCChHHHHHHHHHHhhhhhcCCCCCccEEEEEeecCCcceeccccchhhhcCCCcceEEEEecCCCCC
Q 005071          170 PATVVDLKPASLWFSSQEAESVSAACSDWRNSSLTADVPYFLLTIAPNSRATIRHLKDWEACEGDGQKLLFGFYDPCHLQ  249 (715)
Q Consensus       170 ~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~F~l~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~f~Dps~~~  249 (715)
                      +|++.....       .++..+.+.+++|+..   ...+||++...      ..+|++|+.....++.++ +|+|||+++
T Consensus       152 ~~~~~~~~~-------~~~~~~~~~~~~~~~~---~~~~~f~~~~~------~~~l~~~~~~~~~~~~~~-~f~Dps~~~  214 (615)
T 4gsl_A          152 STVLHVRPE-------PSLKGLFSKCQKWFDV---NYSKWVCILDA------DDEIVNYDKCIIRKTKVL-AIRDTSTME  214 (615)
T ss_dssp             TEEEEEEEC-------TTCCTHHHHHHHHHHH---CTTCSEEEECT------TSCEEECCHHHHHHHCEE-EEECCBCST
T ss_pred             cceeccCCc-------hhhhHHHHHHHHHHhc---cCCcEEEEEec------ccchhhhhhccCCCceEE-EEECCCCCC
Confidence            998754211       1222334566788754   35679988763      245677765444456788 999999999


Q ss_pred             CCCChhHHHHHHHHH-hhcCceeEEEEEEEcCCCcccCCCceEEEEEeecCCCCC-CCCCCcccccEEec-CCcccceEe
Q 005071          250 NHPGWPLRNFLALIL-TRWKLKSVLFLCYRENRGFTDLGLSLVGEALITVPQGWG-DHQCVPNTVGWELN-KGRKVPRCI  326 (715)
Q Consensus       250 ~~pgw~lRN~l~~~~-~~~~~~~~~v~~~R~~~~~~~~~~S~~~~~~~~~~~~~~-~~~~~~~~~gwe~~-~gkl~pr~~  326 (715)
                      ++|||||||||++++ +||++++++|+|||+..+      |++++++++...+.. .....|+++|||+| +||++||++
T Consensus       215 ~~pgw~lrN~l~~~~~~~~~~~~~~v~~~R~~~~------s~~~~~~~~~~~~~~~~~~~~~~~~GWE~n~~gkl~~~~~  288 (615)
T 4gsl_A          215 NVPSALTKNFLSVLQYDVPDLIDFKLLIIRQNEG------SFALNATFASIDPQSSSSNPDMKVSGWERNVQGKLAPRVV  288 (615)
T ss_dssp             TCCBTHHHHHHHHHHHHCTTCCEEEEEEECSSSC------CEEEEEEEEESSCCCC--CCCCEEEEECCCTTSCSCCEEE
T ss_pred             CCCCHHHHHHHHHHHHhccCCceEEEEEEEcCCC------cEEEEEEcccccccccccccCccccccccCCCCCcceeEE
Confidence            999999999999998 899999999999998764      999999998643221 22357899999999 999999999


Q ss_pred             cccCCCChhhhhhhhhhhhhhhhhhhcCCchhHHhhccCeEEEEcCChHHHHHHHHHHHhcCCeEEEEeCCcccccCCCc
Q 005071          327 SLAKSMDPTRLAISAADLNLKLMRWRQLPSLNLDILSSRKCLLLGAGTLGCQVARMLMAWGVRKITLLDNGRVAMSNPLR  406 (715)
Q Consensus       327 dl~~~~dp~~la~~a~dlnlry~R~rllp~~gq~kL~~~kVlIvGaGgLGs~VA~~La~~GVg~ItLVD~D~Ve~sNl~R  406 (715)
                      ||+..|||.+++++++++|+++||||++|++|+++|+++||+||||||+||+||++|+++|||+|+|||+|+|+.|||+|
T Consensus       289 ~l~~~~dp~~la~~~~~Lnlklm~wRllp~~g~ekL~~arVLIVGaGGLGs~vA~~La~aGVG~ItLvD~D~Ve~SNL~R  368 (615)
T 4gsl_A          289 DLSSLLDPLKIADQSVDLNLKLMKWRILPDLNLDIIKNTKVLLLGAGTLGCYVSRALIAWGVRKITFVDNGTVSYSNPVR  368 (615)
T ss_dssp             ECHHHHCHHHHHHHHHHHHHHHHHHHTCTTCCHHHHHTCEEEEECCSHHHHHHHHHHHHTTCCEEEEECCCBCCTTGGGT
T ss_pred             eccccCCHHHHHhhhhhhhhHHHHHhhcchhhHHHHhCCeEEEECCCHHHHHHHHHHHHcCCCEEEEEcCCCCcccCccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCcchhcCCCCcHHHHHHHHHHhhCCCcEEEEEecccCCCCCCCCCccccccccchhhHHHhhccCCEEEEeCCChH
Q 005071          407 QSLYTLDDCLNGGDFKAMAAVKSLERIFPAVAAEGVVMAIPMPGHPVPCQEEDSVLDDCRRLTDLILSHDVIFLLTDTRE  486 (715)
Q Consensus       407 Q~L~~~~Di~~~G~~KAeaaa~~L~~inP~v~v~~~~~~Ipmpgh~~~~~~~~~~~~~~~~l~~li~~~DvV~~~tDs~e  486 (715)
                      |+||+.+|+   |++||++|+++|+++||+++++++..+|||||||++++  ++.+.+.+++.++++++|+||+|+|+++
T Consensus       369 Q~L~~~~dI---G~~KAeaaa~~L~~iNP~V~v~~~~~~Ipm~gh~v~~e--~~~~l~~~~l~~ll~~~DlVvd~tDn~~  443 (615)
T 4gsl_A          369 QALYNFEDC---GKPKAELAAASLKRIFPLMDATGVKLSIPMIGHKLVNE--EAQHKDFDRLRALIKEHDIIFLLVDSRE  443 (615)
T ss_dssp             STTCCGGGT---TSBHHHHHHHHHHHHCTTCEEEEECCCCCCTTCCCSCH--HHHHHHHHHHHHHHHHCSEEEECCSSGG
T ss_pred             ccCCChhhc---ChHHHHHHHHHHHhhCCCcEEEEeeccccccCccccch--hhhcCCHHHHHHHhhcCCEEEecCCCHH
Confidence            999999999   99999999999999999999999999999999999752  3455677888999999999999999999


Q ss_pred             HHHHHHHHHHhcCCeEEEeeeCCceEEEEEcCCCCCcccccccchhccCccccccccCCCCCCCCCCcCceeecccCCCC
Q 005071          487 SRWLPTLLCANTNKITITAALGFDSFLVMRHGPGPFSITHDVKTEAVNGLSADMDNLGLNNRDGGQRLGCYFCNDVVAPT  566 (715)
Q Consensus       487 sR~li~~~~~~~~kp~I~aalG~~g~vv~~~g~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gCy~C~d~~aP~  566 (715)
                      +|++++++|+++++|+|++++|++||++++||....                          ..+.++|||+|+++++|.
T Consensus       444 tR~~ln~~c~~~~~PlI~aalG~~Gql~v~~g~~~~--------------------------~~~~~~~CY~Cl~~~~P~  497 (615)
T 4gsl_A          444 SRWLPSLLSNIENKTVINAALGFDSYLVMRHGNRDE--------------------------QSSKQLGCYFCHDVVAPT  497 (615)
T ss_dssp             GTHHHHHHHHHTTCEEEEEEECSSEEEEEECCC--------------------------------CCCCCTTTSCSSCTT
T ss_pred             HHHHHHHHHHHcCCeEEEEEccceeEEEEeeccccc--------------------------CCCCCCCceeeCCCCCCc
Confidence            999999999999999999999999999999974210                          112478999999999999


Q ss_pred             CCCccccccccccccCcchHHHHHHHHHHHHHHHhcCCCCCCCCccccCCCCCCCCCCCCCceeEEEecCCCCeeeEEec
Q 005071          567 DSTANRTLDQQCTVTRPGLAPIASALAVELFVGVLHHPKGIYAGAEFANSIDSGSSEQPLGILPHQIRGSLSQFSQMTLV  646 (715)
Q Consensus       567 ~s~~drtLdq~CtV~~Pgv~~ias~~A~Ell~~ll~hp~g~~a~~~~~~~~~~~~~~~~Lg~~p~~irg~~~~f~~~~l~  646 (715)
                      ++..+||+|++|+|++|++|+||++||+|+|+.|++||.+...             ++++|..||+|||+.++|+++++.
T Consensus       498 ~~~~~rtl~~~C~Vl~P~vgiigs~qA~EaLk~Ll~~g~~~~~-------------~~~~G~l~~~~dg~~~~f~~~~l~  564 (615)
T 4gsl_A          498 DSLTDRTLDQMCTVTRPGVAMMASSLAVELMTSLLQTKYSGSE-------------TTVLGDIPHQIRGFLHNFSILKLE  564 (615)
T ss_dssp             SCTTTTTTTCTTCCCCHHHHHHHHHHHHHHHHHHHSCCCTTSS-------------EETTEECCSEEEEETTTTEEEEEC
T ss_pred             ccccccccccCcceecchHHHHHHHHHHHHHHHHhCCCCcccC-------------cCcCCCCcEEEeccCCcceEEecc
Confidence            9988999999999999999999999999999999998865321             246787899999999999999999


Q ss_pred             CCCCCCCCCCChhHHHHHHHhCHHHHHHHhcCCchhhhccChhHHHHhhc
Q 005071          647 GHSSNSCTACCSTVVSEYRKRGMEFILQAINHPTYLEDLTGLTELKKSAN  696 (715)
Q Consensus       647 ~~~~~~C~aCs~~v~~~y~~~g~~f~~~~~~~~~~le~~~Gl~~~~~~~~  696 (715)
                      ++++++|++||..++++|+++||+||++|||+|+|||++|||+++|+++|
T Consensus       565 ~~~~p~C~~C~~~v~~~~~~~~~~f~~~~~~~~~~le~~~gl~~~~~~~~  614 (615)
T 4gsl_A          565 TPAYEHCPACSPKVIEAFTDLGWEFVKKALEHPLYLEEISGLSVIKQEVE  614 (615)
T ss_dssp             CCCCTTCTTTCHHHHHHHHHHHHHHHHHHHHCHHHHHHHHSGGGTC----
T ss_pred             CCCCCCCCCCCHHHHHHHHhcCHHHHHHHhcCccHhHHhcCHHHHHHHhc
Confidence            98999999999999999999999999999999999999999999998876
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>3vx8_D Ubiquitin-like modifier-activating enzyme ATG7; E1-E2 complex, ligase; 3.11A {Arabidopsis thaliana} Back     alignment and structure
>3vx6_A E1; 2.60A {Kluyveromyces marxianus} PDB: 3vx7_A Back     alignment and structure
>3t7h_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, ligase; 1.60A {Saccharomyces cerevisiae} PDB: 3t7f_A 3t7g_A 3ruj_A 4gsj_A* Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Back     alignment and structure
>2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 Back     alignment and structure
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Back     alignment and structure
>1y8q_B Anthracycline-, ubiquitin-like 2 activating enzyme E1B; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_B* 3kyc_B* 3kyd_B* 2px9_A Back     alignment and structure
>1tt5_A APPBP1, amyloid protein-binding protein 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbh_A 3dbl_A 3dbr_A 1r4m_A 1r4n_A* 2nvu_A* 1yov_A 3gzn_A* Back     alignment and structure
>3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3cmm_A Ubiquitin-activating enzyme E1 1; UBA1, protein turnover, ligase, conformationa thioester, adenylation, transthioesterification, ATP-bindin nucleotide-binding; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>3fef_A Putative glucosidase LPLD; gulosidase, structural genomics, unknown function, glycosidase, hydrolase, manganese, metal-binding, NAD, PSI- 2; 2.20A {Bacillus subtilis} Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>4fgw_A Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxidoreductase; 2.45A {Saccharomyces cerevisiae} Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3nv9_A Malic enzyme; rossmann fold, oxidoreductase; 2.25A {Entamoeba histolytica} Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>4h7p_A Malate dehydrogenase; ssgcid, structural G seattle structural genomics center for infectious disease, oxidoreductase; 1.30A {Leishmania major} Back     alignment and structure
>2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, redox poise; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A* Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>1vkn_A N-acetyl-gamma-glutamyl-phosphate reductase; TM1782, structu genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; 1.80A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>1obb_A Maltase, alpha-glucosidase; glycosidase, sulfinic acid, NAD+, maltose, hydrolase; HET: MAL NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>2ejw_A HDH, homoserine dehydrogenase; NAD-dependent, oxidoreductase; 1.70A {Thermus thermophilus} Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>1s6y_A 6-phospho-beta-glucosidase; hydrolase, structural genomics, PSI, protein structure initi midwest center for structural genomics; 2.31A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.2 Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>4ea9_A Perosamine N-acetyltransferase; beta helix, acetyl coenzyme A, GDP-perosa transferase; HET: JBT; 0.90A {Caulobacter vibrioides} PDB: 4ea8_A* 4ea7_A* 4eaa_A* 4eab_A* Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3r4v_A Putative uncharacterized protein; tubulin, unknown function; HET: GDP; 1.67A {Pseudomonas phage 201phi2-1} PDB: 3rb8_A* Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 715
d1yova1 529 c.111.1.2 (A:6-534) Amyloid beta precursor protein 9e-16
d1yovb1426 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [T 1e-12
d1jw9b_247 c.111.1.1 (B:) Molybdenum cofactor biosynthesis pr 6e-08
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Activating enzymes of the ubiquitin-like proteins
superfamily: Activating enzymes of the ubiquitin-like proteins
family: Ubiquitin activating enzymes (UBA)
domain: Amyloid beta precursor protein-binding protein 1, APPBP1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 78.5 bits (193), Expect = 9e-16
 Identities = 24/167 (14%), Positives = 55/167 (32%), Gaps = 19/167 (11%)

Query: 362 LSSRKCLLLGAGTLGCQVARMLMAWGVRKITLLDNGRVAMSNPLRQSLYTLDDCLNGGDF 421
           L S    L+ A   G ++ + L+  G+   T++D  +V+  +               G  
Sbjct: 23  LESAHVCLINATATGTEILKNLVLPGIGSFTIIDGNQVSGEDAGNNFFLQRSSI---GKN 79

Query: 422 KAMAAVKSLERIFPAVAAEGVVMAIPMPGHPVPCQEEDSVLDDCRRLTDLILSHDVIFLL 481
           +A AA++ L+ +   V+   V  +             +++LD+            V+   
Sbjct: 80  RAEAAMEFLQELNSDVSGSFVEESP------------ENLLDN---DPSFFCRFTVVVAT 124

Query: 482 TDTRESRWLPTLLCANTNKITITAA-LGFDSFLVMRHGPGPFSITHD 527
                +      +  N+    +     G   ++ +     P   +H 
Sbjct: 125 QLPESTSLRLADVLWNSQIPLLICRTYGLVGYMRIIIKEHPVIESHP 171
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Length = 426 Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Length = 247 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query715
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 100.0
d1yovb1426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1yova1 529 Amyloid beta precursor protein-binding protein 1, 99.94
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 97.76
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 97.71
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 97.38
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 97.36
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 97.24
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 97.12
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 97.09
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 96.99
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 96.91
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 96.89
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 96.81
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 96.8
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 96.73
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 96.57
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 96.41
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 96.28
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 96.27
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 96.26
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 96.23
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 96.2
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 96.05
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 96.03
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 95.94
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 95.82
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 95.81
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 95.77
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 95.75
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 95.71
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 95.63
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 95.61
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 95.61
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 95.6
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 95.57
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 95.54
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 95.53
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 95.52
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 95.42
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 95.41
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 95.4
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 95.32
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 95.3
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 95.2
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 95.19
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 95.14
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 95.14
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 95.05
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 95.03
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 95.02
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 95.01
d2vapa1209 Cell-division protein FtsZ {Archaeon Methanococcus 95.0
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 94.98
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 94.94
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 94.9
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 94.87
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 94.77
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 94.75
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 94.66
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 94.65
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 94.63
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 94.63
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 94.62
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 94.57
d1ofua1198 Cell-division protein FtsZ {Pseudomonas aeruginosa 94.55
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 94.52
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 94.49
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 94.44
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 94.42
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 94.4
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 94.37
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 94.33
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 94.27
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 94.23
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 94.16
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 94.1
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 94.1
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 94.06
d1w5fa1194 Cell-division protein FtsZ {Thermotoga maritima [T 94.03
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 93.96
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 93.91
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 93.91
d1vl6a1222 Malate oxidoreductase (malic enzyme) {Thermotoga m 93.91
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 93.89
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 93.87
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 93.84
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 93.82
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 93.72
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 93.68
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 93.64
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 93.64
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 93.63
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 93.56
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 93.52
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 93.47
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 93.45
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 93.39
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 93.36
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 93.35
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 93.34
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 93.32
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 93.32
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 93.25
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 93.25
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 93.13
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 93.12
d1id1a_153 Rck domain from putative potassium channel Kch {Es 93.08
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 93.05
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 92.96
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 92.95
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 92.94
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 92.91
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 92.83
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 92.79
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 92.75
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 92.73
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 92.7
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 92.7
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 92.67
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 92.58
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 92.56
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 92.49
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 92.41
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 92.29
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 92.28
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 92.22
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 92.2
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 92.15
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 92.06
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 92.04
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 92.03
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 92.02
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 91.94
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 91.91
d1rq2a1198 Cell-division protein FtsZ {Mycobacterium tubercul 91.89
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 91.89
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 91.88
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 91.88
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 91.87
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 91.84
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 91.79
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 91.74
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 91.68
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 91.6
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 91.59
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 91.53
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 91.46
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 91.45
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 91.42
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 91.41
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 91.29
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 91.28
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 91.25
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 91.21
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 91.04
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 91.0
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 90.96
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 90.93
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 90.92
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 90.85
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 90.83
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 90.83
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 90.76
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 90.66
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90.65
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 90.51
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 90.45
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 90.43
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 90.35
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 90.21
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 90.16
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 90.16
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 90.14
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 90.02
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 89.99
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 89.88
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 89.88
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 89.88
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 89.82
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 89.69
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 89.69
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 89.66
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 89.53
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 89.13
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 88.78
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 88.71
d1gq2a1298 Mitochondrial NAD(P)-dependent malic enzyme {Domes 88.71
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 88.7
d1pj3a1294 Mitochondrial NAD(P)-dependent malic enzyme {Human 88.53
d1o0sa1308 Mitochondrial NAD(P)-dependent malic enzyme {Pig r 88.51
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 88.43
d1vjta1193 Putative alpha-glucosidase TM0752 {Thermotoga mari 88.41
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 88.39
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 88.36
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 88.36
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 88.17
d1x7da_340 Ornithine cyclodeaminase {Pseudomonas putida [TaxI 88.07
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 87.89
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 87.72
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 87.57
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 87.49
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 87.36
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 87.23
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 87.2
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 87.19
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 87.19
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 87.17
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 87.08
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 86.54
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 86.12
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 85.87
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 85.85
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 85.82
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 85.71
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 85.58
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 85.52
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 85.33
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 85.22
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 85.02
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 84.99
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 84.58
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 84.53
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 84.49
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 84.29
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 84.25
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 84.18
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 84.18
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 84.03
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 83.94
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 83.83
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 83.77
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 83.37
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 82.68
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 82.56
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 82.34
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 82.18
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 82.1
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 82.08
d1hwxa1293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 81.95
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 81.88
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 81.77
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 81.58
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 81.4
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 81.16
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 81.03
d2fyta1311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 80.77
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 80.68
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 80.68
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 80.59
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 80.36
d1z45a2347 Uridine diphosphogalactose-4-epimerase (UDP-galact 80.29
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 80.19
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 80.11
d1ebfa1168 Homoserine dehydrogenase {Baker's yeast (Saccharom 80.11
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 80.06
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Activating enzymes of the ubiquitin-like proteins
superfamily: Activating enzymes of the ubiquitin-like proteins
family: Molybdenum cofactor biosynthesis protein MoeB
domain: Molybdenum cofactor biosynthesis protein MoeB
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=3.8e-45  Score=372.77  Aligned_cols=236  Identities=25%  Similarity=0.327  Sum_probs=207.0

Q ss_pred             hhhhhhhhcCCchh---HHhhccCeEEEEcCChHHHHHHHHHHHhcCCeEEEEeCCcccccCCCcCCCCCcchhcCCCCc
Q 005071          345 NLKLMRWRQLPSLN---LDILSSRKCLLLGAGTLGCQVARMLMAWGVRKITLLDNGRVAMSNPLRQSLYTLDDCLNGGDF  421 (715)
Q Consensus       345 nlry~R~rllp~~g---q~kL~~~kVlIvGaGgLGs~VA~~La~~GVg~ItLVD~D~Ve~sNl~RQ~L~~~~Di~~~G~~  421 (715)
                      -+||+||+.++++|   |+||+++||+|+||||+||++|++|+++|||+|+|||+|.|+.|||+||+||+.+|+   |++
T Consensus         8 ~~ry~Rqi~l~~~g~~~Q~kL~~~~VliiG~GglGs~va~~La~~Gvg~i~lvD~D~Ve~sNL~RQ~l~~~~di---G~~   84 (247)
T d1jw9b_           8 MLRYNRQIILRGFDFDGQEALKDSRVLIVGLGGLGCAASQYLASAGVGNLTLLDFDTVSLSNLQRQTLHSDATV---GQP   84 (247)
T ss_dssp             HHHTHHHHTSTTTHHHHHHHHHHCEEEEECCSHHHHHHHHHHHHHTCSEEEEECCCBCCGGGGGTCTTCCGGGT---TSB
T ss_pred             HHHhhceeccccCCHHHHHHHhCCCEEEECCCHHHHHHHHHHHHcCCCeEEEECCcccchhhhhhhccccHhhc---Cch
Confidence            37999999998776   899999999999999999999999999999999999999999999999999999999   999


Q ss_pred             HHHHHHHHHHhhCCCcEEEEEecccCCCCCCCCCccccccccchhhHHHhhccCCEEEEeCCChHHHHHHHHHHHhcCCe
Q 005071          422 KAMAAVKSLERIFPAVAAEGVVMAIPMPGHPVPCQEEDSVLDDCRRLTDLILSHDVIFLLTDTRESRWLPTLLCANTNKI  501 (715)
Q Consensus       422 KAeaaa~~L~~inP~v~v~~~~~~Ipmpgh~~~~~~~~~~~~~~~~l~~li~~~DvV~~~tDs~esR~li~~~~~~~~kp  501 (715)
                      ||++|+++|+++||+++++.+...+                 +.++...++..+|+||+|+|+.++|++++++|+++++|
T Consensus        85 K~~~a~~~l~~~np~~~i~~~~~~~-----------------~~~~~~~~~~~~divid~~d~~~~~~~in~~~~~~~ip  147 (247)
T d1jw9b_          85 KVESARDALTRINPHIAITPVNALL-----------------DDAELAALIAEHDLVLDCTDNVAVRNQLNAGCFAAKVP  147 (247)
T ss_dssp             HHHHHHHHHHHHCTTSEEEEECSCC-----------------CHHHHHHHHHTSSEEEECCSSHHHHHHHHHHHHHHTCC
T ss_pred             HHHHHHHHHHHhhcccchhhhhhhh-----------------hhccccccccccceeeeccchhhhhhhHHHHHHHhCCC
Confidence            9999999999999999999998543                 66778888999999999999999999999999999999


Q ss_pred             EEEe-eeCCceEEEEEcCCCCCcccccccchhccCccccccccCCCCCCCCCCcCceeecccCCCCCCCccccccccccc
Q 005071          502 TITA-ALGFDSFLVMRHGPGPFSITHDVKTEAVNGLSADMDNLGLNNRDGGQRLGCYFCNDVVAPTDSTANRTLDQQCTV  580 (715)
Q Consensus       502 ~I~a-alG~~g~vv~~~g~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gCy~C~d~~aP~~s~~drtLdq~CtV  580 (715)
                      +|.+ ..|+.|++..+..                                +...+||.|.....|......    ..-.+
T Consensus       148 ~i~g~~~~~~g~~~~~~~--------------------------------~~~~~c~~c~~~~~~~~~~~~----~~~g~  191 (247)
T d1jw9b_         148 LVSGAAIRMEGQITVFTY--------------------------------QDGEPCYRCLSRLFGENALTC----VEAGV  191 (247)
T ss_dssp             EEEEEEEBTEEEEEEECC--------------------------------CTTCCCTHHHHTTCCC-----------CCB
T ss_pred             cccccccccccceEEEee--------------------------------cCCcccccccccccccccCCc----ccCCc
Confidence            9987 6899999876631                                135789999976665443221    12248


Q ss_pred             cCcchHHHHHHHHHHHHHHHhcCCCCCCCCccccCCCCCCCCCCCCCceeEEEecCCCCeeeEEecCCCCCCCCCCC
Q 005071          581 TRPGLAPIASALAVELFVGVLHHPKGIYAGAEFANSIDSGSSEQPLGILPHQIRGSLSQFSQMTLVGHSSNSCTACC  657 (715)
Q Consensus       581 ~~Pgv~~ias~~A~Ell~~ll~hp~g~~a~~~~~~~~~~~~~~~~Lg~~p~~irg~~~~f~~~~l~~~~~~~C~aCs  657 (715)
                      ++|.++++|+++|.|+++.|+    |.+.               ++.++.+.||+..++|+.+++.  ++++|++||
T Consensus       192 ~~p~~~~v~~~~a~e~ik~l~----g~~~---------------~~~~~~~~~d~~~~~~~~~~~~--~~~~C~vCG  247 (247)
T d1jw9b_         192 MAPLIGVIGSLQAMEAIKMLA----GYGK---------------PASGKIVMYDAMTCQFREMKLM--RNPGCEVCG  247 (247)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHH----TCSC---------------CCBSEEEEEETTTTEEEEEECC--CCTTCTTTC
T ss_pred             ccccchhHHHHHHHHHHHHHh----cCCC---------------cCcCcEEEEECCCCEEEEEecC--cCcCCCCCC
Confidence            899999999999999999999    5543               4567889999999999999987  899999997
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vapa1 c.32.1.1 (A:23-231) Cell-division protein FtsZ {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1ofua1 c.32.1.1 (A:11-208) Cell-division protein FtsZ {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1w5fa1 c.32.1.1 (A:22-215) Cell-division protein FtsZ {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1rq2a1 c.32.1.1 (A:8-205) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1gq2a1 c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1pj3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0sa1 c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1ebfa1 c.2.1.3 (A:2-150,A:341-359) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure