Citrus Sinensis ID: 005085

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-----
MGGIGKTTIGVVFNQFSQKFEGKYFMANVREESEKCGVLVHLRNQVLSKVLGENFDIGTQKIPQYIRDRLQRMKVFIVLDDVNKDKTILERYGTQRIYEVEGLNCNEVLRLFSSCAFKENHCPEDLLKHSETAVHYAKGNPLALQVLGSSFYGKSKPDWVNALNNLKRISGSDIYDDREHVMWILSDDYCSVQYAMNVLVNKSLIKISYNKLQMHDLLQEMGREIVCQEFREKPEKRSRLWDYKDVCHVLEKNKGTDAIKSIFLDLSKIEEINLDPRAFTNMSNVRLLKFYISGHFDVSKMSSKVHLQQESYRTQLSFKKVEQIWEGQKKAPKLKYVDLNHSTNLTRIPEPSETPNLERMNLRNCTGLAHIPSYVQNFNKLGNMIMAGCESLRCFPQNIHFISSIKIDCYKCVNLKEFPRISGNVVELNLMCTPIEEVPLSIECLPNLEILEMSFCYSLKRLSTSICKLKYLSSLDLSYCINLESFPEILEKMELLEEINLEEASNIKELPSSIENLEGLKQLKLTGCTKLGSLPETKNWMHPYCKHYPITRVKDYSSTSPVQLIFANCLKLNESIWADLQQRIRHMIIASRRLFCEKNIGLSDGAAVSFDFFIRYQLVIVKGPQKVKCCGVSPVYANPNTFTLEFGDRSEDFDYMDNAQRQIVGGSHEYELESIRREQFNGPQRQTSRFSQFLKNVCCFDYEPWTKTFFQDQGI
ccccHHHHHHHHHHHHHccccEEEEccccHHHHHHcccHHHHHHHHHHHHHcccccccccccHHHHHHHHcccEEEEEEEccccHHHHHHHHccccEEEcccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccEEHHHHccccccccHHHHHHHHHHHHcccccccHHcHHHHHHHHHHcccccccccccccccccEEEEccEEEccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHccccccEEEEEcccccccEEEEccHHHccccccccEEEcccccccccccccccccccccEEEEccccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccEEEccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccccEEEEccccccccccccccccccccEEEcccccccEEccccccccccccEEEccccccccccccccccHHHHHcccccccccccccccccEEEEcccccccHHHHHHHHHHHHHHHHcccccccccccccccccEEcccccccEEEEEEEcccccEEEEccEEEcccccccccccccccccccccccccHHcccccHHHHHHHHHHHcccccccHHHHHHHHcccEEEccccccccccccccc
cccccHHHHHHHHHHHHHHcccHHHHHHHHHccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccccHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccHHHHHHHHHHccEEEEccccEEHHHHHHHHHHHHHHHcccccccccEEEccHHHHHHHHHccccccEEEEEEEEcccccEEcccHHHHHHHHHcEEEEEEccccccccccccHHccHHHHcEccccccHHHHccccccccccccEEEcccccccccccccccccccHEEEccccccHccccccHHHHHHHHEEccccccccccccccccHHHHHEEccccccHHccccHHHHcHHEEEccccccEccccHHHHHccccEEEcccccccccccccHcccccccEEEcccccHHHcccHHHcccHcccEEEcccccccccccccHHHHHHccEEccccccHHccccccccHHHHHHHccccccccccccccccEEEcccHHHccHHHHHHHHHHcccEEcccccEEEEcccccEEEEEccccccccEEEEEEEEccccccccEEEEEEEEccEEEEEccccccccHHHHccHEEEcccccEccHHHHHHcccccccHHHHHHHHHHccccEEEccccHHHHHcccc
MGGIGKTTIGVVFNQFSQKFEGKYFMANVREESEKCGVLVHLRNQVLSKVLgenfdigtqkIPQYIRDRLQRMKVFIVLDDVNKDKTILERYGTQRIYEVEGLNCNEVLRLFSScafkenhcpedllkhSETAVHYAKGNPLALQVLgssfygkskpDWVNALNNlkrisgsdiyddrehVMWILSDDYCSVQYAMNVLVNKSLIKISYNKLQMHDLLQEMGREIVCQEfrekpekrsrlwdyKDVCHVleknkgtdAIKSIFLDLskieeinldpraftnmsNVRLLKFYISGhfdvskmsskvhlQQESYRTQLSFKKVEQIWEgqkkapklkyvdlnhstnltripepsetpnlermnlrnctglahipSYVQNFNKLGNMIMAgceslrcfpqnihFISSIKidcykcvnlkefprisgnvvelnlmctpieevplsieclpnleileMSFCYSLKRLSTSIcklkylssldlsycinlESFPEILEKMELLEEINLEEasnikelpssieNLEGlkqlkltgctklgslpetknwmhpyckhypitrvkdysstspVQLIFANCLKLNESIWADLQQRIRHMIIASRRLFCekniglsdgaavsfDFFIRYQLVIvkgpqkvkccgvspvyanpntftlefgdrsedfdymdnaqrqivggsheyELESIRreqfngpqrqtsrFSQFLKnvccfdyepwtktffqdqgi
mggigkttigvvfnqfsqKFEGKYFMANVREESEKCGVLVHLRNQVLSKvlgenfdigtqKIPQYIRDRLQRMKVFivlddvnkdktilerygtqriyeveGLNCNEVLRLFSSCAFKENHCPEDLLKHSETAVHYAKGNPLALQVLGSSFYGKSKPDWVNALNNLKRISGSDIYDDREHVMWILSDDYCSVQYAMNVLVNKSLIKISYNKLQMHDLLQEMGREIVCQEfrekpekrsrlwdyKDVCHvleknkgtdaiKSIFLDLSKIEEINLDPRAFTNMSNVRLLKFYISGHFDVSKMSSKVHLQQESYRTQLSFKKVEQIWEgqkkapklkyvdlnhstnltripepsetpnlerMNLRNCTGLAHIPSYVQNFNKLGNMIMAGCESLRCFPQNIHFISSIKIDCYKCVNLKEFPRISGNVVELNLMCTPIEEVPLSIECLPNLEILEMSFCYSLKRLSTSICKLKYLSSLDLSYCINLESFPEILEKMELLEEINLEEASNIKELPSSIENLEGLKQLKLTGCTKLGslpetknwmhpYCKHYPITRVKDYSSTSPVQLIFANCLKLNESIWADLQQRIRHMIIASRRLFCEKNIGLSDGAAVSFDFFIRYQLVIVKGPQKVKCCGVSPVYANPNTFTLEFGDRSEDFDYMDNAQRQIVGGSHEYELESIRREQFNGPQRQTSRFSQFLKNVCCFDYEPWTKTFFQDQGI
MGGIGKTTIGVVFNQFSQKFEGKYFMANVREESEKCGVLVHLRNQVLSKVLGENFDIGTQKIPQYIRDRLQRMKVFIVLDDVNKDKTILERYGTQRIYEVEGLNCNEVLRLFSSCAFKENHCPEDLLKHSETAVHYAKGNPLALQVLGSSFYGKSKPDWVNALNNLKRISGSDIYDDREHVMWILSDDYCSVQYAMNVLVNKSLIKISYNKLQMHDLLQEMGREIVCQEFREKPEKRSRLWDYKDVCHVLEKNKGTDAIKSIFLDLSKIEEINLDPRAFTNMSNVRLLKFYISGHFDVSKMSSKVHLQQESYRTQLSFKKVEQIWEGQKKAPKLKYVDLNHSTNLTRIPEPSETPNLERMNLRNCTGLAHIPSYVQNFNKLGNMIMAGCESLRCFPQNIHFISSIKIDCYKCVNLKEFPRISGNVVELNLMCTPIEEVPLSIECLPNLEILEMSFCYSLKRLSTSICklkylssldlsyCINLESFPeilekmelleeinleeASNIKELPSSIENLEGLKQLKLTGCTKLGSLPETKNWMHPYCKHYPITRVKDYSSTSPVQLIFANCLKLNESIWADLQQRIRHMIIASRRLFCEKNIGLSDGAAVSFDFFIRYQLVIVKGPQKVKCCGVSPVYANPNTFTLEFGDRSEDFDYMDNAQRQIVGGSHEYELESIRREQFNGPQRQTSRFSQFLKNVCCFDYEPWTKTFFQDQGI
*****KTTIGVVFNQFSQKFEGKYFMANVREESEKCGVLVHLRNQVLSKVLGENFDIGTQKIPQYIRDRLQRMKVFIVLDDVNKDKTILERYGTQRIYEVEGLNCNEVLRLFSSCAFKENHCPEDLLKHSETAVHYAKGNPLALQVLGSSFYGKSKPDWVNALNNLKRISGSDIYDDREHVMWILSDDYCSVQYAMNVLVNKSLIKISYNKLQMHDLLQEMGREIVCQEFREKPEKRSRLWDYKDVCHVLEKNKGTDAIKSIFLDLSKIEEINLDPRAFTNMSNVRLLKFYISGHFDVSKMSSKVHLQQESYRTQLSFKKVEQIWEGQKKAPKLKYVDLN*******************MNLRNCTGLAHIPSYVQNFNKLGNMIMAGCESLRCFPQNIHFISSIKIDCYKCVNLKEFPRISGNVVELNLMCTPIEEVPLSIECLPNLEILEMSFCYSLKRLSTSICKLKYLSSLDLSYCINLESFPEILEKMELLEEINLEE**********IENLEGLKQLKLTGCTKLGSLPETKNWMHPYCKHYPITRVKDYSSTSPVQLIFANCLKLNESIWADLQQRIRHMIIASRRLFCEKNIGLSDGAAVSFDFFIRYQLVIVKGPQKVKCCGVSPVYANPNTFTLEFGDRSEDFDYMDNAQRQIVG************************FSQFLKNVCCFDYEPWTKTFF*****
MGGIGKTTIGVVFNQFSQKFEGKYFMANVREESEKCGVLVHLRNQVLSKVLGENFDIGTQKIPQYIRDRLQRMKVFIVLDDVNKDKTILERYGTQRIYEVEGLNCNEVLRLFSSCAFKENHCPEDLLKHSETAVHYAKGNPLALQVLGSSFYGKSKPDWVNALNNLKRISGSDIYDDREHVMWILSDDYCSVQYAMNVLVNKSLIKISYNKLQMHDLLQEMGREIVCQEFREKPEKRSRLWDYKDVCHVLEKNKGTDAIKSIFLDLSKIEEINLDPRAFTNMSNVRLLKFYISGHFDVSKMSSKVHLQQESYRTQLSFKKVEQIWEGQKKAPKLKYVDLNHSTNLTRIPEPSETPNLERMNLRNCTGLAHIPSYVQNFNKLGNMIMAGCESLRCFPQNIHFISSIKIDCYKCVNLKEFPRISGNVVELNLMCTPIEEVPLSIECLPNLEILEMSFCYSLKRLSTSICKLKYLSSLDLSYCINLESFPEILEKMELLEEINLEEASNIKELPSSIENLEGLKQLKLTGCTKLGSLPETKNWMHPYCKHYPITRVKDYSSTSPVQLIFANCLKLNESIWADLQQRIRHMIIASRRLFCEKNIGLSDGAAVSFDFFIRYQLVIVKGPQKVKCCGVSPVYANPNTFTLEFGDRSEDFDYMDNAQRQIVGGSHEYELESIR***********SRFSQFLKNVCCFDYEPWTKTFF*****
MGGIGKTTIGVVFNQFSQKFEGKYFMANVREESEKCGVLVHLRNQVLSKVLGENFDIGTQKIPQYIRDRLQRMKVFIVLDDVNKDKTILERYGTQRIYEVEGLNCNEVLRLFSSCAFKENHCPEDLLKHSETAVHYAKGNPLALQVLGSSFYGKSKPDWVNALNNLKRISGSDIYDDREHVMWILSDDYCSVQYAMNVLVNKSLIKISYNKLQMHDLLQEMGREIVCQEFREKPEKRSRLWDYKDVCHVLEKNKGTDAIKSIFLDLSKIEEINLDPRAFTNMSNVRLLKFYISGHFDVSKMSSKVHLQQESYRTQLSFKKVEQIWEGQKKAPKLKYVDLNHSTNLTRIPEPSETPNLERMNLRNCTGLAHIPSYVQNFNKLGNMIMAGCESLRCFPQNIHFISSIKIDCYKCVNLKEFPRISGNVVELNLMCTPIEEVPLSIECLPNLEILEMSFCYSLKRLSTSICKLKYLSSLDLSYCINLESFPEILEKMELLEEINLEEASNIKELPSSIENLEGLKQLKLTGCTKLGSLPETKNWMHPYCKHYPITRVKDYSSTSPVQLIFANCLKLNESIWADLQQRIRHMIIASRRLFCEKNIGLSDGAAVSFDFFIRYQLVIVKGPQKVKCCGVSPVYANPNTFTLEFGDRSEDFDYMDNAQRQIVGGSHEYELESIRREQFNGPQRQTSRFSQFLKNVCCFDYEPWTKTFFQDQGI
*GGIGKTTIGVVFNQFSQKFEGKYFMANVREESEKCGVLVHLRNQVLSKVLGENFDIGTQKIPQYIRDRLQRMKVFIVLDDVNKDKTILERYGTQRIYEVEGLNCNEVLRLFSSCAFKENHCPEDLLKHSETAVHYAKGNPLALQVLGSSFYGKSKPDWVNALNNLKRISGSDIYDDREHVMWILSDDYCSVQYAMNVLVNKSLIKISYNKLQMHDLLQEMGREIVCQEFREKPEKRSRLWDYKDVCHVLEKNKGTDAIKSIFLDLSKIEEINLDPRAFTNMSNVRLLKFYISGHFDVSKMSSKVHLQQESYRTQLSFKKVEQIWEGQKKAPKLKYVDLNHSTNLTRIPEPSETPNLERMNLRNCTGLAHIPSYVQNFNKLGNMIMAGCESLRCFPQNIHFISSIKIDCYKCVNLKEFPRISGNVVELNLMCTPIEEVPLSIECLPNLEILEMSFCYSLKRLSTSICKLKYLSSLDLSYCINLESFPEILEKMELLEEINLEEASNIKELPSSIENLEGLKQLKLTGCTKLGSLPETKNWMHPYCKHYPITRVKDYSSTSPVQLIFANCLKLNESIWADLQQRIRHMIIASRRLFCEKNIGLSDGAAVSFDFFIRYQLVIVKGPQKVKCCGVSPVYANPNTFTLEFGDRSEDFDYMDNAQRQIVGGSHEYELESIRREQFNGPQRQTSRFSQFLKNVCCFDYEPWTKTFFQDQG*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGGIGKTTIGVVFNQFSQKFEGKYFMANVREESEKCGVLVHLRNQVLSKVLGENFDIGTQKIPQYIRDRLQRMKVFIVLDDVNKDKTILERYGTQRIYEVEGLNCNEVLRLFSSCAFKENHCPEDLLKHSETAVHYAKGNPLALQVLGSSFYGKSKPDWVNALNNLKRISGSDIYDDREHVMWILSDDYCSVQYAMNVLVNKSLIKISYNKLQMHDLLQEMGREIVCQEFREKPEKRSRLWDYKDVCHVLEKNKGTDAIKSIFLDLSKIEEINLDPRAFTNMSNVRLLKFYISGHFDVSKMSSKVHLQQESYRTQLSFKKVEQIWEGQKKAPKLKYVDLNHSTNLTRIPEPSETPNLERMNLRNCTGLAHIPSYVQNFNKLGNMIMAGCESLRCFPQNIHFISSIKIDCYKCVNLKEFPRISGNVVELNLMCTPIEEVPLSIECLPNLEILEMSFCYSLKRLSTSICKLKYLSSLDLSYCINLESFPEILEKMELLEEINLEEASNIKELPSSIENLEGLKQLKLTGCTKLGSLPETKNWMHPYCKHYPITRVKDYSSTSPVQLIFANCLKLNESIWADLQQRIRHMIIASRRLFCEKNIGLSDGAAVSFDFFIRYQLVIVKGPQKVKCCGVSPVYANPNTFTLEFGDRSEDFDYMDNAQRQIVGGSHEYELESIRREQFNGPQRQTSRFSQFLKNVCCFDYEPWTKTFFQDQGI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query715 2.2.26 [Sep-21-2011]
O825001095 Putative disease resistan no no 0.738 0.482 0.300 5e-55
Q40392 1144 TMV resistance protein N N/A no 0.721 0.451 0.296 1e-51
Q9SZ67 1895 Probable WRKY transcripti no no 0.724 0.273 0.310 1e-50
Q9FL92 1372 Probable WRKY transcripti no no 0.773 0.403 0.278 6e-50
O23530 1301 Protein SUPPRESSOR OF npr no no 0.746 0.410 0.260 1e-43
Q9FH83 1288 Probable WRKY transcripti no no 0.723 0.401 0.289 1e-41
Q9FKN7 1613 Protein DA1-related 4 OS= no no 0.766 0.339 0.249 7e-37
P0CB16 1201 Putative disease resistan no no 0.243 0.144 0.303 1e-10
Q9SZA7816 Probable disease resistan no no 0.282 0.247 0.277 4e-10
Q9RBS2 1024 Protein PopC OS=Ralstonia yes no 0.248 0.173 0.289 1e-09
>sp|O82500|Y4117_ARATH Putative disease resistance protein At4g11170 OS=Arabidopsis thaliana GN=At4g11170 PE=2 SV=1 Back     alignment and function desciption
 Score =  216 bits (550), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 195/648 (30%), Positives = 294/648 (45%), Gaps = 120/648 (18%)

Query: 2   GGIGKTTIG-VVFNQFSQKFEGKYFMANVREESEKCGV-----LVHLRNQVLSKVLGENF 55
            G+GKTTI   ++NQ+ + F    FM NVRE   + G+      +HL+ + LSK+L +  
Sbjct: 214 AGVGKTTIARALYNQYHENFNLSIFMENVRESYGEAGLDDYGLKLHLQQRFLSKLLDQK- 272

Query: 56  DIGTQKIPQYIRDRLQRMKVFIVLDDVN-------------------------KDKTILE 90
           D+  + +   I +RL+  KV I+LDDV+                         ++K +L 
Sbjct: 273 DLRVRHLGA-IEERLKSQKVLIILDDVDNIEQLKALAKENQWFGNKSRIVVTTQNKQLLV 331

Query: 91  RYGTQRIYEVEGLNCNEVLRLFSSCAFKENHCPEDLLKHSETAVHYAKGN-PLALQVLGS 149
            +    +Y+V   +  E L +F   AFK++  P D LKH         G+ PLAL+VLGS
Sbjct: 332 SHDINHMYQVAYPSKQEALTIFCQHAFKQS-SPSDDLKHLAIEFTTLAGHLPLALRVLGS 390

Query: 150 SFYGKSKPDWVNALNNLK-RISGS---------DIYDDRE-----HVMWILSDDY----- 189
              GK K +W  +L  LK R+ G          D   D E     H+  I S  +     
Sbjct: 391 FMRGKGKEEWEFSLPTLKSRLDGEVEKVLKVGYDGLHDHEKDLFLHIACIFSGQHENYLK 450

Query: 190 --------CSVQYAMNVLVNKSLI-KISYNKLQMHDLLQEMGREIVCQEFREKPEKRSRL 240
                     V + + VL +KSLI K    +++MH LL+++G+E+V ++   +P KR  L
Sbjct: 451 QMIIANNDTYVSFGLQVLADKSLIQKFENGRIEMHSLLRQLGKEVVRKQSIYEPGKRQFL 510

Query: 241 WDYKDVCHVLEKNKGTDAIKSIFLDLSKI-EEINLDPRAFTNMSNVRLLKFYISGHFDVS 299
            + K+ C VL  N GT  +  I LD+ +I EE+ +  + F  M N+  LKFY+S   D  
Sbjct: 511 MNAKETCGVLSNNTGTGTVLGISLDMCEIKEELYISEKTFEEMRNLVYLKFYMSSPID-D 569

Query: 300 KMSSKVHLQQE--SYRTQL---------------------------SFKKVEQIWEGQKK 330
           KM  K+ L +E  SY  QL                           S  K++++W G + 
Sbjct: 570 KMKVKLQLPEEGLSYLPQLRLLHWDAYPLEFFPSSFRPECLVELNMSHSKLKKLWSGVQP 629

Query: 331 APKLKYVDLNHSTNLTRIPEPSETPNLERMNLRNCTGLAHIPSYVQNFNKLGNMIMAGCE 390
              L+ ++LN S NL  +P   E   L R++L  C  L  +PS ++N   L  + M+ C+
Sbjct: 630 LRNLRTMNLNSSRNLEILPNLMEATKLNRLDLGWCESLVELPSSIKNLQHLILLEMSCCK 689

Query: 391 SLRCFPQNIHFISSIKIDCYKCVNLKEFPRISGNVVELNLMCTPIEEVPLSIECLPNLE- 449
            L   P NI+  S   +    C  L+ FP IS N+  LNL+ T I EVP S++    ++ 
Sbjct: 690 KLEIIPTNINLPSLEVLHFRYCTRLQTFPEISTNIRLLNLIGTAITEVPPSVKYWSKIDE 749

Query: 450 ----------------ILEMSFCYSLKRLSTSICKLKYLSSL---DLSYCINLESFPEIL 490
                           +LE       K L T    LKYL  L   D+SYCIN+ S P++ 
Sbjct: 750 ICMERAKVKRLVHVPYVLEKLCLRENKELETIPRYLKYLPRLQMIDISYCINIISLPKLP 809

Query: 491 EKMELLEEINLEEASNIKELPSSIENLEGLKQLKLTGCTKLGSLPETK 538
             +  L  +N E   +++ L     N      L    C KLG   + K
Sbjct: 810 GSVSALTAVNCE---SLQILHGHFRNKS--IHLNFINCLKLGQRAQEK 852

Arabidopsis thaliana (taxid: 3702)
>sp|Q40392|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1 Back     alignment and function description
>sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 Back     alignment and function description
>sp|Q9FL92|WRK16_ARATH Probable WRKY transcription factor 16 OS=Arabidopsis thaliana GN=WRKY16 PE=2 SV=1 Back     alignment and function description
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function description
>sp|Q9FH83|WRK52_ARATH Probable WRKY transcription factor 52 OS=Arabidopsis thaliana GN=WRKY52 PE=2 SV=3 Back     alignment and function description
>sp|Q9FKN7|DAR4_ARATH Protein DA1-related 4 OS=Arabidopsis thaliana GN=DAR4 PE=1 SV=2 Back     alignment and function description
>sp|P0CB16|DRL25_ARATH Putative disease resistance protein At4g19050 OS=Arabidopsis thaliana GN=At4g19050 PE=3 SV=2 Back     alignment and function description
>sp|Q9SZA7|DRL29_ARATH Probable disease resistance protein At4g33300 OS=Arabidopsis thaliana GN=At4g33300 PE=2 SV=3 Back     alignment and function description
>sp|Q9RBS2|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query715
255544956 1403 leucine-rich repeat containing protein, 0.735 0.374 0.378 7e-89
224127750 1018 tir-nbs-lrr resistance protein [Populus 0.745 0.523 0.347 6e-86
224127917 1470 tir-nbs-lrr resistance protein [Populus 0.739 0.359 0.348 4e-84
359486075 1291 PREDICTED: TMV resistance protein N-like 0.745 0.412 0.345 2e-83
451798990 1335 TMV resistance protein N-like protein 7 0.746 0.4 0.365 9e-82
225448053 1468 PREDICTED: TMV resistance protein N-like 0.744 0.362 0.353 1e-81
255563202 1158 leucine-rich repeat containing protein, 0.724 0.447 0.377 1e-81
225460354 1174 PREDICTED: TMV resistance protein N-like 0.735 0.448 0.355 1e-80
224116202 1098 tir-nbs-lrr resistance protein [Populus 0.739 0.481 0.344 7e-80
359486073 1296 PREDICTED: TMV resistance protein N-like 0.742 0.409 0.338 7e-80
>gi|255544956|ref|XP_002513539.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223547447|gb|EEF48942.1| leucine-rich repeat containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  335 bits (858), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 238/629 (37%), Positives = 333/629 (52%), Gaps = 103/629 (16%)

Query: 1   MGGIGKTTIG-VVFNQFSQKFEGKYFMANVREESEKCGVLVHLRNQVLSKVLGE-NFDIG 58
           MGGIGKTT    +F Q S + E  YF+ANVREESEK  V V LR+++LS +L E N  +G
Sbjct: 226 MGGIGKTTTAKALFTQISNELEAAYFVANVREESEKRTV-VRLRDEILSNILEEENLHLG 284

Query: 59  TQKI-PQYIRDRLQRMKVFIVLDDVN-------------------------KDKTILERY 92
            + I P++I +RL+R ++ IVLDDV+                         +DK +L   
Sbjct: 285 MRSILPRFILNRLRRKRILIVLDDVSNVEQLTTLAGDHSWFGSGSRVIITSRDKQVLVN- 343

Query: 93  GTQRIYEVEGLNCNEVLRLFSSCAFKENHCPEDLLKHSETAVHYAKGNPLALQVLGSSFY 152
              RIYEV+GLN  E L+L S   FK+NH  E  ++ S+  V+Y KG PLAL VL S  Y
Sbjct: 344 AADRIYEVKGLNYCEALQLLSFKVFKQNHPVEGYIELSKRVVNYTKGVPLALNVLASFLY 403

Query: 153 GKSKPDWVNALNNLKRISGSDI-------YDDREHVMWILSDDY---------CSVQYAM 196
            K + +W + L  L+  S  +I       YD+ E   W+  D +           V Y  
Sbjct: 404 SKQREEWTSTLEKLEESSNLEIQKVLKISYDELE---WVDKDIFLDIACFFKGADVDYVT 460

Query: 197 NVL--------------VNKSLIKISYNKLQMHDLLQEMGREIVCQEFREKPEKRSRLWD 242
            +L              V+KSLI I  NKL MHDLLQEMG+ IV +E  E P K SRLW 
Sbjct: 461 TILDGCDFFPSIGISRLVDKSLIAIIDNKLDMHDLLQEMGQHIVQKESSENPGKNSRLWT 520

Query: 243 YKDVCHVLEKNKGTDAIKSIFLDLSKIEEINLDPRAFTNMSNVRLLKFY---------IS 293
            + + HVL  N+GT A + IFLD+SKIE+++L   AF+ M N+RLLKFY          +
Sbjct: 521 PESIHHVLTGNRGTFATEGIFLDISKIEKVDLSSVAFSKMWNLRLLKFYHNSFLSWKNPT 580

Query: 294 GHFDVSKMSSKVHLQQ---------------ESYRTQLS----------FKKVEQIWEGQ 328
           G    S + S+  LQ                ES  +  S          F +V+++W G 
Sbjct: 581 GFVSESTLDSRDGLQSLPNKLCFLHWHGYPWESLPSNFSMENLVELNMPFSQVKELWTGV 640

Query: 329 KKAPKLKYVDLNHSTNLTRIPEPSETPNLERMNLRNCTGLAHIPSYVQNFNKLGNMIMAG 388
           K   KLK +DL+ S  L  +P+ S   NLE++ L NCT L  IPS +Q   KL  + ++ 
Sbjct: 641 KHLQKLKLLDLHDSELLVTLPDLSSASNLEKIILNNCTSLLEIPSSIQCLRKLVCLSLSN 700

Query: 389 CESLRCFPQNIHFISSIKIDCYKCVNLKEFPRISGNVVELNLMCTPIEEVPLSIECLPNL 448
           C+ L+  P  I       ++   C NLK+FP ISG + EL+L  T +EE P S++ L  L
Sbjct: 701 CKELQSLPSLIPLKYLKTLNLSSCSNLKKFPEISGEIEELHLDGTGLEEWPSSVQYLDKL 760

Query: 449 EILEMSFCYSLKRLSTSICKLKYLSSLDLSYCINLESFPEILEKMELLEEINLEEASNIK 508
            +L +  C  LK L  SI  L  L +LDLS+C +L++FP+++  ++ L   N+   + I+
Sbjct: 761 RLLSLDHCEDLKSLPGSI-HLNSLDNLDLSWCSSLKNFPDVVGNIKYL---NVGHTA-IE 815

Query: 509 ELPSSIENLEGLKQLKLTGCTKLGSLPET 537
           ELPSSI +L  L +L L   T++  LP +
Sbjct: 816 ELPSSIGSLVSLTKLNLKD-TEIKELPSS 843

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224127750|ref|XP_002329168.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222870949|gb|EEF08080.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224127917|ref|XP_002329209.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222870990|gb|EEF08121.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359486075|ref|XP_002273047.2| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|451798990|gb|AGF69193.1| TMV resistance protein N-like protein 7 [Vitis labrusca] Back     alignment and taxonomy information
>gi|225448053|ref|XP_002273151.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255563202|ref|XP_002522604.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223538080|gb|EEF39691.1| leucine-rich repeat containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225460354|ref|XP_002263146.1| PREDICTED: TMV resistance protein N-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224116202|ref|XP_002331986.1| tir-nbs-lrr resistance protein [Populus trichocarpa] gi|222832110|gb|EEE70587.1| tir-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359486073|ref|XP_002272820.2| PREDICTED: TMV resistance protein N-like, partial [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query715
UNIPROTKB|Q40392 1144 N "TMV resistance protein N" [ 0.427 0.267 0.273 2.5e-45
TAIR|locus:2175991 1294 AT5G17680 [Arabidopsis thalian 0.462 0.255 0.282 5e-44
TAIR|locus:2053405 1215 AT2G14080 [Arabidopsis thalian 0.488 0.287 0.285 3.4e-37
TAIR|locus:2146243900 AT5G18360 [Arabidopsis thalian 0.476 0.378 0.269 3.6e-37
TAIR|locus:2136108 1095 AT4G11170 [Arabidopsis thalian 0.524 0.342 0.243 4.3e-36
TAIR|locus:2024588997 RLM1 "RESISTANCE TO LEPTOSPHAE 0.613 0.440 0.253 1.2e-35
TAIR|locus:2147992 1189 AT5G11250 [Arabidopsis thalian 0.492 0.296 0.295 2.3e-35
TAIR|locus:2164486 1104 AT5G40910 [Arabidopsis thalian 0.388 0.251 0.283 2.4e-35
TAIR|locus:2039405 1109 AT2G16870 [Arabidopsis thalian 0.531 0.342 0.266 4.9e-35
TAIR|locus:2177401833 AT5G38350 [Arabidopsis thalian 0.551 0.472 0.236 5.4e-35
UNIPROTKB|Q40392 N "TMV resistance protein N" [Nicotiana glutinosa (taxid:35889)] Back     alignment and assigned GO terms
 Score = 328 (120.5 bits), Expect = 2.5e-45, Sum P(4) = 2.5e-45
 Identities = 92/336 (27%), Positives = 174/336 (51%)

Query:   176 DDREHVMWILSDDYCSVQYAMNVLVNKSLIKIS-YNKLQMHDLLQEMGREIVCQEFREKP 234
             +++++++ IL   +   +Y + +L++KSL+ IS YN++QMHDL+Q+MG+ IV   F++ P
Sbjct:   448 EEKDYILQILESCHIGAEYGLRILIDKSLVFISEYNQVQMHDLIQDMGKYIV--NFQKDP 505

Query:   235 EKRSRLWDYKDVCHVLEKNKGTDAIKSIFL---------------DLSKIEEINLDPRAF 279
              +RSRLW  K+V  V+  N GT A+++I++               ++ ++   N+  R+ 
Sbjct:   506 GERSRLWLAKEVEEVMSNNTGTMAMEAIWVSSYSSTLRFSNQAVKNMKRLRVFNMG-RSS 564

Query:   280 TNMSNVRL---LKFYISGHFDVSKMSSKVHLQQESYRTQLSFKKVEQIWEGQKKAPKLKY 336
             T+ +   L   L+ ++  ++      S   L+   +  QL    +  +W   K  P L+ 
Sbjct:   565 THYAIDYLPNNLRCFVCTNYPWESFPSTFELKMLVH-LQLRHNSLRHLWTETKHLPSLRR 623

Query:   337 VDLNHSTNLTRIPEPSETPNLERMNLRNCTGLAHIPSYVQNFNKLGNMIMAGCESLRCFP 396
             +DL+ S  LTR P+ +  PNLE +NL  C+ L  +   +   +K+  + +  C+SL+ FP
Sbjct:   624 IDLSWSKRLTRTPDFTGMPNLEYVNLYQCSNLEEVHHSLGCCSKVIGLYLNDCKSLKRFP 683

Query:   397 -QNIHFISSIKIDCYKCVNLKEFPRISGNV---VELNLMCTPIEEVPLSI-ECLPNLEIL 451
               N+  +  + +    C +L++ P I G +   +++++  + I E+P SI +   ++  L
Sbjct:   684 CVNVESLEYLGLR--SCDSLEKLPEIYGRMKPEIQIHMQGSGIRELPSSIFQYKTHVTKL 741

Query:   452 EMSFCYSLKRLSTSICXXXXXXXXXXXXCINLESFP 487
              +    +L  L +SIC            C  LES P
Sbjct:   742 LLWNMKNLVALPSSICRLKSLVSLSVSGCSKLESLP 777
GO:0005515 "protein binding" evidence=IPI
TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053405 AT2G14080 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2146243 AT5G18360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2136108 AT4G11170 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024588 RLM1 "RESISTANCE TO LEPTOSPHAERIA MACULANS 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2147992 AT5G11250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2164486 AT5G40910 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2039405 AT2G16870 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2177401 AT5G38350 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query715
PLN03210 1153 PLN03210, PLN03210, Resistant to P 4e-73
PLN032101153 PLN03210, PLN03210, Resistant to P 3e-22
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-09
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 1e-08
PLN03210 1153 PLN03210, PLN03210, Resistant to P 2e-06
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information 
 Score =  257 bits (657), Expect = 4e-73
 Identities = 188/633 (29%), Positives = 298/633 (47%), Gaps = 105/633 (16%)

Query: 3   GIGKTTIG-VVFNQFSQKFEGKYFMANV----------REESEKCGVLVHLRNQVLSKVL 51
           GIGKTTI   +F++ S++F+   F+                 +   + +HL+   LS++L
Sbjct: 217 GIGKTTIARALFSRLSRQFQSSVFIDRAFISKSMEIYSSANPDDYNMKLHLQRAFLSEIL 276

Query: 52  GENFDIGTQKIPQYIRDRLQRMKVFIVLDD-------------------------VNKDK 86
            +  DI    +   + +RL+  KV I +DD                         + KDK
Sbjct: 277 DKK-DIKIYHLGA-MEERLKHRKVLIFIDDLDDQDVLDALAGQTQWFGSGSRIIVITKDK 334

Query: 87  TILERYGTQRIYEVEGLNCNEV-LRLFSSCAFKENHCPEDLLKHSETAVHYAKGNPLALQ 145
             L  +G   IYEV  L  NE+ L +F   AFK+N  P+  ++ +      A   PL L 
Sbjct: 335 HFLRAHGIDHIYEV-CLPSNELALEMFCRSAFKKNSPPDGFMELASEVALRAGNLPLGLN 393

Query: 146 VLGSSFYGKSKPDWVNALNNLK-----------RISGSDIYDDREHVMW----------- 183
           VLGS   G+ K DW++ L  L+           R+S   + + ++  ++           
Sbjct: 394 VLGSYLRGRDKEDWMDMLPRLRNGLDGKIEKTLRVSYDGLNNKKDKAIFRHIACLFNGEK 453

Query: 184 ------ILSDDYCSVQYAMNVLVNKSLIKISYNKLQMHDLLQEMGREIVCQEFREKPEKR 237
                 +L++    V   +  LV+KSLI +  + ++MH LLQEMG+EIV  +  E P +R
Sbjct: 454 VNDIKLLLANSDLDVNIGLKNLVDKSLIHVREDIVEMHSLLQEMGKEIVRAQSNE-PGER 512

Query: 238 SRLWDYKDVCHVLEKNKGTDAIKSIFLDLSKIEEINLDPRAFTNMSNVRLLKFY------ 291
             L D KD+C VLE N GT  +  I LD+ +I+E+++   AF  M N+  LKFY      
Sbjct: 513 EFLVDAKDICDVLEDNTGTKKVLGITLDIDEIDELHIHENAFKGMRNLLFLKFYTKKWDQ 572

Query: 292 -------ISGHFD---------------VSKMSSKVHLQQESYRTQLSFKKVEQIWEGQK 329
                  +   FD               +  M S     +   + Q+   K+E++W+G  
Sbjct: 573 KKEVRWHLPEGFDYLPPKLRLLRWDKYPLRCMPSNFR-PENLVKLQMQGSKLEKLWDGVH 631

Query: 330 KAPKLKYVDLNHSTNLTRIPEPSETPNLERMNLRNCTGLAHIPSYVQNFNKLGNMIMAGC 389
               L+ +DL  S NL  IP+ S   NLE + L +C+ L  +PS +Q  NKL ++ M+ C
Sbjct: 632 SLTGLRNIDLRGSKNLKEIPDLSMATNLETLKLSDCSSLVELPSSIQYLNKLEDLDMSRC 691

Query: 390 ESLRCFPQNIHFISSIKIDCYKCVNLKEFPRISGNVVELNLMCTPIEEVP--LSIECLPN 447
           E+L   P  I+  S  +++   C  LK FP IS N+  L+L  T IEE P  L +E L  
Sbjct: 692 ENLEILPTGINLKSLYRLNLSGCSRLKSFPDISTNISWLDLDETAIEEFPSNLRLENLDE 751

Query: 448 LEILEMSFCYSLKRLSTSICKLKYLS-SLDLSYCINLESFPEI---LEKMELLEEINLEE 503
           L + EM      +R+      +  LS SL   +  ++ S  E+   ++ +  LE + +E 
Sbjct: 752 LILCEMKSEKLWERVQPLTPLMTMLSPSLTRLFLSDIPSLVELPSSIQNLHKLEHLEIEN 811

Query: 504 ASNIKELPSSIENLEGLKQLKLTGCTKLGSLPE 536
             N++ LP+ I NLE L+ L L+GC++L + P+
Sbjct: 812 CINLETLPTGI-NLESLESLDLSGCSRLRTFPD 843

syringae 6; Provisional. Length = 1153
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 715
PLN032101153 Resistant to P. syringae 6; Provisional 100.0
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.95
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.94
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 99.94
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.92
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.9
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.88
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.87
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.86
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.85
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.82
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.74
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.73
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.69
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.68
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.67
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.62
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.61
KOG0617264 consensus Ras suppressor protein (contains leucine 99.58
KOG0617264 consensus Ras suppressor protein (contains leucine 99.58
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.52
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.48
KOG4237498 consensus Extracellular matrix protein slit, conta 99.46
KOG4237498 consensus Extracellular matrix protein slit, conta 99.4
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.06
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.02
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.97
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.95
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.95
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.93
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.87
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.87
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.85
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.75
PLN03150623 hypothetical protein; Provisional 98.74
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.68
PLN03150623 hypothetical protein; Provisional 98.59
PRK15386426 type III secretion protein GogB; Provisional 98.45
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 98.45
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.44
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.4
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.38
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.34
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.29
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.29
KOG4341483 consensus F-box protein containing LRR [General fu 98.24
KOG4341483 consensus F-box protein containing LRR [General fu 98.19
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.16
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.12
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.1
PRK15386426 type III secretion protein GogB; Provisional 98.06
PRK06893229 DNA replication initiation factor; Validated 97.94
PRK04841903 transcriptional regulator MalT; Provisional 97.88
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.75
PRK09376416 rho transcription termination factor Rho; Provisio 97.73
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.6
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.59
PF05729166 NACHT: NACHT domain 97.59
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.58
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.55
PRK00411394 cdc6 cell division control protein 6; Reviewed 97.53
cd01128249 rho_factor Transcription termination factor rho is 97.52
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.36
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.29
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.29
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 97.27
COG2256436 MGS1 ATPase related to the helicase subunit of the 97.2
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 97.2
TIGR02928365 orc1/cdc6 family replication initiation protein. M 97.19
TIGR00767415 rho transcription termination factor Rho. Members 97.18
PRK08727233 hypothetical protein; Validated 97.17
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.16
COG3903414 Predicted ATPase [General function prediction only 97.15
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.13
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.11
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 97.06
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.04
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.99
PRK13342413 recombination factor protein RarA; Reviewed 96.99
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.92
PRK14087450 dnaA chromosomal replication initiation protein; P 96.87
PRK05642234 DNA replication initiation factor; Validated 96.81
PRK08084235 DNA replication initiation factor; Provisional 96.79
PRK14088440 dnaA chromosomal replication initiation protein; P 96.68
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 96.64
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.62
PRK12422445 chromosomal replication initiation protein; Provis 96.62
PRK09087226 hypothetical protein; Validated 96.6
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 96.57
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 96.54
TIGR00362405 DnaA chromosomal replication initiator protein Dna 96.42
cd01133274 F1-ATPase_beta F1 ATP synthase beta subunit, nucle 96.35
PRK00149450 dnaA chromosomal replication initiation protein; R 96.34
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.19
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.13
COG0593408 DnaA ATPase involved in DNA replication initiation 95.99
KOG2123 388 consensus Uncharacterized conserved protein [Funct 95.97
PRK14086617 dnaA chromosomal replication initiation protein; P 95.82
PHA00729226 NTP-binding motif containing protein 95.66
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 95.6
PRK08116268 hypothetical protein; Validated 95.6
PRK13341725 recombination factor protein RarA/unknown domain f 95.6
PRK07952244 DNA replication protein DnaC; Validated 95.58
PRK12377248 putative replication protein; Provisional 95.54
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 95.48
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.46
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 95.34
PRK08903227 DnaA regulatory inactivator Hda; Validated 95.27
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 95.16
PRK12608380 transcription termination factor Rho; Provisional 94.88
PLN03025319 replication factor C subunit; Provisional 94.86
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 94.78
PF13173128 AAA_14: AAA domain 94.76
PRK08181269 transposase; Validated 94.69
PF14516331 AAA_35: AAA-like domain 94.6
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.58
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 94.46
COG1484254 DnaC DNA replication protein [DNA replication, rec 94.32
smart00382148 AAA ATPases associated with a variety of cellular 94.32
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 94.26
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 94.24
KOG2028554 consensus ATPase related to the helicase subunit o 94.12
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 94.07
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.04
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 94.02
PRK06526254 transposase; Provisional 94.02
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 93.93
PTZ001121164 origin recognition complex 1 protein; Provisional 93.85
PRK04195482 replication factor C large subunit; Provisional 93.81
COG3899849 Predicted ATPase [General function prediction only 93.79
PRK09183259 transposase/IS protein; Provisional 93.78
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.72
PRK08939306 primosomal protein DnaI; Reviewed 93.63
PRK08118167 topology modulation protein; Reviewed 93.52
PRK06620214 hypothetical protein; Validated 93.46
PRK11331459 5-methylcytosine-specific restriction enzyme subun 93.34
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 93.25
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 93.16
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 93.13
PF00004132 AAA: ATPase family associated with various cellula 92.74
COG2255332 RuvB Holliday junction resolvasome, helicase subun 92.71
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 92.67
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 92.57
PRK06921266 hypothetical protein; Provisional 92.55
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 92.5
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 92.5
PRK14960702 DNA polymerase III subunits gamma and tau; Provisi 92.42
PRK12323700 DNA polymerase III subunits gamma and tau; Provisi 92.33
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 92.3
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 92.21
PRK06835329 DNA replication protein DnaC; Validated 92.2
PRK12402337 replication factor C small subunit 2; Reviewed 92.14
PRK07003830 DNA polymerase III subunits gamma and tau; Validat 92.09
PRK09112351 DNA polymerase III subunit delta'; Validated 91.99
PRK09361225 radB DNA repair and recombination protein RadB; Pr 91.88
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 91.83
TIGR02237209 recomb_radB DNA repair and recombination protein R 91.74
PRK00440319 rfc replication factor C small subunit; Reviewed 91.42
COG1618179 Predicted nucleotide kinase [Nucleotide transport 91.38
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 91.34
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 91.19
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 91.06
PRK07994647 DNA polymerase III subunits gamma and tau; Validat 91.03
KOG2227529 consensus Pre-initiation complex, subunit CDC6, AA 90.92
PRK07940394 DNA polymerase III subunit delta'; Validated 90.89
PRK03992389 proteasome-activating nucleotidase; Provisional 90.89
PRK04132846 replication factor C small subunit; Provisional 90.88
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 90.63
PRK05541176 adenylylsulfate kinase; Provisional 90.58
COG4088261 Predicted nucleotide kinase [Nucleotide transport 90.42
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 90.15
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 90.04
PRK05564313 DNA polymerase III subunit delta'; Validated 90.02
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 89.99
PRK08691709 DNA polymerase III subunits gamma and tau; Validat 89.95
PRK07471365 DNA polymerase III subunit delta'; Validated 89.93
PRK09280463 F0F1 ATP synthase subunit beta; Validated 89.87
COG0468279 RecA RecA/RadA recombinase [DNA replication, recom 89.8
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 89.7
KOG3864221 consensus Uncharacterized conserved protein [Funct 89.7
PTZ00202550 tuzin; Provisional 89.59
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 89.5
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 89.37
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 89.35
cd01135276 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) 89.26
PF08433270 KTI12: Chromatin associated protein KTI12 ; InterP 89.23
PRK12597461 F0F1 ATP synthase subunit beta; Provisional 89.07
cd01132274 F1_ATPase_alpha F1 ATP synthase alpha, central dom 88.99
PRK07261171 topology modulation protein; Provisional 88.89
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 88.85
cd01393226 recA_like RecA is a bacterial enzyme which has rol 88.81
PRK12678672 transcription termination factor Rho; Provisional 88.77
CHL00059485 atpA ATP synthase CF1 alpha subunit 88.76
PRK14959624 DNA polymerase III subunits gamma and tau; Provisi 88.74
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 88.64
cd01394218 radB RadB. The archaeal protein radB shares simila 88.32
KOG2543438 consensus Origin recognition complex, subunit 5 [R 88.31
PRK05707328 DNA polymerase III subunit delta'; Validated 88.17
KOG3864221 consensus Uncharacterized conserved protein [Funct 87.94
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 87.73
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 87.3
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 87.25
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 87.18
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 87.0
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 86.91
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 86.8
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 86.63
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 86.56
TIGR01039461 atpD ATP synthase, F1 beta subunit. The sequences 86.42
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 86.13
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 85.77
CHL00176638 ftsH cell division protein; Validated 85.68
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 85.66
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 85.63
CHL00181287 cbbX CbbX; Provisional 85.38
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 85.2
PRK09281502 F0F1 ATP synthase subunit alpha; Validated 85.13
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 84.93
PF00006215 ATP-synt_ab: ATP synthase alpha/beta family, nucle 84.63
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 84.54
KOG0473326 consensus Leucine-rich repeat protein [Function un 84.54
PRK04301317 radA DNA repair and recombination protein RadA; Va 84.48
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 84.32
COG1192259 Soj ATPases involved in chromosome partitioning [C 84.28
PRK07133725 DNA polymerase III subunits gamma and tau; Validat 84.14
TIGR03324497 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit a 83.91
KOG4308478 consensus LRR-containing protein [Function unknown 83.83
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 83.76
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 83.41
PF01656195 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domai 83.34
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 83.25
smart0037026 LRR Leucine-rich repeats, outliers. 83.25
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 82.99
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 82.95
cd00983325 recA RecA is a bacterial enzyme which has roles in 82.75
COG1066456 Sms Predicted ATP-dependent serine protease [Postt 82.75
PRK14528186 adenylate kinase; Provisional 82.3
PTZ00185574 ATPase alpha subunit; Provisional 82.3
TIGR02012321 tigrfam_recA protein RecA. This model describes or 82.28
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 82.27
CHL00060494 atpB ATP synthase CF1 beta subunit 82.27
TIGR00962501 atpA proton translocating ATP synthase, F1 alpha s 82.24
PRK00889175 adenylylsulfate kinase; Provisional 82.04
TIGR03305449 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit 81.98
PF07726131 AAA_3: ATPase family associated with various cellu 81.96
CHL00195489 ycf46 Ycf46; Provisional 81.72
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 81.35
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 81.28
KOG0473326 consensus Leucine-rich repeat protein [Function un 81.27
PRK08972444 fliI flagellum-specific ATP synthase; Validated 81.26
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 80.89
PRK03839180 putative kinase; Provisional 80.77
PHA02518211 ParA-like protein; Provisional 80.74
KOG1969877 consensus DNA replication checkpoint protein CHL12 80.67
PRK08769319 DNA polymerase III subunit delta'; Validated 80.66
PRK13343502 F0F1 ATP synthase subunit alpha; Provisional 80.48
PRK11823446 DNA repair protein RadA; Provisional 80.41
TIGR01041458 ATP_syn_B_arch ATP synthase archaeal, B subunit. A 80.26
>PLN03210 Resistant to P Back     alignment and domain information 
Probab=100.00  E-value=1.5e-68  Score=645.62  Aligned_cols=614  Identities=31%  Similarity=0.501  Sum_probs=476.7

Q ss_pred             CCCCcHHHHH-HHHHHhhccCCceEEEEec--ch---hhhc-----CCcHHHHHHHHHHHHhCCCCCCCCCcchHHHHHH
Q 005085            1 MGGIGKTTIG-VVFNQFSQKFEGKYFMANV--RE---ESEK-----CGVLVHLRNQVLSKVLGENFDIGTQKIPQYIRDR   69 (715)
Q Consensus         1 mgGiGKTTLa-~vy~~~~~~F~~~~wv~~v--~~---~~~~-----~~~~~~l~~~i~~~~~~~~~~~~~~~~~~~l~~~   69 (715)
                      |||+|||||| ++|+++..+|+..+|+..+  +.   .+..     ......++++++.++.... +... .....++++
T Consensus       215 ~gGiGKTTLA~~l~~~l~~~F~g~vfv~~~~v~~~~~~~~~~~~~~~~~~~~l~~~~l~~il~~~-~~~~-~~~~~~~~~  292 (1153)
T PLN03210        215 SSGIGKTTIARALFSRLSRQFQSSVFIDRAFISKSMEIYSSANPDDYNMKLHLQRAFLSEILDKK-DIKI-YHLGAMEER  292 (1153)
T ss_pred             CCCCchHHHHHHHHHHHhhcCCeEEEeeccccccchhhcccccccccchhHHHHHHHHHHHhCCC-Cccc-CCHHHHHHH
Confidence            8999999999 9999999999999988531  11   1110     1112456777777765433 2111 234678899


Q ss_pred             hcCCeEEEEEeCcc-------------------------CChHHHHHhCcCcEEEcCCCCHHHHHHHHHhhhcCCCCCCh
Q 005085           70 LQRMKVFIVLDDVN-------------------------KDKTILERYGTQRIYEVEGLNCNEVLRLFSSCAFKENHCPE  124 (715)
Q Consensus        70 L~~kr~LlVLDDv~-------------------------r~~~v~~~~~~~~~~~l~~L~~~es~~LF~~~af~~~~~~~  124 (715)
                      |++||+||||||||                         |+++++..++++++|+|+.|+++|||+||+++||++..+++
T Consensus       293 L~~krvLLVLDdv~~~~~l~~L~~~~~~~~~GsrIIiTTrd~~vl~~~~~~~~~~v~~l~~~ea~~LF~~~Af~~~~~~~  372 (1153)
T PLN03210        293 LKHRKVLIFIDDLDDQDVLDALAGQTQWFGSGSRIIVITKDKHFLRAHGIDHIYEVCLPSNELALEMFCRSAFKKNSPPD  372 (1153)
T ss_pred             HhCCeEEEEEeCCCCHHHHHHHHhhCccCCCCcEEEEEeCcHHHHHhcCCCeEEEecCCCHHHHHHHHHHHhcCCCCCcH
Confidence            99999999999998                         88899988888999999999999999999999999887888


Q ss_pred             hHHHHHHHHHHHhCCCcchhHHhhhcccCCChhHHHHHHHHhhccCCCCCcC----------------------------
Q 005085          125 DLLKHSETAVHYAKGNPLALQVLGSSFYGKSKPDWVNALNNLKRISGSDIYD----------------------------  176 (715)
Q Consensus       125 ~~~~~~~~i~~~c~glPLai~~~g~~L~~k~~~~w~~~l~~l~~~~~~~i~~----------------------------  176 (715)
                      ++++++++|+++|+|+||||+++|+.|++++.++|++++++++..++.++..                            
T Consensus       373 ~~~~l~~~iv~~c~GLPLAl~vlgs~L~~k~~~~W~~~l~~L~~~~~~~I~~~L~~SYd~L~~~~~k~~Fl~ia~ff~~~  452 (1153)
T PLN03210        373 GFMELASEVALRAGNLPLGLNVLGSYLRGRDKEDWMDMLPRLRNGLDGKIEKTLRVSYDGLNNKKDKAIFRHIACLFNGE  452 (1153)
T ss_pred             HHHHHHHHHHHHhCCCcHHHHHHHHHHcCCCHHHHHHHHHHHHhCccHHHHHHHHHhhhccCccchhhhhheehhhcCCC
Confidence            8999999999999999999999999999999999999999988755433322                            


Q ss_pred             CHHHHHHHHhhCCCCHHHhHHHHhcccceEEeCCeEeecHHHHHHHHHHHhhhcccCCCCcccccccchhhHHhhcCcCC
Q 005085          177 DREHVMWILSDDYCSVQYAMNVLVNKSLIKISYNKLQMHDLLQEMGREIVCQEFREKPEKRSRLWDYKDVCHVLEKNKGT  256 (715)
Q Consensus       177 ~~~~l~~il~~~~~~~~~~l~~L~~~~ll~~~~~~~~mhdli~~l~~~i~~~~~~~~~~~~~~lw~~e~~~~~l~~~~~~  256 (715)
                      ..+.+..++..+++.....++.|+++||++.+.+.+.|||++|+||++++.++. .+++++.++|.+++++.++.+++++
T Consensus       453 ~~~~v~~~l~~~~~~~~~~l~~L~~ksLi~~~~~~~~MHdLl~~~~r~i~~~~~-~~~~~r~~l~~~~di~~vl~~~~g~  531 (1153)
T PLN03210        453 KVNDIKLLLANSDLDVNIGLKNLVDKSLIHVREDIVEMHSLLQEMGKEIVRAQS-NEPGEREFLVDAKDICDVLEDNTGT  531 (1153)
T ss_pred             CHHHHHHHHHhcCCCchhChHHHHhcCCEEEcCCeEEhhhHHHHHHHHHHHhhc-CCCCcceeEeCHHHHHHHHHhCccc
Confidence            445666777777778888899999999999998899999999999999999987 7899999999999999999999999


Q ss_pred             CceeEEEecCCCCcccccChhhhcCCCCccEEEEeecC---------cccc--ccCCccc---cc-------------cc
Q 005085          257 DAIKSIFLDLSKIEEINLDPRAFTNMSNVRLLKFYISG---------HFDV--SKMSSKV---HL-------------QQ  309 (715)
Q Consensus       257 ~~~~~~~l~l~~~~~~~l~~~~~~~l~~L~~L~l~~n~---------~~~~--~~l~~~l---~~-------------~~  309 (715)
                      +.++++++|.+......+.+.+|.+|++|+.|.+..+.         .++.  ..+|..+   .|             ..
T Consensus       532 ~~v~~i~l~~~~~~~~~i~~~aF~~m~~L~~L~~~~~~~~~~~~~~~~lp~~~~~lp~~Lr~L~~~~~~l~~lP~~f~~~  611 (1153)
T PLN03210        532 KKVLGITLDIDEIDELHIHENAFKGMRNLLFLKFYTKKWDQKKEVRWHLPEGFDYLPPKLRLLRWDKYPLRCMPSNFRPE  611 (1153)
T ss_pred             ceeeEEEeccCccceeeecHHHHhcCccccEEEEecccccccccceeecCcchhhcCcccEEEEecCCCCCCCCCcCCcc
Confidence            99999999999988888999999999999999996331         1111  2233222   11             26


Q ss_pred             cccEEEecCCCcccccccCCCCCCccEEeecCCCCCcccCCCCCCCcceEEEEecCCCCcccCchhhcccccceEeccCc
Q 005085          310 ESYRTQLSFKKVEQIWEGQKKAPKLKYVDLNHSTNLTRIPEPSETPNLERMNLRNCTGLAHIPSYVQNFNKLGNMIMAGC  389 (715)
Q Consensus       310 ~L~~L~L~~~~l~~lp~~~~~l~~L~~L~L~~n~~~~~~p~~~~l~~L~~L~L~~n~~l~~~p~~~~~l~~L~~L~L~~~  389 (715)
                      +|+.|+++++.++.+|.++..+++|+.|+|++|..++.+|.++.+++|++|+|++|..+..+|..++++++|+.|++++|
T Consensus       612 ~L~~L~L~~s~l~~L~~~~~~l~~Lk~L~Ls~~~~l~~ip~ls~l~~Le~L~L~~c~~L~~lp~si~~L~~L~~L~L~~c  691 (1153)
T PLN03210        612 NLVKLQMQGSKLEKLWDGVHSLTGLRNIDLRGSKNLKEIPDLSMATNLETLKLSDCSSLVELPSSIQYLNKLEDLDMSRC  691 (1153)
T ss_pred             CCcEEECcCccccccccccccCCCCCEEECCCCCCcCcCCccccCCcccEEEecCCCCccccchhhhccCCCCEEeCCCC
Confidence            89999999999999999999999999999999988899999999999999999999999999999999999999999999


Q ss_pred             ccccccCcccCCCcccE-EEcCCCCCCCcCCCCCCCCcEEeccCCCCcccCcccC-------------------------
Q 005085          390 ESLRCFPQNIHFISSIK-IDCYKCVNLKEFPRISGNVVELNLMCTPIEEVPLSIE-------------------------  443 (715)
Q Consensus       390 ~~~~~lp~~~~~l~~L~-L~l~~~~~l~~l~~~~~~L~~L~L~~n~l~~lp~~~~-------------------------  443 (715)
                      ..+..+|..+ ++++|+ |++++|..++.+|....+|+.|++++|.+..+|..+.                         
T Consensus       692 ~~L~~Lp~~i-~l~sL~~L~Lsgc~~L~~~p~~~~nL~~L~L~~n~i~~lP~~~~l~~L~~L~l~~~~~~~l~~~~~~l~  770 (1153)
T PLN03210        692 ENLEILPTGI-NLKSLYRLNLSGCSRLKSFPDISTNISWLDLDETAIEEFPSNLRLENLDELILCEMKSEKLWERVQPLT  770 (1153)
T ss_pred             CCcCccCCcC-CCCCCCEEeCCCCCCccccccccCCcCeeecCCCccccccccccccccccccccccchhhccccccccc
Confidence            9999999877 699999 9999999999999999999999999999988886431                         


Q ss_pred             -----CCCCCCEEEcccccccccccccccCCCCccEeecCCCcCCCccchhccCCcccccccccccccccccchhhcCCC
Q 005085          444 -----CLPNLEILEMSFCYSLKRLSTSICKLKYLSSLDLSYCINLESFPEILEKMELLEEINLEEASNIKELPSSIENLE  518 (715)
Q Consensus       444 -----~l~~L~~L~L~~n~~~~~lp~~~~~l~~L~~L~L~~n~~~~~~p~~~~~l~~L~~L~L~~n~~~~~lp~~l~~l~  518 (715)
                           ..++|+.|++++|...+.+|.+++++++|+.|++++|..++.+|... ++++|+.|++++|..+..+|..   .+
T Consensus       771 ~~~~~~~~sL~~L~Ls~n~~l~~lP~si~~L~~L~~L~Ls~C~~L~~LP~~~-~L~sL~~L~Ls~c~~L~~~p~~---~~  846 (1153)
T PLN03210        771 PLMTMLSPSLTRLFLSDIPSLVELPSSIQNLHKLEHLEIENCINLETLPTGI-NLESLESLDLSGCSRLRTFPDI---ST  846 (1153)
T ss_pred             hhhhhccccchheeCCCCCCccccChhhhCCCCCCEEECCCCCCcCeeCCCC-CccccCEEECCCCCcccccccc---cc
Confidence                 12467777777777777788888888888888888887777777654 5666666666666444444321   13


Q ss_pred             CCCEEEecCCCCCCC------CCCcCeEEecCcc-CCCCCCCCCCCCCCC-ceEE-------------------------
Q 005085          519 GLKQLKLTGCTKLGS------LPETKNWMHPYCK-HYPITRVKDYSSTSP-VQLI-------------------------  565 (715)
Q Consensus       519 ~L~~L~Ls~n~~~~~------lp~L~~L~l~~n~-L~~~~lp~~l~~l~~-~~L~-------------------------  565 (715)
                      +|+.|+|++|.+...      +++|+.|++++|+ |+.  +|..+..++. +.++                         
T Consensus       847 nL~~L~Ls~n~i~~iP~si~~l~~L~~L~L~~C~~L~~--l~~~~~~L~~L~~L~l~~C~~L~~~~l~~~~~~~~~~~~n  924 (1153)
T PLN03210        847 NISDLNLSRTGIEEVPWWIEKFSNLSFLDMNGCNNLQR--VSLNISKLKHLETVDFSDCGALTEASWNGSPSEVAMATDN  924 (1153)
T ss_pred             ccCEeECCCCCCccChHHHhcCCCCCEEECCCCCCcCc--cCcccccccCCCeeecCCCcccccccCCCCchhhhhhccc
Confidence            344444444433221      3444444444444 443  4443333333 3444                         


Q ss_pred             ------------ecCCCCCCHHHHHHHHHhHccceec---cCCcccccccCccce-eecccc----ccceeeEEEEeCC
Q 005085          566 ------------FANCLKLNESIWADLQQRIRHMIIA---SRRLFCEKNIGLSDG-AAVSFD----FFIRYQLVIVKGP  624 (715)
Q Consensus       566 ------------l~~c~~l~~~~~~~~~~~~~~~~lp---ip~~~~~~~~~~~l~-~~~~~~----~~~~~~~~~~~~~  624 (715)
                                  +.+|.+|...+....+.......+|   +|.||.|+..|.+++ +.++..    -+.+|++|++.+.
T Consensus       925 ~~~~~p~~~~l~f~nC~~L~~~a~l~~~~~~~~~~l~g~evp~~f~hr~~g~sl~~i~l~~~~~~~~~~~f~~c~v~~~ 1003 (1153)
T PLN03210        925 IHSKLPSTVCINFINCFNLDQEALLQQQSIFKQLILSGEEVPSYFTHRTTGASLTNIPLLHISPCQPFFRFRACAVVDS 1003 (1153)
T ss_pred             ccccCCchhccccccccCCCchhhhcccccceEEECCCccCchhccCCcccceeeeeccCCcccCCCccceEEEEEEec
Confidence                        4455555543321111112223567   999999999999998 776543    2678999987753

syringae 6; Provisional
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3903 Predicted ATPase [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>cd01133 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide-binding domain Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PF14516 AAA_35: AAA-like domain Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>COG3899 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09280 F0F1 ATP synthase subunit beta; Validated Back     alignment and domain information
>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>cd01135 V_A-ATPase_B V/A-type ATP synthase (non-catalytic) subunit B Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>PRK12597 F0F1 ATP synthase subunit beta; Provisional Back     alignment and domain information
>cd01132 F1_ATPase_alpha F1 ATP synthase alpha, central domain Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK12678 transcription termination factor Rho; Provisional Back     alignment and domain information
>CHL00059 atpA ATP synthase CF1 alpha subunit Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>TIGR01039 atpD ATP synthase, F1 beta subunit Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09281 F0F1 ATP synthase subunit alpha; Validated Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF00006 ATP-synt_ab: ATP synthase alpha/beta family, nucleotide-binding domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR000194 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1192 Soj ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03324 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit alpha Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF01656 CbiA: CobQ/CobB/MinD/ParA nucleotide binding domain; InterPro: IPR002586 This entry consists of various cobyrinic acid a,c-diamide synthases Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>PTZ00185 ATPase alpha subunit; Provisional Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00060 atpB ATP synthase CF1 beta subunit Back     alignment and domain information
>TIGR00962 atpA proton translocating ATP synthase, F1 alpha subunit Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>TIGR03305 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK08972 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PHA02518 ParA-like protein; Provisional Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13343 F0F1 ATP synthase subunit alpha; Provisional Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>TIGR01041 ATP_syn_B_arch ATP synthase archaeal, B subunit Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query715
4fcg_A328 Structure Of The Leucine-Rich Repeat Domain Of The 7e-06
>pdb|4FCG|A Chain A, Structure Of The Leucine-Rich Repeat Domain Of The Type Iii Effector Xcv3220 (Xopl) Length = 328 Back     alignment and structure 
Iteration: 1

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 70/185 (37%), Gaps = 15/185 (8%)
Query: 364 NCTGLAHIPSYVQNFNKLGNMIMAGCESLRCFPQNIHFISSIK-IDCYKCVNLKEFPR-- 420
           +  GL  +P   Q F  L  + +A    LR  P +I  ++ ++ +    C  L E P   
Sbjct: 112 DAAGLXELPDTXQQFAGLETLTLAR-NPLRALPASIASLNRLRELSIRACPELTELPEPL 170
Query: 421 ----ISG------NVVELNLMCTPIEEVPLSIECLPNLEILEMSFCYSLKRLSTSICXXX 470
                SG      N+  L L  T I  +P SI  L NL+ L++     L  L  +I    
Sbjct: 171 ASTDASGEHQGLVNLQSLRLEWTGIRSLPASIANLQNLKSLKIRNS-PLSALGPAIHHLP 229
Query: 471 XXXXXXXXXCINLESFPXXXXXXXXXXXXXXXXASNIKELPSSIENLEGLKQLKLTGCTK 530
                    C  L ++P                 SN+  LP  I  L  L++L L GC  
Sbjct: 230 KLEELDLRGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVN 289
Query: 531 LGSLP 535
           L  LP
Sbjct: 290 LSRLP 294

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query715
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-29
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-27
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-26
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-23
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-27
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-06
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 2e-15
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 1e-13
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-13
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-12
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-11
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-04
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-10
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 7e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-11
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-09
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-04
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-10
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-09
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-08
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-10
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-10
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-09
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-09
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-07
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 4e-09
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-08
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 4e-08
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-09
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-07
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-04
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-08
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-08
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 8e-06
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 2e-08
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-08
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 5e-08
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 6e-08
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 4e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-08
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-07
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 7e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 6e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 9e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-04
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-05
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-04
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 2e-04
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score =  117 bits (295), Expect = 5e-29
 Identities = 44/221 (19%), Positives = 80/221 (36%), Gaps = 21/221 (9%)

Query: 331 APKLKYVDLNHSTNLTRIPEPSETPNLERMNLRNCTGLAHIPSYVQNFNKLGNMIMAGCE 390
           +   + +    ST L    +       +R    +     H      N N    +      
Sbjct: 11  SSGRENLYFQGSTALRPYHD--VLSQWQRHYNADRNRW-HSAWRQANSNNP-QIETRTGR 66

Query: 391 SLRCFPQNIHFISSIK---IDCYKCVNLKEFPRISG---NVVELNLMCTPIEEVPLSIEC 444
           +L+     +   +      ++      L +FP  +    ++  + +    + E+P +++ 
Sbjct: 67  ALKATADLLEDATQPGRVALELRSV-PLPQFPDQAFRLSHLQHMTIDAAGLMELPDTMQQ 125

Query: 445 LPNLEILEMSFCYSLKRLSTSICKLKYLSSLDLSYCINLESFPEILEKMELLEEI----N 500
              LE L ++    L+ L  SI  L  L  L +  C  L   PE L   +   E     N
Sbjct: 126 FAGLETLTLARN-PLRALPASIASLNRLRELSIRACPELTELPEPLASTDASGEHQGLVN 184

Query: 501 LEE----ASNIKELPSSIENLEGLKQLKLTGCTKLGSLPET 537
           L+      + I+ LP+SI NL+ LK LK+     L +L   
Sbjct: 185 LQSLRLEWTGIRSLPASIANLQNLKSLKIRNS-PLSALGPA 224
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query715
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 99.96
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.96
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.96
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.95
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.95
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.95
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.95
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.95
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.94
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.94
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.94
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.94
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.94
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.94
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.94
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.94
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.93
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.93
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.93
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.93
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.93
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.93
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.93
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.93
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.93
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.93
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.93
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.93
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.93
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.93
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.92
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.92
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.92
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.92
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.92
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.92
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.92
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.91
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.91
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.91
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.9
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.9
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.9
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.89
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.89
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.89
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.88
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.88
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.88
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.88
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.88
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.88
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.88
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.87
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.87
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.87
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.86
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.86
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.85
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.85
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.85
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.84
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 99.84
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.84
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.84
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.83
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.83
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.83
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.83
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.82
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.82
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.82
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.82
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.81
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 99.8
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.8
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.79
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.79
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.78
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.78
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.78
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.78
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.77
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.77
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.77
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.76
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.75
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.75
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.74
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.73
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.72
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.71
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.71
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.71
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.7
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.69
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.69
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.67
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.67
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.67
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.66
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.65
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.65
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.64
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.63
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.62
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.62
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.61
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.59
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.58
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.57
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.56
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.56
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.56
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.55
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.55
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.53
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.53
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.53
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.51
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.51
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.49
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.48
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.44
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.43
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.4
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.39
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.38
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.37
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.35
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.32
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.3
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.29
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.28
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.27
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.26
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.22
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.2
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.18
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.15
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.03
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.98
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.92
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.92
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.88
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.81
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.77
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.77
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.6
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.5
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.47
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.28
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.2
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 98.13
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.11
2fna_A357 Conserved hypothetical protein; structural genomic 98.08
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.07
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 98.05
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 97.97
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.96
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.96
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.93
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.83
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.79
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 97.78
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.74
2v1u_A387 Cell division control protein 6 homolog; DNA repli 97.69
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 97.62
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.58
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.41
2chg_A226 Replication factor C small subunit; DNA-binding pr 97.35
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 97.32
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 96.89
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 96.59
3bos_A242 Putative DNA replication factor; P-loop containing 96.59
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 96.59
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 96.34
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 96.32
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 96.0
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 95.13
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.07
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 94.95
2chq_A319 Replication factor C small subunit; DNA-binding pr 94.82
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 94.8
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 94.79
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.53
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 94.18
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 93.82
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 93.78
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 93.55
3pvs_A447 Replication-associated recombination protein A; ma 93.41
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 93.39
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 93.31
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 93.24
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 93.08
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 92.72
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 92.71
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 92.47
2qgz_A308 Helicase loader, putative primosome component; str 92.4
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 92.18
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 91.81
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 91.8
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 91.57
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 91.48
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 90.68
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 90.44
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 90.31
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 89.6
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 89.34
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 89.3
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 88.82
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 88.21
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 87.64
3vr4_D465 V-type sodium ATPase subunit D; V-ATPase, rotary m 85.88
3l0o_A427 Transcription termination factor RHO; helicase, RH 85.83
1sky_E473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 85.81
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 85.67
2cvh_A220 DNA repair and recombination protein RADB; filamen 85.28
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 85.25
3ice_A422 Transcription termination factor RHO; transcriptio 84.67
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 84.04
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 83.93
2ck3_D482 ATP synthase subunit beta\, mitochondrial; hydrola 83.28
2qe7_A502 ATP synthase subunit alpha; blockage of ATP hydrol 83.24
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 82.52
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 81.77
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 81.64
2ck3_A510 ATP synthase subunit alpha\, mitochondrial; hydrol 81.5
2z43_A324 DNA repair and recombination protein RADA; archaea 80.94
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 80.34
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
Probab=99.96  E-value=2.2e-28  Score=275.18  Aligned_cols=223  Identities=16%  Similarity=0.169  Sum_probs=168.2

Q ss_pred             CCCCcHHHHH-HHHH----HhhccCCceEEEEecchhhhcCCcHHHHHHHHHHHHhCCCC--CCCCC------cchHHHH
Q 005085            1 MGGIGKTTIG-VVFN----QFSQKFEGKYFMANVREESEKCGVLVHLRNQVLSKVLGENF--DIGTQ------KIPQYIR   67 (715)
Q Consensus         1 mgGiGKTTLa-~vy~----~~~~~F~~~~wv~~v~~~~~~~~~~~~l~~~i~~~~~~~~~--~~~~~------~~~~~l~   67 (715)
                      |||||||||| ++|+    +++.+|+.++||+ +++.+. .+ +.+++++|+.+++....  ...+.      .+...++
T Consensus       160 ~gGvGKTtLA~~v~~~~~~~~~~~F~~~~wv~-vs~~~~-~~-~~~~~~~il~~l~~~~~~~~~~~~~~~~~~~l~~~l~  236 (549)
T 2a5y_B          160 RAGSGKSVIASQALSKSDQLIGINYDSIVWLK-DSGTAP-KS-TFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMIC  236 (549)
T ss_dssp             STTSSHHHHHHHHHHHCSSTBTTTBSEEEEEE-CCCCST-TH-HHHHHHHHHHHHTTTSCCTTCCCCTTCCHHHHHHHHH
T ss_pred             CCCCCHHHHHHHHHHhhhHHHhccCCcEEEEE-ECCCCC-CC-HHHHHHHHHHHHhcCcccccccccccccHHHHHHHHH
Confidence            8999999999 9996    6899999999997 776542 34 78899999999876532  12111      3578999


Q ss_pred             HHhcCC-eEEEEEeCcc-------------------CChHHHHHhC-cCcEEEcCCCCHHHHHHHHHhhhcCCCCCChhH
Q 005085           68 DRLQRM-KVFIVLDDVN-------------------KDKTILERYG-TQRIYEVEGLNCNEVLRLFSSCAFKENHCPEDL  126 (715)
Q Consensus        68 ~~L~~k-r~LlVLDDv~-------------------r~~~v~~~~~-~~~~~~l~~L~~~es~~LF~~~af~~~~~~~~~  126 (715)
                      +.|++| ||||||||||                   |++.|+..++ ...+|+|++|+.+|||+||.++||+... ++++
T Consensus       237 ~~L~~~kr~LlVLDdv~~~~~~~~~~~~gs~ilvTTR~~~v~~~~~~~~~~~~l~~L~~~ea~~Lf~~~a~~~~~-~~~~  315 (549)
T 2a5y_B          237 NALIDRPNTLFVFDDVVQEETIRWAQELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMPV-GEKE  315 (549)
T ss_dssp             HHHTTSTTEEEEEEEECCHHHHHHHHHTTCEEEEEESBGGGGGGCCSCEEEEECCCCCHHHHHHHHHHTSCCCC---CHH
T ss_pred             HHHcCCCcEEEEEECCCCchhhcccccCCCEEEEEcCCHHHHHHcCCCCeEEECCCCCHHHHHHHHHHHhcCCCC-chhH
Confidence            999996 9999999999                   7777777775 4468999999999999999999987643 4678


Q ss_pred             HHHHHHHHHHhCCCcchhHHhhhcccCCChhHHHHHHHH-hhccCCCCCcC-----------------------------
Q 005085          127 LKHSETAVHYAKGNPLALQVLGSSFYGKSKPDWVNALNN-LKRISGSDIYD-----------------------------  176 (715)
Q Consensus       127 ~~~~~~i~~~c~glPLai~~~g~~L~~k~~~~w~~~l~~-l~~~~~~~i~~-----------------------------  176 (715)
                      ++++++|+++|+|+||||+++|+.|+.++ .+|...+.. +.......+..                             
T Consensus       316 ~~~~~~I~~~c~GlPLAl~~~g~~l~~~~-w~~~~~l~~~l~~~~~~~i~~~l~~Sy~~L~~~lk~~f~~Ls~~er~l~~  394 (549)
T 2a5y_B          316 EDVLNKTIELSSGNPATLMMFFKSCEPKT-FEKMAQLNNKLESRGLVGVECITPYSYKSLAMALQRCVEVLSDEDRSALA  394 (549)
T ss_dssp             HHHHHHHHHHHTTCHHHHHHHHTTCCSSS-HHHHHHHHHHHHHHCSSTTCCCSSSSSSSHHHHHHHHHHTSCHHHHHHTT
T ss_pred             HHHHHHHHHHhCCChHHHHHHHHHhccch-HHHHHHhHHHhhcccHHHHHHHHhcccccccHHHHHHHhccchhhhhHhh
Confidence            89999999999999999999999998774 233333322 21111111111                             


Q ss_pred             ---------CHHHHHHHHhhC--CCCH-----------HHhHHHHhcccceEEe----CCeEeecHHHHHHHHHHHhhhc
Q 005085          177 ---------DREHVMWILSDD--YCSV-----------QYAMNVLVNKSLIKIS----YNKLQMHDLLQEMGREIVCQEF  230 (715)
Q Consensus       177 ---------~~~~l~~il~~~--~~~~-----------~~~l~~L~~~~ll~~~----~~~~~mhdli~~l~~~i~~~~~  230 (715)
                               ...  +++|.++  |+..           ..++++|+++||++..    ...|+|||++|++|++++.+++
T Consensus       395 ~ls~fp~~~~i~--i~~w~a~~~G~i~~~~~~~~~~~~~~~l~~L~~rsLl~~~~~~~~~~~~mHdlv~~~a~~~~~~~~  472 (549)
T 2a5y_B          395 FAVVMPPGVDIP--VKLWSCVIPVDICSNEEEQLDDEVADRLKRLSKRGALLSGKRMPVLTFKIDHIIHMFLKHVVDAQT  472 (549)
T ss_dssp             GGGSSCTTCCEE--HHHHHHHSCC-------CCCTHHHHHHHHHTTTBSSCSEEECSSSCEEECCHHHHHHHHTTSCTHH
T ss_pred             heeeeCCCCeee--eeeeeeeccceeccCCCCCCHHHHHHHHHHHHHcCCeeEecCCCceEEEeChHHHHHHHHHHHHHH
Confidence                     111  5677777  5432           2379999999999987    2479999999999998887765
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3vr4_D V-type sodium ATPase subunit D; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_D* 3vr2_D* 3vr5_D 3vr6_D* Back     alignment and structure
>3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... Back     alignment and structure
>2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 715
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 4e-18
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.004
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

 Score = 82.9 bits (204), Expect = 4e-18
 Identities = 32/227 (14%), Positives = 56/227 (24%), Gaps = 39/227 (17%)

Query: 1   MGGIGKTTIG-VVFN---QFSQKFEGKYFMANVREESEKCGVLVHLRNQVLSKVLGENFD 56
             G GK+ I     +   Q                 + K    +     ++ K   +  +
Sbjct: 52  RAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKSTFDLFTDILLMLKSEDDLLN 111

Query: 57  IGTQKIP-------QYIRDRLQRMKVFIVLDDVNKDKTILERY----------------- 92
             + +               + R     V DDV +++TI                     
Sbjct: 112 FPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETIRWAQELRLRCLVTTRDVEISN 171

Query: 93  ---GTQRIYEVEGLNCNEVLRLFSSCAFKENHCPEDLLKHSETAVHYAKGNPLALQVLGS 149
               T    EV  L  +E      +         E         +  + GNP  L +   
Sbjct: 172 AASQTCEFIEVTSLEIDECYDFLEAYGMPM-PVGEKEEDVLNKTIELSSGNPATLMMFFK 230

Query: 150 SFYGKSKPDWVNALNNLKRISGSDIYDDREHVMWILSDDYCSVQYAM 196
           S   K+        N L+      +         I    Y S+  A+
Sbjct: 231 SCEPKTFEKMAQLNNKLESRGLVGV-------ECITPYSYKSLAMAL 270
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query715
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 99.96
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.88
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.86
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.84
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.84
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.81
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.8
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.78
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.77
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.75
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.72
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.66
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.63
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.61
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.59
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.57
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.55
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.54
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.52
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.51
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.48
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.44
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.43
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.41
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.34
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.32
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.32
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.25
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.25
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.18
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.16
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.13
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.06
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.02
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.96
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.95
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.65
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.96
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 97.75
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.7
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.05
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 96.89
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 96.78
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.77
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 96.18
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.9
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 95.82
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.81
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 95.61
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 95.29
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 95.05
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 94.91
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 94.9
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 94.54
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 94.36
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 93.85
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 93.68
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 93.55
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 93.42
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 91.96
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 91.92
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 90.43
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 90.32
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 90.22
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 90.19
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 89.98
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 89.44
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 88.98
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 88.84
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 88.76
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 88.04
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 87.61
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 87.21
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 87.15
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 86.96
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 85.35
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 85.28
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 84.89
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 84.87
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 84.85
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 84.63
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 84.35
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 83.2
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 83.2
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 82.7
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 82.61
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 82.37
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 82.23
d1xpua3289 Transcription termination factor Rho, ATPase domai 81.65
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 81.63
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 81.17
d2qy9a2211 GTPase domain of the signal recognition particle r 81.04
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 81.03
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 80.84
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 80.75
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 80.11
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 80.07
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

Probab=99.96  E-value=6.2e-29  Score=251.48  Aligned_cols=188  Identities=16%  Similarity=0.181  Sum_probs=146.2

Q ss_pred             CCCCcHHHHH-HHHHH----hhccCCceEEEEecchhhhcCCcHHHHHHHHHHHHhCCCC-CCC----CC---cchHHHH
Q 005085            1 MGGIGKTTIG-VVFNQ----FSQKFEGKYFMANVREESEKCGVLVHLRNQVLSKVLGENF-DIG----TQ---KIPQYIR   67 (715)
Q Consensus         1 mgGiGKTTLa-~vy~~----~~~~F~~~~wv~~v~~~~~~~~~~~~l~~~i~~~~~~~~~-~~~----~~---~~~~~l~   67 (715)
                      |||||||||| ++|++    +..+|++++||+ +++.+.... +...+..+...+..... +..    ..   .....++
T Consensus        52 mgGiGKTtLA~~v~~~~~~~~~~~f~~~~Wv~-vs~~~~~~~-l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  129 (277)
T d2a5yb3          52 RAGSGKSVIASQALSKSDQLIGINYDSIVWLK-DSGTAPKST-FDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICN  129 (277)
T ss_dssp             STTSSHHHHHHHHHHHCSSTBTTTBSEEEEEE-CCCCSTTHH-HHHHHHHHHHHTTTSCCTTCCCCTTCCHHHHHHHHHH
T ss_pred             CCCCCHHHHHHHHHHhhhhhhhhcCceEEEEE-ecCCCCHHH-HHHHHHHHHHHhcchhhcCCccchhhhhHHHHHHHHH
Confidence            8999999999 99986    566799999998 666554333 33334444444333221 111    11   2334577


Q ss_pred             HHhcCCeEEEEEeCcc-------------------CChHHHHHhCcC-cEEEcCCCCHHHHHHHHHhhhcCCCCCChhHH
Q 005085           68 DRLQRMKVFIVLDDVN-------------------KDKTILERYGTQ-RIYEVEGLNCNEVLRLFSSCAFKENHCPEDLL  127 (715)
Q Consensus        68 ~~L~~kr~LlVLDDv~-------------------r~~~v~~~~~~~-~~~~l~~L~~~es~~LF~~~af~~~~~~~~~~  127 (715)
                      +.|.+||+|+||||||                   |++.|+..+... +.|+|++|+.+|||+||++++|....++ ..+
T Consensus       130 ~~L~~kr~LlVLDDv~~~~~~~~~~~~~srilvTTR~~~v~~~~~~~~~~~~l~~L~~~ea~~Lf~~~~~~~~~~~-~~~  208 (277)
T d2a5yb3         130 ALIDRPNTLFVFDDVVQEETIRWAQELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGMPMPVGE-KEE  208 (277)
T ss_dssp             HHTTSTTEEEEEEEECCHHHHHHHHHTTCEEEEEESBGGGGGGCCSCEEEEECCCCCHHHHHHHHHHTSCCCC--C-HHH
T ss_pred             HHhccCCeeEecchhhHHhhhhhhcccCceEEEEeehHHHHHhcCCCCceEECCCCCHHHHHHHHHHHhCCccCch-hhH
Confidence            8889999999999999                   889998877654 7899999999999999999999765443 468


Q ss_pred             HHHHHHHHHhCCCcchhHHhhhcccCCChhHHHHHHHHhhccCCCCCcCCHHHHHHHHhhCCCCHHHhHHH
Q 005085          128 KHSETAVHYAKGNPLALQVLGSSFYGKSKPDWVNALNNLKRISGSDIYDDREHVMWILSDDYCSVQYAMNV  198 (715)
Q Consensus       128 ~~~~~i~~~c~glPLai~~~g~~L~~k~~~~w~~~l~~l~~~~~~~i~~~~~~l~~il~~~~~~~~~~l~~  198 (715)
                      +++++|+++|+|+||||+++|+.|+.++.++|.+..+.|......       .+..++..||..+|.+++.
T Consensus       209 ~~~~~iv~~c~GlPLAl~~ig~~l~~k~~~~~~~~~~~L~~~~~~-------~v~~il~~sY~~L~~~lk~  272 (277)
T d2a5yb3         209 DVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLESRGLV-------GVECITPYSYKSLAMALQR  272 (277)
T ss_dssp             HHHHHHHHHHTTCHHHHHHHHTTCCSSSHHHHHHHHHHHHHHCSS-------TTCCCSSSSSSSHHHHHHH
T ss_pred             HHHHHHHHHhCCCHHHHHHHHHHhccCCHHHHHHHHHHHhcCcHH-------HHHHHHHHHHhcccHHHHH
Confidence            999999999999999999999999999999999999888764333       3556888999999999993
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure