Citrus Sinensis ID: 005168


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710
MLNLSGNSFNNTILSSLTHLSSLRSLNLNGNSLEGSIDVKEFDSLRDLEELDIGENKIDKFVVSKELYLDDTGFKGTLDIREFDSFNNLEVLDMSYNKIDNLVVPQELRLSDNHFRIPISLEPLFNHSRLKIFHAKNNQMNAEITESHSLTAPNFQLQSLSLSSSYGDGVTFPKFLYHQHDLEYVRLSHIKMNGEFPNWLLENNTKLATLFLVNDSLAGPFWLPIHSHKRLGILDISNNNIRGHIPVEIGDVLPSLYVFNISMNALDGSIPSSFGNMKFLQLLDLSNNQLTGEIPEHLAVGCVNLQFLMLSNNSLKEGLYLTNNSLSGNIPGWLGNLTWLIHIIMPENHLEGPIPVEFCQLYSLQILDISDNNISGSLPSCFHPLSIEQVHLSKNMLHRQLKRDLSYNLLNGSIPDWIGELSQLSHLILGHNNLEGEVPVQLCELNQLQLLDLSNNSLHGSIPPCFDNTTLYESYNNSSSLDEKFEISFFIEGPQGDFTTKNIAYIYQGKVLSLLSGLYLSCNKLIGHIPPQIGNLTRIQTLNLSYNNLTGLIPSTFSNLKHIESLDLSYNKLNGKIPHQLVELKTLEVFSVAYNNLSGEILEWTAQFATFNKSSYEGNTFLCGLPLPICRSPATMSEASIGNERDDNLIDMDSFFITFTTSYVIVIFAIVIILYVNSYWRRRWFYFVEMWITTCYYFVVDNLIPTRFCH
cEEccccccccccHHHHHccccccEEEcccccccccccHHHHcccccccEEEcccccccccccccEEEcccccccccccHHcccccccccEEEcccccccccccccEEEccccccEEEcccccccccccccEEEccccccEEEcccccccccccccccEEEccccccccccccccccccccccEEEccccccEEEcccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHHccccccEEEcccccccccccccccccccccEEEcccccccccccccHHcccccccEEEccccccccEEEccccccEEccccccccccccccEEcccccccccccccccccccccEEEccccccEEEcccccccccccEEEccccccccccccccccccccccccHHHHccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHHccccccccccccccccccccEEEEccEEEEEEEcEEEEEcccccccccEEEccccccccccHHHHHccccccccccccccccccccccccccccccEEccccccccccccHHHHcccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEHHHHHHHHHHHEEEHHHHccccHHHHHHHHHHHHHEEEEEEEEEEEEcccccc
ccccccccccccccHHHccccccEEEEcccccccccccHHHHcccccccEEEccccccccccccHEEEcccccccccccHHHHccccccEEEEccccccccccccHEEEcccccccccccHHHHccccccEEEEEccccccccccHHHccccccccccEEEEcccccccccccHHHccccccEEEEEccccccccccHHHHHccccccEEEEccccccccccHHHccccccEEEEcccccccccccHHHHHHHHHccEEEcccccccccccHHHccccccEEEEcccccccccccHHHHHHcHcccEEEcccccccEEEEcccccccccccHHHccccccEEEEEccccccccccHHHccccccEEEEcccccccccccHHHccccEEEEEEcccccccccccccccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHcccccccEEEccccccccccccccccEEEcccccccccccHHHccccccEEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc
mlnlsgnsfnNTILSSLTHLSSlrslnlngnslegsidvkefdslrdleeldigenkidKFVVskelylddtgfkgtldirefdsfnnlevldmsynkidnlvvpqelrlsdnhfripisleplfnhsrLKIFHAknnqmnaeiteshsltapnfqlqslslsssygdgvtfpkflyhqhdleYVRLSHIKmngefpnwllennTKLATLFLVNdslagpfwlpihshkrlgildisnnnirghipveigdvlpsLYVFNIsmnaldgsipssfgnmkFLQLLDlsnnqltgeipehlaVGCVNLQFLMLSNnslkeglyltnnslsgnipgwlgnLTWLIHIImpenhlegpipvefcqlyslqildisdnnisgslpscfhplsieQVHLSKNMLHRQLKRDLsynllngsipdWIGELSQLSHLILghnnlegevpvQLCElnqlqlldlsnnslhgsippcfdnttlyesynnsssldekfeisffiegpqgdfttknIAYIYQGKVLSLLSGLYLSCNKlighippqignltRIQTLNLSynnltglipstfsnlkhiESLDLSYnklngkiphqlVELKTLEVFSVAYNNLSGEILEWTAQFATfnkssyegntflcglplpicrspatmseasignerddnlidmdsFFITFTTSYVIVIFAIVIILYVNSYWRRRWFYFVEMWITTCYYFVVdnliptrfch
MLNLSGNSFNNTILSSLTHLSSLRSLNLNGNSLEGSIDVKEFDSLRDleeldigenkidkfvvskelylddtgfkgtldiREFDSFNNLEVLDMSYNKIDNLVVPQELRLSDNHFRIPISLEPLFNHSRLKIFHAKNNQMNAEITESHSLTAPNFQLQSLSLSSSYGDGVTFPKFLYHQHDLEYVRLSHIKMNGEFPNWLLENNTKLATLFLVNDSLAGPFWLPIHSHKRLGILDISNNNIRGHIPVEIGDVLPSLYVFNISMNALDGSIPSSFGNMKFLQLLDLSNNQLTGEIPEHLAVGCVNLQFLMLSNNSLKEGLYLTNNSLSGNIPGWLGNLTWLIHIIMPENHLEGPIPVEFCQLYSLQILDISDNNISGSLPSCFHPLSIEQVHLSKNMLHRQLKRDLSYNLLNGSIPDWIGELSQLSHLILGHNNLEGEVPVQLCELNQLQLLDLSNNSLHGSIPPCFDNTTLYESYNNSSSLDEKFEISFFIEGPQGDFTTKNIAYIYQGKVLSLLSGLYLSCNKLIGHIPPQIGNLTRIQTLNLSYNNLTGLIPSTFSNLKHIESLDLSYNKLNGKIPHQLVELKTLEVFSVAYNNLSGEILEWTAQFATFNKSSYEGNTFLCGLPLPICRSPATMSEASIGNERDDNLIDMDSFFITFTTSYVIVIFAIVIILYVNSYWRRRWFYFVEMWITTCYYFVVDNLIPTRFCH
MLNLSGNSFnntilsslthlsslrslnlngnslegsiDVKEFDSLRDLEELDIGENKIDKFVVSKELYLDDTGFKGTLDIREFDSFNNLEVLDMSYNKIDNLVVPQELRLSDNHFRIPISLEPLFNHSRLKIFHAKNNQMNAEITESHSLTAPNFqlqslslsssYGDGVTFPKFLYHQHDLEYVRLSHIKMNGEFPNWLLENNTKLATLFLVNDSLAGPFWLPIHSHKRLGILDISNNNIRGHIPVEIGDVLPSLYVFNISMNALDGSIPSSFGNMKFLQLLDLSNNQLTGEIPEHLAVGCVNLQFLMLSNNSLKEGLYLTNNSLSGNIPGWLGNLTWLIHIIMPENHLEGPIPVEFCQLYSLQILDISDNNISGSLPSCFHPLSIEQVHLSKNMLHRQLKRDLSYNLLNGSIPDWIGELSQLSHLILGHNNLEGEVPVqlcelnqlqlldlsnnslHGSIPPCFDNTTLYESYNNSSSLDEKFEISFFIEGPQGDFTTKNIAYIYQGKVLSLLSGLYLSCNKLIGHIPPQIGNLTRIQTLNLSYNNLTGLIPSTFSNLKHIESLDLSYNKLNGKIPHQLVELKTLEVFSVAYNNLSGEILEWTAQFATFNKSSYEGNTFLCGLPLPICRSPATMSEASIGNERDDNLIDMDSFFITFTTSYVIVIFAIVIILYVNSYWRRRWFYFVEMWITTCYYFVVDNLIPTRFCH
***********************************SIDVKEFDSLRDLEELDIGENKIDKFVVSKELYLDDTGFKGTLDIREFDSFNNLEVLDMSYNKIDNLVVPQELRLSDNHFRIPISLEPLFNHSRLKIFHAKN*******************L*SLSLSSSYGDGVTFPKFLYHQHDLEYVRLSHIKMNGEFPNWLLENNTKLATLFLVNDSLAGPFWLPIHSHKRLGILDISNNNIRGHIPVEIGDVLPSLYVFNISMNALDGSIPSSFGNMKFLQLLDLSNNQLTGEIPEHLAVGCVNLQFLMLSNNSLKEGLYLTNNSLSGNIPGWLGNLTWLIHIIMPENHLEGPIPVEFCQLYSLQILDISDNNISGSLPSCFHPLSIEQVHLSKNMLHRQLKRDLSYNLLNGSIPDWIGELSQLSHLILGHNNLEGEVPVQLCELNQLQLLDLSNNSLHGSIPPCFDNTTLYESYNNSSSLDEKFEISFFIEGPQGDFTTKNIAYIYQGKVLSLLSGLYLSCNKLIGHIPPQIGNLTRIQTLNLSYNNLTGLIPSTFSNLKHIESLDLSYNKLNGKIPHQLVELKTLEVFSVAYNNLSGEILEWTAQFATFNKSSYEGNTFLCGLPLPICRSP************DDNLIDMDSFFITFTTSYVIVIFAIVIILYVNSYWRRRWFYFVEMWITTCYYFVVDNLIPTRFC*
MLNLSGNSFNNTILSSLTHLSSLRSLNLNGNSLEGSIDVKEFDSLRDLEELDIGENKIDKFVVSKELYLDDTGFKGTLDIREFDSFNNLEVLDMSYNKIDNLVVPQELRLSDNHFRIPISLEPLFNHSRLKIFHAKNNQMNAEITESHSLTAPNFQLQSLSLSSSYGDGVTFPKFLYHQHDLEYVRLSHIKMNGEFPNWLLENNTKLATLFLVNDSLAGPFWLPIHSHKRLGILDISNNNIRGHIPVEIGDVLPSLYVFNISMNALDGSIPSSFGNMKFLQLLDLSNNQLTGEIPEHLAVGCVNLQFLMLSNNSLKEGLYLTNNSLSGNIPGWLGNLTWLIHIIMPENHLEGPIPVEFCQLYSLQILDISDNNISGSLPSCFHPLSIEQVHLSKNMLHRQLKRDLSYNLLNGSIPDWIGELSQLSHLILGHNNLEGEVPVQLCELNQLQLLDLSNNSLHGSIPPCFDNTTLYE************EISFFIEGPQGDFTTKNIAYIYQGKVLSLLSGLYLSCNKLIGHIPPQIGNLTRIQTLNLSYNNLTGLIPSTFSNLKHIESLDLSYNKLNGKIPHQLVELKTLEVFSVAYNNLSGEILEWTAQFATFNKSSYEGNTFLCG****************************DSFFITFTTSYVIVIFAIVIILYVNSYWRRRWFYFVEMWITTCYYFVVDNLIPTRFC*
MLNLSGNSFNNTILSSLTHLSSLRSLNLNGNSLEGSIDVKEFDSLRDLEELDIGENKIDKFVVSKELYLDDTGFKGTLDIREFDSFNNLEVLDMSYNKIDNLVVPQELRLSDNHFRIPISLEPLFNHSRLKIFHAKNNQMNAEITESHSLTAPNFQLQSLSLSSSYGDGVTFPKFLYHQHDLEYVRLSHIKMNGEFPNWLLENNTKLATLFLVNDSLAGPFWLPIHSHKRLGILDISNNNIRGHIPVEIGDVLPSLYVFNISMNALDGSIPSSFGNMKFLQLLDLSNNQLTGEIPEHLAVGCVNLQFLMLSNNSLKEGLYLTNNSLSGNIPGWLGNLTWLIHIIMPENHLEGPIPVEFCQLYSLQILDISDNNISGSLPSCFHPLSIEQVHLSKNMLHRQLKRDLSYNLLNGSIPDWIGELSQLSHLILGHNNLEGEVPVQLCELNQLQLLDLSNNSLHGSIPPCFDNTTLYESYNNSSSLDEKFEISFFIEGPQGDFTTKNIAYIYQGKVLSLLSGLYLSCNKLIGHIPPQIGNLTRIQTLNLSYNNLTGLIPSTFSNLKHIESLDLSYNKLNGKIPHQLVELKTLEVFSVAYNNLSGEILEWTAQFATFNKSSYEGNTFLCGLPLPICRSPATMSEASIGNERDDNLIDMDSFFITFTTSYVIVIFAIVIILYVNSYWRRRWFYFVEMWITTCYYFVVDNLIPTRFCH
MLNLSGNSFNNTILSSLTHLSSLRSLNLNGNSLEGSIDVKEFDSLRDLEELDIGENKIDKFVVSKELYLDDTGFKGTLDIREFDSFNNLEVLDMSYNKIDNLVVPQELRLSDNHFRIPISLEPLFNHSRLKIFHAKNNQMNAEITESHSLTAPNFQLQSLSLSSSYGDGVTFPKFLYHQHDLEYVRLSHIKMNGEFPNWLLENNTKLATLFLVNDSLAGPFWLPIHSHKRLGILDISNNNIRGHIPVEIGDVLPSLYVFNISMNALDGSIPSSFGNMKFLQLLDLSNNQLTGEIPEHLAVGCVNLQFLMLSNNSLKEGLYLTNNSLSGNIPGWLGNLTWLIHIIMPENHLEGPIPVEFCQLYSLQILDISDNNISGSLPSCFHPLSIEQVHLSKNMLHRQLKRDLSYNLLNGSIPDWIGELSQLSHLILGHNNLEGEVPVQLCELNQLQLLDLSNNSLHGSIPPCFDNTTLYESYNNSSSLDEKFEISFFIEGPQGDFTTKNIAYIYQGKVLSLLSGLYLSCNKLIGHIPPQIGNLTRIQTLNLSYNNLTGLIPSTFSNLKHIESLDLSYNKLNGKIPHQLVELKTLEVFSVAYNNLSGEILEWTAQFATFNKSSYEGNTFLCGLPLPICRSPATMSEASIGNERDDNLIDMDSFFITFTTSYVIVIFAIVIILYVNSYWRRRWFYFVEMWITTCYYFVVDNLIPTRFCH
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHoooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLNLSGNSFNNTILSSLTHLSSLRSLNLNGNSLEGSIDVKEFDSLRDLEELDIGENKIDKFVVSKELYLDDTGFKGTLDIREFDSFNNLEVLDMSYNKIDNLVVPQELRLSDNHFRIPISLEPLFNHSRLKIFHAKNNQMNAEITESHSLTAPNFQLQSLSLSSSYGDGVTFPKFLYHQHDLEYVRLSHIKMNGEFPNWLLENNTKLATLFLVNDSLAGPFWLPIHSHKRLGILDISNNNIRGHIPVEIGDVLPSLYVFNISMNALDGSIPSSFGNMKFLQLLDLSNNQLTGEIPEHLAVGCVNLQFLMLSNNSLKEGLYLTNNSLSGNIPGWLGNLTWLIHIIMPENHLEGPIPVEFCQLYSLQILDISDNNISGSLPSCFHPLSIEQVHLSKNMLHRQLKRDLSYNLLNGSIPDWIGELSQLSHLILGHNNLEGEVPVQLCELNQLQLLDLSNNSLHGSIPPCFDNTTLYESYNNSSSLDEKFEISFFIEGPQGDFTTKNIAYIYQGKVLSLLSGLYLSCNKLIGHIPPQIGNLTRIQTLNLSYNNLTGLIPSTFSNLKHIESLDLSYNKLNGKIPHQLVELKTLEVFSVAYNNLSGEILEWTAQFATFNKSSYEGNTFLCGLPLPICRSPATMSEASIGNERDDNLIDMDSFFITFTTSYVIVIFAIVIILYVNSYWRRRWFYFVEMWITTCYYFVVDNLIPTRFCH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query710 2.2.26 [Sep-21-2011]
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.852 0.483 0.318 3e-59
C0LGQ5 1249 LRR receptor-like serine/ no no 0.904 0.514 0.309 8e-59
Q9ZPS9 1143 Serine/threonine-protein no no 0.885 0.550 0.292 2e-50
Q8L899 1207 Systemin receptor SR160 O N/A no 0.877 0.516 0.290 1e-49
Q8GUQ5 1207 Brassinosteroid LRR recep N/A no 0.877 0.516 0.290 2e-49
Q9FL28 1173 LRR receptor-like serine/ no no 0.814 0.492 0.311 5e-48
Q9LYN8 1192 Leucine-rich repeat recep no no 0.867 0.516 0.290 1e-47
Q9ZWC8 1166 Serine/threonine-protein no no 0.805 0.490 0.297 6e-47
Q9LVP0 1102 Probable leucine-rich rep no no 0.888 0.572 0.300 3e-46
Q9LJF3 1164 Receptor-like protein kin no no 0.945 0.576 0.287 4e-46
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function desciption
 Score =  230 bits (586), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 222/698 (31%), Positives = 338/698 (48%), Gaps = 93/698 (13%)

Query: 2   LNLSGNSFNNTILSSLTHLSSLRSLNLNGNSLEGSIDVKEFDSLRDLEELDIGENKID-- 59
           LNL GN     I   LT L++L++L+L+ N+L G I  +EF  +  LE L + +N++   
Sbjct: 269 LNLIGNQLQGLIPKRLTELANLQTLDLSSNNLTGVIH-EEFWRMNQLEFLVLAKNRLSGS 327

Query: 60  --KFVVS-----KELYLDDTGFKGTLDIREFDSFNNLEVLDMSYNKIDNLVVPQELRLSD 112
             K + S     K+L+L +T   G +   E  +  +L++LD+S N +             
Sbjct: 328 LPKTICSNNTSLKQLFLSETQLSGEIPA-EISNCQSLKLLDLSNNTLTG----------- 375

Query: 113 NHFRIPISLEPLFNHSRLKIFHAKNNQMNAEITESHS-LTAPNFQLQSLSLSSSYGDGVT 171
              +IP SL   F    L   +  NN +   ++ S S LT     LQ  +L  +  +G  
Sbjct: 376 ---QIPDSL---FQLVELTNLYLNNNSLEGTLSSSISNLT----NLQEFTLYHNNLEG-K 424

Query: 172 FPKFLYHQHDLEYVRLSHIKMNGEFPNWLLENNTKLATLFLVNDSLAGPFWLPIHSHKRL 231
            PK +     LE + L   + +GE P   + N T+L  +    + L+G     I   K L
Sbjct: 425 VPKEIGFLGKLEIMYLYENRFSGEMP-VEIGNCTRLQEIDWYGNRLSGEIPSSIGRLKDL 483

Query: 232 GILDISNNNIRGHIPVEIGDVLPSLYVFNISMNALDGSIPSSFGNMKFLQLLDLSNNQLT 291
             L +  N + G+IP  +G+    + V +++ N L GSIPSSFG +  L+L  + NN L 
Sbjct: 484 TRLHLRENELVGNIPASLGNC-HQMTVIDLADNQLSGSIPSSFGFLTALELFMIYNNSLQ 542

Query: 292 GEIPEHLAVGCVNLQFLMLSNNSLKEGL--------YL----TNNSLSGNIPGWLGNLTW 339
           G +P+ L +   NL  +  S+N     +        YL    T N   G+IP  LG  T 
Sbjct: 543 GNLPDSL-INLKNLTRINFSSNKFNGSISPLCGSSSYLSFDVTENGFEGDIPLELGKSTN 601

Query: 340 LIHIIMPENHLEGPIPVEFCQLYSLQILDISDNNISGSLPSCFHPLSIEQVHLSKNMLHR 399
           L  + + +N   G IP  F ++  L +LDIS N++SG +P         ++ L K + H 
Sbjct: 602 LDRLRLGKNQFTGRIPRTFGKISELSLLDISRNSLSGIIPV--------ELGLCKKLTHI 653

Query: 400 QLKRDLSYNLLNGSIPDWIGELSQLSHLILGHNNLEGEVPVQLCELNQLQLLDLSNNSLH 459
               DL+ N L+G IP W+G+L  L  L L  N   G +P ++  L  +  L L  NSL+
Sbjct: 654 ----DLNNNYLSGVIPTWLGKLPLLGELKLSSNKFVGSLPTEIFSLTNILTLFLDGNSLN 709

Query: 460 GSIPPCFDNTTLYESYNNSSSLDEKFEISFFIEGPQGDFTTKNIAYIYQGKVLSLLSGLY 519
           GSIP    N     + N    L+E       + GP      K          LS L  L 
Sbjct: 710 GSIPQEIGNLQALNALN----LEENQ-----LSGPLPSTIGK----------LSKLFELR 750

Query: 520 LSCNKLIGHIPPQIGNLTRIQT-LNLSYNNLTGLIPSTFSNLKHIESLDLSYNKLNGKIP 578
           LS N L G IP +IG L  +Q+ L+LSYNN TG IPST S L  +ESLDLS+N+L G++P
Sbjct: 751 LSRNALTGEIPVEIGQLQDLQSALDLSYNNFTGRIPSTISTLPKLESLDLSHNQLVGEVP 810

Query: 579 HQLVELKTLEVFSVAYNNLSGEILEWTAQFATFNKSSYEGNTFLCGLPLPICRSPATMSE 638
            Q+ ++K+L   +++YNNL G++     QF+ +   ++ GN  LCG PL  C    + ++
Sbjct: 811 GQIGDMKSLGYLNLSYNNLEGKL---KKQFSRWQADAFVGNAGLCGSPLSHCNRAGSKNQ 867

Query: 639 ASIGNERDDNLIDMDSFFITFTTS-YVIVIFAIVIILY 675
            S+  +            I+  +S   I +  +VIIL+
Sbjct: 868 RSLSPK--------TVVIISAISSLAAIALMVLVIILF 897




Together with GSO1, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons. Involved in the nuclear division phase of megagametogenesis.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZPS9|BRL2_ARATH Serine/threonine-protein kinase BRI1-like 2 OS=Arabidopsis thaliana GN=BRL2 PE=1 SV=1 Back     alignment and function description
>sp|Q8L899|BRI1_SOLPE Systemin receptor SR160 OS=Solanum peruvianum PE=1 SV=1 Back     alignment and function description
>sp|Q8GUQ5|BRI1_SOLLC Brassinosteroid LRR receptor kinase OS=Solanum lycopersicum GN=CURL3 PE=1 SV=1 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description
>sp|Q9ZWC8|BRL1_ARATH Serine/threonine-protein kinase BRI1-like 1 OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|Q9LJF3|BRL3_ARATH Receptor-like protein kinase BRI1-like 3 OS=Arabidopsis thaliana GN=BRL3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query710
224142481781 predicted protein [Populus trichocarpa] 0.969 0.880 0.462 1e-160
255581263 912 serine-threonine protein kinase, plant-t 0.945 0.735 0.452 1e-158
224112245 876 predicted protein [Populus trichocarpa] 0.932 0.755 0.428 1e-144
224123984 1016 predicted protein [Populus trichocarpa] 0.978 0.684 0.404 1e-137
359476165 1464 PREDICTED: LRR receptor-like serine/thre 0.969 0.469 0.386 1e-135
224142723 923 predicted protein [Populus trichocarpa] 0.912 0.702 0.400 1e-135
224073436 1014 predicted protein [Populus trichocarpa] 0.977 0.684 0.403 1e-134
224073452710 predicted protein [Populus trichocarpa] 0.853 0.853 0.432 1e-134
224073382 1309 predicted protein [Populus trichocarpa] 0.912 0.495 0.412 1e-134
224134597 947 predicted protein [Populus trichocarpa] 0.850 0.637 0.422 1e-134
>gi|224142481|ref|XP_002324585.1| predicted protein [Populus trichocarpa] gi|222866019|gb|EEF03150.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  572 bits (1473), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 353/763 (46%), Positives = 469/763 (61%), Gaps = 75/763 (9%)

Query: 1   MLNLSGNSFNNTILSSLTHLSSLRSLNLNGNSLEGSIDVKEFDSLRDLEELDIGENKIDK 60
           +L LS N  N++ LS L  LSSL+ LNL+ N L+GSID+K    L+ L+ELDI       
Sbjct: 32  ILELSFNKINDSTLSFLEGLSSLKHLNLDNNQLKGSIDMKGLCELKQLQELDIS------ 85

Query: 61  FVVSKELYLDDTGFKGTLDIREFDSFNNLEVLDMSYN---------KIDNLVVPQELRLS 111
                  Y D  G    L      + NNL+VLD+S+N         +I +L   ++L+LS
Sbjct: 86  -------YNDLNGLPSCLT-----NLNNLQVLDISFNNFSGNISLSRIGSLTSIRDLKLS 133

Query: 112 DNHFRIPISLEPLFNHSRLKIFHAKNNQMNAEITESHSLTAPNFQLQSLSLSSSYGDGVT 171
           DNHF+IPISL P FN S LK  +  +N++       H+L  P FQLQ LSL+  +G G T
Sbjct: 134 DNHFQIPISLGPFFNLSNLKNLNGDHNEIYESTELVHNLI-PRFQLQRLSLAC-HGFGGT 191

Query: 172 FPKFLYHQHDLEYVRLSHIKMNGEFPNWLLENNTKLATLFLVNDSLAGPFWLPIHSHKRL 231
           FPKFLY+QHDL++V LSHIK+ GEFP+WLL+NNTKL  L+LVN SL+G   LP  SH  L
Sbjct: 192 FPKFLYYQHDLQFVDLSHIKIIGEFPSWLLQNNTKLEALYLVNSSLSGSLQLPNDSHVNL 251

Query: 232 GILDISNNNIRGHIPVEIGDVLPSLYVFNISMNALDGSIPSSFGNMKFLQLLDLSNNQLT 291
             LDIS N+I+  IP +IG   P L   N+S N   GSIPSS  NM  L +LDLSNN L+
Sbjct: 252 SRLDISRNHIQNQIPTKIGAYFPWLEFLNLSRNYFSGSIPSSISNMSSLGVLDLSNNGLS 311

Query: 292 GEIPEHLAVGCVNLQFLMLSNNSLK-------------EGLYLTNNSLSGNIPGWLGNLT 338
           G IPE L  GC++L+ L+LSNN LK               L L+ N L+G +P  L N +
Sbjct: 312 GNIPEQLVEGCLSLRGLVLSNNHLKGQFFWRSFNLAYLTDLILSGNQLTGILPNSLSNGS 371

Query: 339 WLIHIIMPENHLEGPIPVEFCQLYSLQILDISDNNISGSLPSCF-HPLSIEQVHLSKNML 397
            L  + +  N+L G IP     + SLQ LD+S+NN+ GSLPS F    ++ +V+LSKN L
Sbjct: 372 RLEALDVSLNNLSGKIPRWIGYMSSLQYLDLSENNLYGSLPSSFCSSRTMTEVYLSKNKL 431

Query: 398 HRQL-----------KRDLSYNLLNGSIPDWIGELSQLSHLILGHNNLEGEVPVQLCELN 446
              L           + DLS+N   G IP+ IG L +LS L+LG+NNLEG++P QLC+L 
Sbjct: 432 EGSLIGALDGCLSLNRLDLSHNYFGGGIPESIGSLLELSFLLLGYNNLEGKIPSQLCKLE 491

Query: 447 QLQLLDLSNNSLHGSIPPCFDNTTLYESYNNSSSLDEKFEISFFIEGPQ----------- 495
           +L L+DLS+N L G I PC   T+ ++    +S       +     GPQ           
Sbjct: 492 KLSLIDLSHNHLFGHILPCLQPTSKWQRERETSLNPSGNSLGRENRGPQIVFPVPAVEDP 551

Query: 496 -----GDFTTKNIAYIYQGKVLSLLSGLYLSCNKLIGHIPPQIGNLTRIQTLNLSYNNLT 550
                 +FTTK+I+Y ++G +L  +SG+ LSCN L G IP ++GNL+ IQ LNLS+N+LT
Sbjct: 552 SMNKSVEFTTKSISYSFKGIILKYISGIDLSCNNLTGEIPVELGNLSNIQVLNLSHNSLT 611

Query: 551 GLIPSTFSNLKHIESLDLSYNKLNGKIPHQLVELKTLEVFSVAYNNLSGEILEWTAQFAT 610
           G IP TFSNLK IESLDLSYN LNG+IP QL++L  L  FSVA+NNLSG+  E  AQF+T
Sbjct: 612 GPIPPTFSNLKEIESLDLSYNNLNGEIPRQLLDLNFLSAFSVAHNNLSGKTPEMVAQFST 671

Query: 611 FNKSSYEGNTFLCGLPLP--ICRS--PATMSEASIGNERDDNLIDMDSFFITFTTSYVIV 666
           FNKS YEGN  LCG PL     R+  P+ +  +    + ++ +IDM++F +TF+ +Y++V
Sbjct: 672 FNKSCYEGNPLLCGPPLARNCTRALPPSPLPRSQTHKKEENGVIDMEAFIVTFSVAYIMV 731

Query: 667 IFAIVIILYVNSYWRRRWFYFVEMWITTCYYFVVDNL-IPTRF 708
           +  I  +LY+N  WRR WFYF+   I  CYYF+VDNL +P RF
Sbjct: 732 LLTIGSVLYINPRWRRAWFYFIGESINNCYYFLVDNLPVPARF 774




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255581263|ref|XP_002531443.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223528936|gb|EEF30930.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224112245|ref|XP_002332815.1| predicted protein [Populus trichocarpa] gi|222833209|gb|EEE71686.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224123984|ref|XP_002330258.1| predicted protein [Populus trichocarpa] gi|222871714|gb|EEF08845.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359476165|ref|XP_002283141.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224142723|ref|XP_002324704.1| predicted protein [Populus trichocarpa] gi|222866138|gb|EEF03269.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224073436|ref|XP_002304095.1| predicted protein [Populus trichocarpa] gi|222841527|gb|EEE79074.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224073452|ref|XP_002304097.1| predicted protein [Populus trichocarpa] gi|222841529|gb|EEE79076.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224073382|ref|XP_002304087.1| predicted protein [Populus trichocarpa] gi|222841519|gb|EEE79066.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224134597|ref|XP_002327443.1| predicted protein [Populus trichocarpa] gi|222835997|gb|EEE74418.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query710
TAIR|locus:2101943891 RLP45 "AT3G53240" [Arabidopsis 0.692 0.552 0.336 7.8e-65
TAIR|locus:2019662965 RLP15 "AT1G74190" [Arabidopsis 0.794 0.584 0.311 1.2e-61
TAIR|locus:2037308976 RLP14 "AT1G74180" [Arabidopsis 0.874 0.636 0.316 6.1e-61
TAIR|locus:20373131000 RLP13 "AT1G74170" [Arabidopsis 0.780 0.554 0.315 2.5e-59
TAIR|locus:2040075935 RLP21 "AT2G25470" [Arabidopsis 0.863 0.655 0.318 1.9e-56
TAIR|locus:20250121083 RLP1 "AT1G07390" [Arabidopsis 0.692 0.454 0.318 2.2e-56
TAIR|locus:2155909908 RLP56 "AT5G49290" [Arabidopsis 0.694 0.542 0.320 1.5e-52
TAIR|locus:2161825 1090 AT5G56040 [Arabidopsis thalian 0.867 0.565 0.287 3.3e-46
TAIR|locus:2156349 1252 GSO2 "GASSHO 2" [Arabidopsis t 0.774 0.439 0.290 3.2e-45
TAIR|locus:2020457 1166 BRL1 "BRI1 like" [Arabidopsis 0.647 0.394 0.272 1.5e-43
TAIR|locus:2101943 RLP45 "AT3G53240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 578 (208.5 bits), Expect = 7.8e-65, Sum P(2) = 7.8e-65
 Identities = 177/526 (33%), Positives = 261/526 (49%)

Query:   182 LEYVRLSHIKMNGEFPNWLLE-NNTKLATLFLVNDSLAGPFWLPIHSHKRLGILDISNNN 240
             L ++ LS+ +  G  P+ +    N +   L   N S   P  L    +  L  L +S+N 
Sbjct:   375 LRHLNLSNNEFLGNMPSSMARMENIEFMDLSYNNFSGKLPRNLFTGCYS-LSWLKLSHNR 433

Query:   241 IRGHIPVEIGDVLPSLYVFNISMNALDGSIPSSFGNMKFLQLLDLSNNQLTGEIPEHLAV 300
               G I  +  D   SL    +  N   G IP +  N++ L ++DLSNN LTG IP  L  
Sbjct:   434 FSGPIIRKSSDET-SLITLIMDNNMFTGKIPRTLLNLRMLSVIDLSNNLLTGTIPRWLG- 491

Query:   301 GCVNLQFLMLSNNSLKEGLYLTNNSLSGNIPGWLGNLTWLIHIIMPENHLEGPIPVEFCQ 360
                N  FL        E L ++NN L G IP  L N+ +L  + +  N L G +P+    
Sbjct:   492 ---NF-FL--------EVLRISNNRLQGAIPPSLFNIPYLWLLDLSGNFLSGSLPLRSSS 539

Query:   361 LYSLQILDISDNNISGSLPSCF----HPLSIEQVHLSKNM-LHRQLKRD----LSYNLLN 411
              Y   ILD+ +NN++GS+P         L +    LS N+ L R         L  N L 
Sbjct:   540 DYGY-ILDLHNNNLTGSIPDTLWYGLRLLDLRNNKLSGNIPLFRSTPSISVVLLRENNLT 598

Query:   412 GSIPDWIGELSQLSHLILGHNNLEGEVP--VXXXXXXXXXXXXXXXXXXHGSIPPCFDNT 469
             G IP  +  LS +  L   HN L   +P  V                    S+   F   
Sbjct:   599 GKIPVELCGLSNVRMLDFAHNRLNESIPSCVTNLSFGSGGHSNADSDWYPASLLSNF--M 656

Query:   470 TLY-ESYNNSSSLDEKFEISFFIE-GPQGDFTTKNIAYIYQGKVLSLLSGLYLSCNKLIG 527
              +Y E Y  S  + ++F + + ++   Q +F  K    +Y    L+ + GL LS N+L G
Sbjct:   657 EIYTEVYYESLIVSDRFSLDYSVDFNVQVEFAVKQRYDLYMRGTLNQMFGLDLSSNELSG 716

Query:   528 HIPPQIGNLTRIQTLNLSYNNLTGLIPSTFSNLKHIESLDLSYNKLNGKIPHQLVELKTL 587
             +IP ++G+L R+++LNLS N+L+G IP +FSNL+ IESLDLS+NKL+G IP QL  L++L
Sbjct:   717 NIPEELGDLKRVRSLNLSRNSLSGSIPGSFSNLRSIESLDLSFNKLHGTIPSQLTLLQSL 776

Query:   588 EVFSVAYNNLSGEILEWTAQFATFNKSSYEGNTFLCGLPLPICRSPATMSEASIGNERDD 647
              VF+V+YNNLSG ++    QF TF + SY GN  LCG P        T+S      + D+
Sbjct:   777 VVFNVSYNNLSG-VIPQGKQFNTFGEKSYLGNFLLCGSPTKRSCGGTTISSGKEYEDDDE 835

Query:   648 N-LIDMDSFFITFTTSYVIVIFAIVIILYVNSYWRRRWFYFVEMWI 692
             + L+D+   + +  T+YV V+   ++ L  +S WRR WF  V+ +I
Sbjct:   836 SGLLDIVVLWWSLGTTYVTVMMGFLVFLCFDSPWRRAWFCLVDTFI 881


GO:0007165 "signal transduction" evidence=IC
TAIR|locus:2019662 RLP15 "AT1G74190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037308 RLP14 "AT1G74180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037313 RLP13 "AT1G74170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040075 RLP21 "AT2G25470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025012 RLP1 "AT1G07390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155909 RLP56 "AT5G49290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2161825 AT5G56040 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156349 GSO2 "GASSHO 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020457 BRL1 "BRI1 like" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00181059
hypothetical protein (781 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query710
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 9e-48
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-42
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-37
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-31
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-16
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-11
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 7e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 8e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.004
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  181 bits (461), Expect = 9e-48
 Identities = 181/571 (31%), Positives = 251/571 (43%), Gaps = 91/571 (15%)

Query: 106 QELRLSDNHFRIPISLEPLFNHSRLKIFHAKNNQMNAEITESHSLTAPNFQLQSLSLSSS 165
           Q + LS+N    PI  +     S L+  +  NN     I      + PN  L++L LS++
Sbjct: 96  QTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRG---SIPN--LETLDLSNN 150

Query: 166 YGDGVTFPKFLYHQHDLEYVRLSHIKMNGEFPNWLLENNTKLATLFLVNDSLAGPFWLPI 225
              G   P  +     L+ + L    + G+ PN L  N T L  L L ++ L G     +
Sbjct: 151 MLSG-EIPNDIGSFSSLKVLDLGGNVLVGKIPNSL-TNLTSLEFLTLASNQLVGQIPREL 208

Query: 226 HSHKRLGILDISNNNIRGHIPVEIGDVLPSLYVFNISMNALDGSIPSSFGNMKFLQLLDL 285
              K L  + +  NN+ G IP EIG  L SL   ++  N L G IPSS GN+K LQ L L
Sbjct: 209 GQMKSLKWIYLGYNNLSGEIPYEIGG-LTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFL 267

Query: 286 SNNQLTGEIPEHLAVGCVNLQFLMLSNNSLKEGLYLTNNSLSGNIPGWLGNLTWLIHIIM 345
             N+L+G IP  +     +LQ L+         L L++NSLSG IP  +  L  L  + +
Sbjct: 268 YQNKLSGPIPPSI----FSLQKLI--------SLDLSDNSLSGEIPELVIQLQNLEILHL 315

Query: 346 PENHLEGPIPVEFCQLYSLQILDISDNNISGSLPSCFHPLSIEQVHLSKNMLHRQLK-RD 404
             N+  G IPV    L  LQ+L +  N  SG +P           +L K   H  L   D
Sbjct: 316 FSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPK----------NLGK---HNNLTVLD 362

Query: 405 LSYNLLNGSIPDWIGELSQLSHLILGHNNLEGEVPVQLCELNQLQLLDLSNNSLHGSIPP 464
           LS N L G IP+ +     L  LIL  N+LEGE+P  L     L+ + L +NS  G +P 
Sbjct: 363 LSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPS 422

Query: 465 CFDNTTLYE----SYNNSSSL--DEKFEI-----------SFFIEGPQGDFTTKNIAYIY 507
            F    L      S NN        K+++            FF   P   F +K      
Sbjct: 423 EFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDS-FGSKR----- 476

Query: 508 QGKVLSLLSGLYLSCNKLIGHIPPQIGNLTRIQTLNLSYNNLTGLIPSTFSNLKHIESLD 567
                  L  L LS N+  G +P ++G+L+ +  L LS N L+G IP   S+ K + SLD
Sbjct: 477 -------LENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLD 529

Query: 568 LSYNKLNGKIPHQLVELKTLEVFSVAYNNLSGEI-----------------------LEW 604
           LS+N+L+G+IP    E+  L    ++ N LSGEI                       L  
Sbjct: 530 LSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPS 589

Query: 605 TAQFATFNKSSYEGNTFLCG----LPLPICR 631
           T  F   N S+  GN  LCG      LP C+
Sbjct: 590 TGAFLAINASAVAGNIDLCGGDTTSGLPPCK 620


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 710
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.96
KOG4237498 consensus Extracellular matrix protein slit, conta 99.94
KOG4237498 consensus Extracellular matrix protein slit, conta 99.91
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.88
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.87
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.86
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.83
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.79
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.75
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.7
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.65
KOG0617264 consensus Ras suppressor protein (contains leucine 99.62
KOG0617264 consensus Ras suppressor protein (contains leucine 99.61
PLN03150623 hypothetical protein; Provisional 99.44
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.19
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.12
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.11
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.05
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.04
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.01
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.01
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.01
PLN03150623 hypothetical protein; Provisional 98.97
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.97
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.96
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.94
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.93
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.91
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.91
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.87
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.66
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.6
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.58
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.49
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.25
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.24
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.23
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.21
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.13
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.11
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.1
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.04
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.94
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.93
KOG4341483 consensus F-box protein containing LRR [General fu 97.92
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.86
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.82
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.78
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.74
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.72
PRK15386426 type III secretion protein GogB; Provisional 97.53
KOG4341483 consensus F-box protein containing LRR [General fu 97.52
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.48
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.43
PRK15386426 type III secretion protein GogB; Provisional 97.31
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.57
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.41
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.36
KOG2123 388 consensus Uncharacterized conserved protein [Funct 95.65
KOG1947482 consensus Leucine rich repeat proteins, some prote 95.26
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 94.59
KOG1947482 consensus Leucine rich repeat proteins, some prote 94.16
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.09
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 93.68
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 92.98
smart0037026 LRR Leucine-rich repeats, outliers. 92.98
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 92.54
smart0037026 LRR Leucine-rich repeats, outliers. 92.54
KOG4308478 consensus LRR-containing protein [Function unknown 91.41
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 91.02
KOG4308478 consensus LRR-containing protein [Function unknown 88.88
KOG0473326 consensus Leucine-rich repeat protein [Function un 86.79
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 84.61
KOG0473326 consensus Leucine-rich repeat protein [Function un 84.05
KOG3864221 consensus Uncharacterized conserved protein [Funct 81.45
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=2.7e-58  Score=547.57  Aligned_cols=532  Identities=31%  Similarity=0.449  Sum_probs=444.7

Q ss_pred             CeecCCCCCCCccchhhccCCCCCEEECCCCccccccChhhhcCCCCCCEEeCCCCCCC------CcccccEEecCCCcc
Q 005168            1 MLNLSGNSFNNTILSSLTHLSSLRSLNLNGNSLEGSIDVKEFDSLRDLEELDIGENKID------KFVVSKELYLDDTGF   74 (710)
Q Consensus         1 ~L~Ls~n~i~~~~~~~~~~l~~L~~L~Ls~n~i~~~i~~~~f~~l~~L~~L~Ls~n~l~------~l~~l~~L~L~~~~~   74 (710)
                      .|||++|.|++..+.+|.++++|++|+|++|++.+.++.+.|..+++|++|+|++|.++      .+++|++|+|++|.+
T Consensus        73 ~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~~~l~~L~~L~Ls~n~~  152 (968)
T PLN00113         73 SIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRGSIPNLETLDLSNNML  152 (968)
T ss_pred             EEEecCCCccccCChHHhCCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCccccccCccccCCCCEEECcCCcc
Confidence            37889999999888899999999999999999887788677778999999999999875      577888888888888


Q ss_pred             eeecCHHhhcCCCCCCEEEccCCcCCCCCCCcEEEccccccccccCcccccCCCCCcEEEccCCcccccccccccCCCCC
Q 005168           75 KGTLDIREFDSFNNLEVLDMSYNKIDNLVVPQELRLSDNHFRIPISLEPLFNHSRLKIFHAKNNQMNAEITESHSLTAPN  154 (710)
Q Consensus        75 ~~~i~~~~~~~l~~L~~L~Ls~n~l~~~~~L~~L~L~~~~l~~~~~~~~l~~l~~L~~L~L~~n~~~~~~~~~~~~~~~~  154 (710)
                      .+.+|. .+.++++|++|++++|.+.+.                .+ ..+.++++|+.|++++|.+....+..   +...
T Consensus       153 ~~~~p~-~~~~l~~L~~L~L~~n~l~~~----------------~p-~~~~~l~~L~~L~L~~n~l~~~~p~~---l~~l  211 (968)
T PLN00113        153 SGEIPN-DIGSFSSLKVLDLGGNVLVGK----------------IP-NSLTNLTSLEFLTLASNQLVGQIPRE---LGQM  211 (968)
T ss_pred             cccCCh-HHhcCCCCCEEECccCccccc----------------CC-hhhhhCcCCCeeeccCCCCcCcCChH---HcCc
Confidence            877777 788888888888888776532                22 34566777777777777765554433   2344


Q ss_pred             CcccEEEecCCCCCCCccChhccCCCCCCEEEccCCcCcccCChhHhhcCCCCcEEEccCCcccccCccCccCCCCCCEE
Q 005168          155 FQLQSLSLSSSYGDGVTFPKFLYHQHDLEYVRLSHIKMNGEFPNWLLENNTKLATLFLVNDSLAGPFWLPIHSHKRLGIL  234 (710)
Q Consensus       155 ~~L~~L~l~~~~~~~~~~~~~l~~~~~L~~L~ls~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~L~~L  234 (710)
                      .+|++|++ .++.+.+.+|..+..+++|++|++++|.+.+..|..+ .++++|+.|++++|.+.+..|..+..+++|++|
T Consensus       212 ~~L~~L~L-~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l-~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L  289 (968)
T PLN00113        212 KSLKWIYL-GYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSL-GNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISL  289 (968)
T ss_pred             CCccEEEC-cCCccCCcCChhHhcCCCCCEEECcCceeccccChhH-hCCCCCCEEECcCCeeeccCchhHhhccCcCEE
Confidence            57777777 6677777788888888889999998888888888776 788889999999888888888888888889999


Q ss_pred             EcccCcCcccCChhhhhcCCCccEEEccCCcCcccCCccCcCCCCCCEEeccCCccCCcCChhhhcCCCCCcEEEccCCC
Q 005168          235 DISNNNIRGHIPVEIGDVLPSLYVFNISMNALDGSIPSSFGNMKFLQLLDLSNNQLTGEIPEHLAVGCVNLQFLMLSNNS  314 (710)
Q Consensus       235 ~ls~n~i~~~~~~~~~~~~~~L~~L~L~~n~i~~~~~~~f~~l~~L~~L~Ls~n~l~~~i~~~~~~~l~~L~~L~Ls~n~  314 (710)
                      ++++|.+.+.+|..+.. +++|+.|++++|.+.+..|..+..+++|+.|++++|.+.+.+|.... .+++|+.|++++|.
T Consensus       290 ~Ls~n~l~~~~p~~~~~-l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~l~-~~~~L~~L~Ls~n~  367 (968)
T PLN00113        290 DLSDNSLSGEIPELVIQ-LQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLG-KHNNLTVLDLSTNN  367 (968)
T ss_pred             ECcCCeeccCCChhHcC-CCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcCChHHh-CCCCCcEEECCCCe
Confidence            99988888777776654 78899999999988888888888889999999999988867776554 68888888887776


Q ss_pred             CcCeeeccCccCccCcCccccCCCccceeeCccCccccccchhhcCCCCCCEEECCCCcCcccCCCCCC-CCCcceEEcc
Q 005168          315 LKEGLYLTNNSLSGNIPGWLGNLTWLIHIIMPENHLEGPIPVEFCQLYSLQILDISDNNISGSLPSCFH-PLSIEQVHLS  393 (710)
Q Consensus       315 l~~~l~l~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~ls~n~i~~~~~~~~~-~~~L~~L~l~  393 (710)
                      +..           ..|..+..+++|+.|++++|.+.+..|..+..+++|+.|++++|++++..+..+. ++.|+.++++
T Consensus       368 l~~-----------~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls  436 (968)
T PLN00113        368 LTG-----------EIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDIS  436 (968)
T ss_pred             eEe-----------eCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEECc
Confidence            553           5677888888899999999998888888888899999999999998887777666 7888888766


Q ss_pred             CccccccccccCCCccCcccCChhhhcCCCccEEecCCCcccccCCcccCCCCCCCEEEccCCcccccCCCCcccccccc
Q 005168          394 KNMLHRQLKRDLSYNLLNGSIPDWIGELSQLSHLILGHNNLEGEVPVQLCELNQLQLLDLSNNSLHGSIPPCFDNTTLYE  473 (710)
Q Consensus       394 ~n~l~~~~~~~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~~~~~  473 (710)
                      +|.+.+             ..|..+..+++|+.|++++|++.+..|..+ ..++|+.|++++|++++..|..+.+     
T Consensus       437 ~N~l~~-------------~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~-~~~~L~~L~ls~n~l~~~~~~~~~~-----  497 (968)
T PLN00113        437 NNNLQG-------------RINSRKWDMPSLQMLSLARNKFFGGLPDSF-GSKRLENLDLSRNQFSGAVPRKLGS-----  497 (968)
T ss_pred             CCcccC-------------ccChhhccCCCCcEEECcCceeeeecCccc-ccccceEEECcCCccCCccChhhhh-----
Confidence            665543             666777788999999999999998888765 4689999999999999888887766     


Q ss_pred             cccCCCCCccccccceeecCCCcceeeccccceecccccccccEEECcCCcCCCCCCccccccCCCCEEeCCCccCCCCC
Q 005168          474 SYNNSSSLDEKFEISFFIEGPQGDFTTKNIAYIYQGKVLSLLSGLYLSCNKLIGHIPPQIGNLTRIQTLNLSYNNLTGLI  553 (710)
Q Consensus       474 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~~  553 (710)
                                                            ++.|+.|++++|.+.+.+|..+.++++|++|+|++|.+++..
T Consensus       498 --------------------------------------l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~  539 (968)
T PLN00113        498 --------------------------------------LSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQI  539 (968)
T ss_pred             --------------------------------------hhccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccC
Confidence                                                  348999999999999999999999999999999999999999


Q ss_pred             chhhcCCccCCEEeCcCCcCcccCCcccccCCCCCEEeccCCccccccCCCccccccCCcccccCCCCCCCCC
Q 005168          554 PSTFSNLKHIESLDLSYNKLNGKIPHQLVELKTLEVFSVAYNNLSGEILEWTAQFATFNKSSYEGNTFLCGLP  626 (710)
Q Consensus       554 ~~~~~~l~~L~~L~Ls~N~i~~~~~~~l~~l~~L~~L~l~~N~l~~~~~~~~~~~~~~~~~~~~~n~~~c~~~  626 (710)
                      |..|.++++|+.|+|++|++++.+|..+..+++|+.+++++|++.+.+|.. ..+..+....+.||+..|+.+
T Consensus       540 p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~-~~~~~~~~~~~~~n~~lc~~~  611 (968)
T PLN00113        540 PASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPST-GAFLAINASAVAGNIDLCGGD  611 (968)
T ss_pred             ChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCCc-chhcccChhhhcCCccccCCc
Confidence            999999999999999999999999999999999999999999999999974 677788888899999998743



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query710
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 3e-36
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 3e-22
3rgx_A768 Structural Insight Into Brassinosteroid Perception 4e-36
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 3e-22
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 3e-15
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-04
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 150 bits (378), Expect = 3e-36, Method: Compositional matrix adjust. Identities = 178/681 (26%), Positives = 275/681 (40%), Gaps = 114/681 (16%) Query: 39 VKEFDSLRDLEELDIGENKIDKFVVSKELYLDDTGFK------GTLD----IREFDSFNN 88 V F L LD+ N + V + +G K TLD + N+ Sbjct: 90 VSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNS 149 Query: 89 LEVLDMSYNKIDNLVVPQELRLSDNHFRIPISLEPLFNHSRLKIFHAKNNQMNAEITESH 148 LEVLD+S N I V + LSD LK N+++ ++ S Sbjct: 150 LEVLDLSANSISGANVVGWV-LSDGC-------------GELKHLAISGNKISGDVDVSR 195 Query: 149 SLTAPNFXXXXXXXXXXYGDGVTFPKFLYHQHDLEYVRLSHIKMNGEFPNWLLENNTKLA 208 + + G+ FL L+++ +S K++G+F + + T+L Sbjct: 196 CVN----LEFLDVSSNNFSTGI---PFLGDCSALQHLDISGNKLSGDF-SRAISTCTELK 247 Query: 209 TLFLVNDSLAGPFWLPIHSHKRLGILDISNNNIRGHIPVEIGDVLPSLYVFNISMNALDG 268 L + ++ GP +P K L L ++ N G IP + +L ++S N G Sbjct: 248 LLNISSNQFVGP--IPPLPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYG 305 Query: 269 SIPSSFG-------------------------NMKFLQLLDLSNNQLTGEIPEHLAVGCV 303 ++P FG M+ L++LDLS N+ +GE+PE L Sbjct: 306 AVPPFFGSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA 365 Query: 304 NLQFLMLSNNSLK---------------EGLYLTNNSLSGNIPGWLGNLTWLIHIIMPEN 348 +L L LS+N+ + LYL NN +G IP L N + L+ + + N Sbjct: 366 SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFN 425 Query: 349 HLEGPIPVEFCQLYSLQILDISDNNISGSLPS-CFHPLSIEQVHLSKNMLHRQLKR---- 403 +L G IP L L+ L + N + G +P + ++E + L N L ++ Sbjct: 426 YLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSN 485 Query: 404 -------DLSYNLLNGSIPDWIGELSQLSHLILGHNNLEGEVPVXXXXXXXXXXXXXXXX 456 LS N L G IP WIG L L+ L L +N+ G +P Sbjct: 486 CTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTN 545 Query: 457 XXHGSIPPC-----------FDNTTLYESYNNSSSLDEKFEISFFIE--GPQGD----FT 499 +G+IP F Y N E +E G + + + Sbjct: 546 LFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLS 605 Query: 500 TKN----IAYIYQGKVLSLLSG------LYLSCNKLIGHIPPQIGNLTRIQTLNLSYNNL 549 T+N + +Y G L +S N L G+IP +IG++ + LNL +N++ Sbjct: 606 TRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDI 665 Query: 550 TGLIPSTFSNLKHIESLDLSYNKLNGKIPHQLVELKTLEVFSVAYNNLSGEILEWTAQFA 609 +G IP +L+ + LDLS NKL+G+IP + L L ++ NNLSG I E QF Sbjct: 666 SGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEM-GQFE 724 Query: 610 TFNKSSYEGNTFLCGLPLPIC 630 TF + + N LCG PLP C Sbjct: 725 TFPPAKFLNNPGLCGYPLPRC 745
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query710
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-124
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-96
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-95
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-68
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-41
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-18
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-68
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-57
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-24
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-14
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-09
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-66
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-65
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-65
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-58
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-43
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-37
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-36
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-26
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-16
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-63
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-51
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-48
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-40
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-38
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-36
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 9e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-60
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-46
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-41
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-41
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-40
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-23
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-17
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-59
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-47
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-38
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-52
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-47
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-51
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-17
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-49
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-33
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-20
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-40
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-34
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-23
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-35
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-33
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-32
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-29
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-15
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-13
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-34
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-29
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-26
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-13
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-33
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-26
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-20
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-17
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-14
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-33
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-26
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-24
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-24
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-22
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-20
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-17
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-32
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-29
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-24
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-14
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-31
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-21
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-18
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-05
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-30
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-23
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-20
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-20
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-20
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-19
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-16
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-30
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-29
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-28
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-24
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-30
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-26
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-21
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-13
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-13
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 5e-29
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-26
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-22
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-20
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-14
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-28
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-18
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-18
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-28
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-20
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-19
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-19
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-28
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-25
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-23
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-21
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-18
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-25
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-22
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-16
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-16
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-25
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-24
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-24
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-12
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 6e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-25
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-24
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-24
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-12
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 9e-24
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-21
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-20
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-11
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-23
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-21
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-22
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-16
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-22
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-17
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-11
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-11
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-08
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-06
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-21
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-20
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-17
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-11
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-18
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-17
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-17
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-17
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-09
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-17
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-14
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-13
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 8e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-09
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-11
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-11
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 8e-07
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 7e-06
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 9e-13
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-11
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 9e-07
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 2e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 9e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-06
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-12
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-09
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-11
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 7e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 4e-10
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 8e-07
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 3e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 6e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 9e-08
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-07
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 9e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 9e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 5e-07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 5e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 7e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 7e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 6e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 5e-05
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 7e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 2e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  387 bits (997), Expect = e-124
 Identities = 168/646 (26%), Positives = 263/646 (40%), Gaps = 119/646 (18%)

Query: 2   LNLSGNSFNNTILSSLTHLSSLRSLNLNGNSLEGSIDVKEFDSLRDLEELDIGENK---- 57
           L++S N+F+  I   L   S+L+ L+++GN L G    +   +  +L+ L+I  N+    
Sbjct: 205 LDVSSNNFSTGI-PFLGDCSALQHLDISGNKLSGDFS-RAISTCTELKLLNISSNQFVGP 262

Query: 58  IDKFVVSK--ELYLDDTGFKGTLDIREFDSFNNLEVLDMSYNK--------IDNLVVPQE 107
           I    +     L L +  F G +      + + L  LD+S N           +  + + 
Sbjct: 263 IPPLPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLES 322

Query: 108 LRLSDNHFRIPISLEPLFNHSRLKIFHAKNNQMNAEITESHSLTAPNFQLQSLSLSSSYG 167
           L LS N+F   + ++ L     LK+     N+ + E+ ES +           +LS+S  
Sbjct: 323 LALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLT-----------NLSAS-- 369

Query: 168 DGVTFPKFLYHQHDLEYVRLSHIKMNGEFPNWLLENN-TKLATLFLVNDSLAGPFWLPIH 226
                         L  + LS    +G     L +N    L  L+L N+   G     + 
Sbjct: 370 --------------LLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLS 415

Query: 227 SHKRLGILDISNNNIRGHIPVEIGDVLPSLYVFNISMNALDGSIPSSFGNMKFLQLLDLS 286
           +   L  L +S N + G IP  +G  L  L    + +N L+G IP     +K L+ L L 
Sbjct: 416 NCSELVSLHLSFNYLSGTIPSSLGS-LSKLRDLKLWLNMLEGEIPQELMYVKTLETLILD 474

Query: 287 NNQLTGEIPEHLAVGCVNLQFLMLSNNSLKEGLYLTNNSLSGNIPGWLGNLTWLIHIIMP 346
            N LTGEIP  L+  C NL ++ LSNN L           +G IP W+G L  L  + + 
Sbjct: 475 FNDLTGEIPSGLS-NCTNLNWISLSNNRL-----------TGEIPKWIGRLENLAILKLS 522

Query: 347 ENHLEGPIPVEFCQLYSLQILDISDNNISGSLPSCFHPLSIEQVHLSKNMLHRQLKRDLS 406
            N   G IP E     SL  LD++ N  +G++P+                   +    ++
Sbjct: 523 NNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAM----------------FKQSGKIA 566

Query: 407 YNLLNGSIPDWIGELSQLSHLILGHN--NLEGEVPVQLCELNQLQLLDLSNNSLHGSIPP 464
            N + G    +I             N    +G    QL  L+     ++++    G   P
Sbjct: 567 ANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSP 626

Query: 465 CFDNTTLYESYNNSSSLDEKFEISFFIEGPQGDFTTKNIAYIYQGKVLSLLSGLYLSCNK 524
            FDN                                              +  L +S N 
Sbjct: 627 TFDN-------------------------------------------NGSMMFLDMSYNM 643

Query: 525 LIGHIPPQIGNLTRIQTLNLSYNNLTGLIPSTFSNLKHIESLDLSYNKLNGKIPHQLVEL 584
           L G+IP +IG++  +  LNL +N+++G IP    +L+ +  LDLS NKL+G+IP  +  L
Sbjct: 644 LSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSAL 703

Query: 585 KTLEVFSVAYNNLSGEILEWTAQFATFNKSSYEGNTFLCGLPLPIC 630
             L    ++ NNLSG I E   QF TF  + +  N  LCG PLP C
Sbjct: 704 TMLTEIDLSNNNLSGPIPE-MGQFETFPPAKFLNNPGLCGYPLPRC 748


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query710
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.98
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.98
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.92
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.92
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.9
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.9
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.88
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.88
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.87
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.86
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.86
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.86
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.85
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.85
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.85
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.84
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.84
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.84
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.84
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.84
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.83
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.83
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.81
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.8
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.79
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.78
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.78
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.78
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.77
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.77
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.75
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.75
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.75
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.74
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.73
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.73
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.73
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.72
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.72
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.72
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.72
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.72
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.69
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.69
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.69
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.68
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.67
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.67
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.65
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.64
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.64
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.63
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.62
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.62
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.61
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.59
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.55
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.53
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.53
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.5
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.5
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.5
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.49
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.48
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.43
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.4
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.39
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.39
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.38
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.36
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.26
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.26
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.17
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.16
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.14
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.64
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.58
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.25
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.19
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.16
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 98.11
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.1
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.77
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.59
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.71
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.6
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.56
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 83.32
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=7.8e-67  Score=604.12  Aligned_cols=625  Identities=29%  Similarity=0.394  Sum_probs=420.9

Q ss_pred             eecCCCCCCCc---cchhhccCCCCCEEECCCCccccccChhhhcCCCCCCEEeCCCCCCC----------CcccccEEe
Q 005168            2 LNLSGNSFNNT---ILSSLTHLSSLRSLNLNGNSLEGSIDVKEFDSLRDLEELDIGENKID----------KFVVSKELY   68 (710)
Q Consensus         2 L~Ls~n~i~~~---~~~~~~~l~~L~~L~Ls~n~i~~~i~~~~f~~l~~L~~L~Ls~n~l~----------~l~~l~~L~   68 (710)
                      |||+++.+++.   .+.+|.++++|+.++++.+.+. .++ ..|+.+++|++|+|++|.++          ++++|++|+
T Consensus        55 L~L~~~~l~g~~~~l~~~l~~L~~L~~l~~~~~~~~-~l~-~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~  132 (768)
T 3rgz_A           55 IDLSSKPLNVGFSAVSSSLLSLTGLESLFLSNSHIN-GSV-SGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLN  132 (768)
T ss_dssp             EECTTSCCCEEHHHHHHHTTTCTTCCEEECTTSCEE-ECC-CCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEE
T ss_pred             EECCCCCcCCccCccChhHhccCcccccCCcCCCcC-CCc-hhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEE
Confidence            67777777776   5566666666666666666554 343 45666666666666666443          445566666


Q ss_pred             cCCCcceeecCHHhhcCCCCCCEEEccCCcCC-----------CCCCCcEEEccccccccccCcccccCCCCCcEEEccC
Q 005168           69 LDDTGFKGTLDIREFDSFNNLEVLDMSYNKID-----------NLVVPQELRLSDNHFRIPISLEPLFNHSRLKIFHAKN  137 (710)
Q Consensus        69 L~~~~~~~~i~~~~~~~l~~L~~L~Ls~n~l~-----------~~~~L~~L~L~~~~l~~~~~~~~l~~l~~L~~L~L~~  137 (710)
                      |++|.+.+.+|...+.++++|++|++++|+++           ++++|++|++++|.+++..+   +..+++|++|++++
T Consensus       133 Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~---~~~l~~L~~L~Ls~  209 (768)
T 3rgz_A          133 VSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVD---VSRCVNLEFLDVSS  209 (768)
T ss_dssp             CCSSEEECCSSCCSCCCCTTCSEEECCSSCCEEETHHHHHHTTCCTTCCEEECCSSEEESCCB---CTTCTTCCEEECCS
T ss_pred             CcCCccCCcCCHHHhccCCCCCEEECCCCccCCcCChhhhhhccCCCCCEEECCCCcccccCC---cccCCcCCEEECcC
Confidence            66666665555522356666666666666543           23566666666666654322   35566666666666


Q ss_pred             CcccccccccccCCCCCCcccEEEecCCCCCCCccChhccCCCCCCEEEccCCcCcccCChhHhhcCCCCcEEEccCCcc
Q 005168          138 NQMNAEITESHSLTAPNFQLQSLSLSSSYGDGVTFPKFLYHQHDLEYVRLSHIKMNGEFPNWLLENNTKLATLFLVNDSL  217 (710)
Q Consensus       138 n~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~l~~~~~L~~L~ls~~~~~~~~~~~~~~~l~~L~~L~l~~~~~  217 (710)
                      |++....+.    +...++|++|++ +++.+.+.+|..+..+++|++|++++|.+++..|..   .+++|++|++++|++
T Consensus       210 n~l~~~~~~----l~~l~~L~~L~L-s~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~---~l~~L~~L~L~~n~l  281 (768)
T 3rgz_A          210 NNFSTGIPF----LGDCSALQHLDI-SGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPL---PLKSLQYLSLAENKF  281 (768)
T ss_dssp             SCCCSCCCB----CTTCCSCCEEEC-CSSCCCSCHHHHTTTCSSCCEEECCSSCCEESCCCC---CCTTCCEEECCSSEE
T ss_pred             CcCCCCCcc----cccCCCCCEEEC-cCCcCCCcccHHHhcCCCCCEEECCCCcccCccCcc---ccCCCCEEECcCCcc
Confidence            665543322    334446666666 555555556666666666666666666666555543   456666666666666


Q ss_pred             cccCccCccCC-CCCCEEEcccCcCcccCChhhhhcCCCccEEEccCCcCcccCCcc-CcCCCCCCEEeccCCccCCcCC
Q 005168          218 AGPFWLPIHSH-KRLGILDISNNNIRGHIPVEIGDVLPSLYVFNISMNALDGSIPSS-FGNMKFLQLLDLSNNQLTGEIP  295 (710)
Q Consensus       218 ~~~~~~~~~~~-~~L~~L~ls~n~i~~~~~~~~~~~~~~L~~L~L~~n~i~~~~~~~-f~~l~~L~~L~Ls~n~l~~~i~  295 (710)
                      .+..|..+... ++|++|++++|.+++.+|..+.. +++|++|++++|.+.+.+|.. |.++++|++|++++|.+++.+|
T Consensus       282 ~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~-l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p  360 (768)
T 3rgz_A          282 TGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGS-CSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELP  360 (768)
T ss_dssp             EESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGG-CTTCCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSEEEECCC
T ss_pred             CCccCHHHHhhcCcCCEEECcCCcCCCccchHHhc-CCCccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCccCcccc
Confidence            65555555443 66666666666666555555443 566666666666665444433 5666666666666666655555


Q ss_pred             hhhhcCCC-CCcEEEccCCCCc---------------CeeeccCccCccCcCccccCCCccceeeCccCccccccchhhc
Q 005168          296 EHLAVGCV-NLQFLMLSNNSLK---------------EGLYLTNNSLSGNIPGWLGNLTWLIHIIMPENHLEGPIPVEFC  359 (710)
Q Consensus       296 ~~~~~~l~-~L~~L~Ls~n~l~---------------~~l~l~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~  359 (710)
                      ..+.. ++ +|++|++++|.+.               +.+++++|.+++.+|..+..+++|++|++++|.+++..|..|.
T Consensus       361 ~~l~~-l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~  439 (768)
T 3rgz_A          361 ESLTN-LSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLG  439 (768)
T ss_dssp             TTHHH-HTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGGGCTTCCEEECCSSEEESCCCGGGG
T ss_pred             HHHHh-hhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHhcCCCCCEEECcCCcccCcccHHHh
Confidence            55442 33 6666666666542               2356666666667777788888888888888888777777788


Q ss_pred             CCCCCCEEECCCCcCcccCCCCCC-CCCcceEEccCccccccccc-----------cCCCccCcccCChhhhcCCCccEE
Q 005168          360 QLYSLQILDISDNNISGSLPSCFH-PLSIEQVHLSKNMLHRQLKR-----------DLSYNLLNGSIPDWIGELSQLSHL  427 (710)
Q Consensus       360 ~l~~L~~L~ls~n~i~~~~~~~~~-~~~L~~L~l~~n~l~~~~~~-----------~l~~n~~~~~~~~~~~~l~~L~~L  427 (710)
                      .+++|++|++++|.+.+..+..+. +++|++|++++|.+++..+.           ++++|.+.+.+|.+++.+++|++|
T Consensus       440 ~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L  519 (768)
T 3rgz_A          440 SLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAIL  519 (768)
T ss_dssp             GCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEE
T ss_pred             cCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEE
Confidence            888888888888888777666665 77788888888877765443           677888888999999999999999


Q ss_pred             ecCCCcccccCCcccCCCCCCCEEEccCCcccccCCCCcccccccccccCCCCCcccc--c---------ccee--ec--
Q 005168          428 ILGHNNLEGEVPVQLCELNQLQLLDLSNNSLHGSIPPCFDNTTLYESYNNSSSLDEKF--E---------ISFF--IE--  492 (710)
Q Consensus       428 ~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~~~~~~~~~~~~~~~~~--~---------~~~~--~~--  492 (710)
                      ++++|++.+.+|..+..+++|+.|++++|+++|.+|..+...................  +         ....  ..  
T Consensus       520 ~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  599 (768)
T 3rgz_A          520 KLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGI  599 (768)
T ss_dssp             ECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTC
T ss_pred             ECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhccccccccccccccccccccccccccccccc
Confidence            9999999999999999999999999999999999998775543221111110000000  0         0000  00  


Q ss_pred             ----------CCCcceeeccccc--eecccccccccEEECcCCcCCCCCCccccccCCCCEEeCCCccCCCCCchhhcCC
Q 005168          493 ----------GPQGDFTTKNIAY--IYQGKVLSLLSGLYLSCNKLIGHIPPQIGNLTRIQTLNLSYNNLTGLIPSTFSNL  560 (710)
Q Consensus       493 ----------~~~~~~~~~~~~~--~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l  560 (710)
                                .............  ......++.|+.|+|++|++++.+|..|+++++|+.|+|++|.+++.+|+.|+++
T Consensus       600 ~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L  679 (768)
T 3rgz_A          600 RSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDL  679 (768)
T ss_dssp             CGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGC
T ss_pred             cchhhhccccccccccccceecccCchhhhccccccEEECcCCcccccCCHHHhccccCCEEeCcCCccCCCCChHHhCC
Confidence                      0000000000000  0011236789999999999999999999999999999999999999999999999


Q ss_pred             ccCCEEeCcCCcCcccCCcccccCCCCCEEeccCCccccccCCCccccccCCcccccCCCCCCCCCCCCCCCCCCCCCcc
Q 005168          561 KHIESLDLSYNKLNGKIPHQLVELKTLEVFSVAYNNLSGEILEWTAQFATFNKSSYEGNTFLCGLPLPICRSPATMSEAS  640 (710)
Q Consensus       561 ~~L~~L~Ls~N~i~~~~~~~l~~l~~L~~L~l~~N~l~~~~~~~~~~~~~~~~~~~~~n~~~c~~~~~~c~~~~~~~~~~  640 (710)
                      ++|+.|||++|++++.+|..+..+++|++|++++|+++|.+|.. .++.++....+.|||.+|+.|+..|.......+..
T Consensus       680 ~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~-~~~~~~~~~~~~gN~~Lcg~~l~~C~~~~~~~~~~  758 (768)
T 3rgz_A          680 RGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEM-GQFETFPPAKFLNNPGLCGYPLPRCDPSNADGYAH  758 (768)
T ss_dssp             TTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSS-SSGGGSCGGGGCSCTEEESTTSCCCCSCC------
T ss_pred             CCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCc-hhhccCCHHHhcCCchhcCCCCcCCCCCccCCCCC
Confidence            99999999999999999999999999999999999999999985 68889999999999999999988897665555554


Q ss_pred             CC
Q 005168          641 IG  642 (710)
Q Consensus       641 ~~  642 (710)
                      +.
T Consensus       759 ~~  760 (768)
T 3rgz_A          759 HQ  760 (768)
T ss_dssp             --
T ss_pred             CC
Confidence            33



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 710
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-20
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-13
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-17
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-16
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-11
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-06
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-06
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-16
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-15
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 9e-15
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-09
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 5e-05
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 9e-12
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 7e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-10
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.002
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 5e-07
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 9e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 8e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 6e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.004
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 1e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.002
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 1e-06
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 3e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 5e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-06
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 6e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.004
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 3e-05
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.001
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 6e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.002
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 9e-05
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.002
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 89.7 bits (221), Expect = 9e-20
 Identities = 61/377 (16%), Positives = 124/377 (32%), Gaps = 33/377 (8%)

Query: 233 ILDISNNNIRGHIPVEIGDVLPSLYVFNISMNALDGSIPSSFGNMKFLQLLDLSNNQLTG 292
              +   N+   +     D + +L    + + ++DG        +  L  ++ SNNQLT 
Sbjct: 26  KTVLGKTNVTDTVSQTDLDQVTTLQADRLGIKSIDG-----VEYLNNLTQINFSNNQLTD 80

Query: 293 EIPEHLAVGCVNLQFLMLSNNSLKEGLY--------LTNNSLSGNIPGWLGNLTWLIHII 344
             P         L  ++++NN + +                 +             ++ +
Sbjct: 81  ITPLK---NLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDIDPLKNLTNLNRL 137

Query: 345 MPENHLEGPIPVEFCQLYSLQILDISDNNISGSLPSCFHPLSIEQVHLSKNM------LH 398
              ++    I          Q+   +       L +      ++      +       L 
Sbjct: 138 ELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLT 197

Query: 399 RQLKRDLSYNLLNGSIPDWIGELSQLSHLILGHNNLEGEVPVQLCELNQLQLLDLSNNSL 458
                  + N ++   P  I   + L  L L  N L+      L  L  L  LDL+NN +
Sbjct: 198 NLESLIATNNQISDITPLGIL--TNLDELSLNGNQLKD--IGTLASLTNLTDLDLANNQI 253

Query: 459 HGSIPPCFDNTTLYESYNNSSSLDEKFEISFFIEGPQGDFTTKNIAYIYQGKVLSLLSGL 518
              + P    T L E    ++ +     ++        +     +  I     L  L+ L
Sbjct: 254 SN-LAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDISPISNLKNLTYL 312

Query: 519 YLSCNKLIGHIPPQIGNLTRIQTLNLSYNNLTGLIPSTFSNLKHIESLDLSYNKLNGKIP 578
            L  N +    P  + +LT++Q L  + N ++    S+ +NL +I  L   +N+++   P
Sbjct: 313 TLYFNNISDISP--VSSLTKLQRLFFANNKVSD--VSSLANLTNINWLSAGHNQISDLTP 368

Query: 579 HQLVELKTLEVFSVAYN 595
             L  L  +    +   
Sbjct: 369 --LANLTRITQLGLNDQ 383


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query710
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.94
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.8
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.78
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.77
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.74
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.73
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.72
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.71
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.7
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.7
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.7
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.64
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.64
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.51
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.5
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.49
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.49
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.48
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.41
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.4
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.35
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.35
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.32
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.23
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.15
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.15
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.11
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.45
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.44
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.67
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.46
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.95  E-value=6.2e-28  Score=245.95  Aligned_cols=259  Identities=34%  Similarity=0.531  Sum_probs=196.2

Q ss_pred             CCCEEeccCCccCC--cCChhhhcCCCCCcEEEccC-CCCcCeeeccCccCccCcCccccCCCccceeeCccCccccccc
Q 005168          279 FLQLLDLSNNQLTG--EIPEHLAVGCVNLQFLMLSN-NSLKEGLYLTNNSLSGNIPGWLGNLTWLIHIIMPENHLEGPIP  355 (710)
Q Consensus       279 ~L~~L~Ls~n~l~~--~i~~~~~~~l~~L~~L~Ls~-n~l~~~l~l~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~  355 (710)
                      +++.|+|++|.+.+  .+|..+. ++++|++|++++ |.+           +|.+|..|+++++|++|++++|++.+..+
T Consensus        51 ~v~~L~L~~~~l~g~~~lp~~l~-~L~~L~~L~Ls~~N~l-----------~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~  118 (313)
T d1ogqa_          51 RVNNLDLSGLNLPKPYPIPSSLA-NLPYLNFLYIGGINNL-----------VGPIPPAIAKLTQLHYLYITHTNVSGAIP  118 (313)
T ss_dssp             CEEEEEEECCCCSSCEECCGGGG-GCTTCSEEEEEEETTE-----------ESCCCGGGGGCTTCSEEEEEEECCEEECC
T ss_pred             EEEEEECCCCCCCCCCCCChHHh-cCcccccccccccccc-----------ccccccccccccccchhhhcccccccccc
Confidence            45566666665554  2444443 455555555443 222           22344555555555555555555554444


Q ss_pred             hhhcCCCCCCEEECCCCcCcccCCCCCCCCCcceEEccCccccccccccCCCccCcccCChhhhcCCCccEEecCCCccc
Q 005168          356 VEFCQLYSLQILDISDNNISGSLPSCFHPLSIEQVHLSKNMLHRQLKRDLSYNLLNGSIPDWIGELSQLSHLILGHNNLE  435 (710)
Q Consensus       356 ~~~~~l~~L~~L~ls~n~i~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~  435 (710)
                      ..+..+.+|+.+++++|.+.                                    +.+|..+..++.++.+++++|.+.
T Consensus       119 ~~~~~~~~L~~l~l~~N~~~------------------------------------~~~p~~l~~l~~L~~l~l~~n~l~  162 (313)
T d1ogqa_         119 DFLSQIKTLVTLDFSYNALS------------------------------------GTLPPSISSLPNLVGITFDGNRIS  162 (313)
T ss_dssp             GGGGGCTTCCEEECCSSEEE------------------------------------SCCCGGGGGCTTCCEEECCSSCCE
T ss_pred             ccccchhhhccccccccccc------------------------------------ccCchhhccCcccceeeccccccc
Confidence            44555555555555444433                                    256777888999999999999999


Q ss_pred             ccCCcccCCCCCC-CEEEccCCcccccCCCCcccccccccccCCCCCccccccceeecCCCcceeeccccceeccccccc
Q 005168          436 GEVPVQLCELNQL-QLLDLSNNSLHGSIPPCFDNTTLYESYNNSSSLDEKFEISFFIEGPQGDFTTKNIAYIYQGKVLSL  514 (710)
Q Consensus       436 ~~~~~~~~~l~~L-~~L~L~~n~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~  514 (710)
                      +.+|..+..+..+ +.+++++|++++..|..+..+.                                            
T Consensus       163 ~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~--------------------------------------------  198 (313)
T d1ogqa_         163 GAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLN--------------------------------------------  198 (313)
T ss_dssp             EECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCC--------------------------------------------
T ss_pred             cccccccccccccccccccccccccccccccccccc--------------------------------------------
Confidence            8899888888775 8999999999988887765533                                            


Q ss_pred             ccEEECcCCcCCCCCCccccccCCCCEEeCCCccCCCCCchhhcCCccCCEEeCcCCcCcccCCcccccCCCCCEEeccC
Q 005168          515 LSGLYLSCNKLIGHIPPQIGNLTRIQTLNLSYNNLTGLIPSTFSNLKHIESLDLSYNKLNGKIPHQLVELKTLEVFSVAY  594 (710)
Q Consensus       515 L~~L~L~~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~i~~~~~~~l~~l~~L~~L~l~~  594 (710)
                      ...++++++...+..|..+..+++++.+++++|.+++.++ .+..+++|+.|+|++|++++.+|+.+..+++|++|+|++
T Consensus       199 ~~~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~  277 (313)
T d1ogqa_         199 LAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSF  277 (313)
T ss_dssp             CSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGG-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCS
T ss_pred             cccccccccccccccccccccccccccccccccccccccc-ccccccccccccCccCeecccCChHHhCCCCCCEEECcC
Confidence            4579999999999999999999999999999999987654 688899999999999999999999999999999999999


Q ss_pred             CccccccCCCccccccCCcccccCCCCCCCCCCCCCC
Q 005168          595 NNLSGEILEWTAQFATFNKSSYEGNTFLCGLPLPICR  631 (710)
Q Consensus       595 N~l~~~~~~~~~~~~~~~~~~~~~n~~~c~~~~~~c~  631 (710)
                      |.++|.+|++ ..+..++.+++.+|+..|+.|++.|.
T Consensus       278 N~l~g~iP~~-~~L~~L~~l~l~~N~~l~g~plp~c~  313 (313)
T d1ogqa_         278 NNLCGEIPQG-GNLQRFDVSAYANNKCLCGSPLPACT  313 (313)
T ss_dssp             SEEEEECCCS-TTGGGSCGGGTCSSSEEESTTSSCCC
T ss_pred             CcccccCCCc-ccCCCCCHHHhCCCccccCCCCCCCC
Confidence            9999999974 77889999999999999999888773



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure