Citrus Sinensis ID: 005266

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-----

MEAVAEGLWGLADYHENKGEIGKAVKCLEAICQSHVSFLPIIEVKTRLRISTLLLKHTHNVNHAKSHLERSQLLLKAIPSCFELKCRTFSLLSQCYHLVGAIPPQKLILYKALDLTSSASQDVAVKLWSCNFNSQLANAFIIEGDYQSSISALQSGYVCATEISYPDLQMFFATAILHVHLMQWDDENSVLRSINQCDRVWESIDPNRRGQCLGLLFYNELLHIFYRLRICDYKNAAHHVDNLDAAMKADKQKMQEIQQLSSELDALNQSLSRPDLPSRERSALAGRQAKLQQRLRSLEDSSLTGKEFLEPSYFGNARQAWGDKLVLAPSPMDGEWLPKSAVYALVDLMVVILGRPKGLFKECMQRIQSGMQTIQDALLKLGITDGVREVDLQHSAIWMAGVYLMLLMQFLENKVAVELTRSGFVEAQEACESMIEMLRGQYAHSVGCYSEAAFHYVEAAKITESKSMQAMCHAYAAVSYFCIGDAESSSQAIDLIGPVYQMKDTINGVREEASLHFAYGLLLMRQQDFQEARNRLAKGLQIAHNHMGNLQLVSQYLTILGNLALALHDTVQAREILRSSLTLAKKLYDIPTQIWALSVLTALYQQLGDRGNEMENDEYRRKKLDELQKRLADAYSSIHHIELISKVKLEVQQFHELDIKRAMANQSMSVNLDIPESIGLSTPLPVQSSSRLIDLDGGRRGKRKI

cHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHcccccccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccEEEEccccccccccc

cHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccccEEEHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccHHccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccccHccccccHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccccccHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcEEHHHHHcccHHHccccccccccccccccccccccccccccHHEEcccccccccccc

MEAVAEGlwgladyhenkgEIGKAVKCLEAICQSHVSFLPIIEVKTRLRISTLLLKHTHNVNHAKSHLERSQLLLKAIPSCFELKCRTFSLLSQCYhlvgaippqkLILYKAldltssasQDVAVKLWSCNFNSQLANAFIIEGDYQSSISALQSGYvcateisypDLQMFFATAILHVHLMQWDDENSVLRSINQCDRvwesidpnrrgqclGLLFYNELLHIFYRLRIcdyknaahhVDNLDAAMKADKQKMQEIQQLSSELDALnqslsrpdlpsreRSALAGRQAKLQQRLRSledssltgkeflepsyfgnarqawgdklvlapspmdgewlpkSAVYALVDLMVVILGRPKGLFKECMQRIQSGMQTIQDALLKLgitdgvrevdlqHSAIWMAGVYLMLLMQFLENKVAVELTRSGFVEAQEACESMIEMLRGQYAHSVGCYSEAAFHYVEAAKITESKSMQAMCHAYAAVSYFCIgdaesssqaidligpvyqmkdtingVREEASLHFAYGLLLMRQQDFQEARNRLAKGLQIAHNHMGNLQLVSQYLTILGNLALALHDTVQAREILRSSLTLAKKLYDIPTQIWALSVLTALYQQLGdrgnemendEYRRKKLDELQKRLADAYSSIHHIELISKVKLEVQQFHELDIKRAMANQSmsvnldipesiglstplpvqsssrlidldggrrgkrki

MEAVAEGLWGLADYHENKGEIGKAVKCLEAICQSHVSFLPIIEVKTRLRISTLLLKHThnvnhakshlERSQLLLKAIPSCFELKCRTFSLLSQCYHLVGAIPPQKLILYKALDLTSSASQDVAVKLWSCNFNSQLANAFIIEGDYQSSISALQSGYVCATEISYPDLQMFFATAILHVHLMQWDDENSVLRSINQCDRVWESIDPNRRGQCLGLLFYNELLHIFYRLRICDYKNAAHHVDNLDAAMKADKQKMQEIQQLSSELDALNQSLSRPDLPSRERSALAGRQAKLQQrlrsledssltgkEFLEPSYFGNARQAWGDKLVLAPSPMDGEWLPKSAVYALVDLMVVILGRPKGLFKECMQRIQSGMQTIQDALLKLGITDGVREVDLQHSAIWMAGVYLMLLMQFLENKVAVELTRSGFVEAQEACESMIEMLRGQYAHSVGCYSEAAFHYVEAAKITESKSMQAMCHAYAAVSYFCIGDAESSSQAIDLIGPVYQMKDTINGVREEASLHFAYGLLLMRQQDFQEARNRLAKGLQIAHNHMGNLQLVSQYLTILGNLALALHDTVQAREILRSSLTLAKKLYDIPTQIWALSVLTALYQQLGDRGNEMENDEYRRKKLDELQKRLADAYSSIHHIELISKVKLEVQQFHELDIKRAMANQSMSVNLDIPESIGlstplpvqsssrlidldggrrgkrki

*****EGLWGLADYHENKGEIGKAVKCLEAICQSHVSFLPIIEVKTRLRISTLLLKHTHNVNHAKSHLERSQLLLKAIPSCFELKCRTFSLLSQCYHLVGAIPPQKLILYKALDLTSSASQDVAVKLWSCNFNSQLANAFIIEGDYQSSISALQSGYVCATEISYPDLQMFFATAILHVHLMQWDDENSVLRSINQCDRVWESIDPNRRGQCLGLLFYNELLHIFYRLRICDYKNAAHHVDNL****************************************************************FLEPSYFGNARQAWGDKLVLAPSPMDGEWLPKSAVYALVDLMVVILGRPKGLFKECMQRIQSGMQTIQDALLKLGITDGVREVDLQHSAIWMAGVYLMLLMQFLENKVAVELTRSGFVEAQEACESMIEMLRGQYAHSVGCYSEAAFHYVEAAKITESKSMQAMCHAYAAVSYFCIGDAESSSQAIDLIGPVYQMKDTINGVREEASLHFAYGLLLMRQQDFQEARNRLAKGLQIAHNHMGNLQLVSQYLTILGNLALALHDTVQAREILRSSLTLAKKLYDIPTQIWALSVLTALYQQLG*********************RLADAYSSIHHIELISKVKLEVQQFHELDIKRAM******************************************

**AVAEGLWGLADYHENKGEIGKAVKCLEAICQSHVSFLPIIEVKTRLRISTLLLKHTHNVNHAKSHLERSQLLLKAIPSCFELKCRTFSLLSQCYHLVGAIPPQKLILYKALDLTSSASQDVAVKLWSCNFNSQLANAFIIEGDYQSSISALQSGYVCATEISYPDLQMFFATAILHVHLMQWDDENS**RS*NQCDRVWE*********CLGLLFYNELLHIFYRLRICDYKNAAHHVDNLDA********************ALNQSLSRPDLPSRERSALAGRQ***************TGKEFLEPSYFG*A**AWGDKLVLAPSPMDGEWLPKSAVYALVDLMVVILGRPKGLFKECMQRIQSG********************DLQHSAIWMAGVYLMLLMQFLENKVAVELTRSGFVEAQEACESMIEMLRGQYAHSVGCYSEAAFHYVEAAKITESKSMQAMCHAYAAVSYFCIGDAESSSQAIDLIGPVYQM**T*NGVREEASLHFAYGLLLMRQQDFQEARNRLAKGLQIAHNHMGNLQLVSQYLTILGNLALALHD*******L***LTLAKKLYDIPTQIWALSVLTALYQQLGD***************************SIHHIELISKVKLEV*************************SIGL***********LI*****R******

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MEAVAEGLWGLADYHENKGEIGKAVKCLEAICQSHVSFLPIIEVKTRLRISTLLLKHTHNVNHAKSHLERSQLLLKAIPSCFELKCRTFSLLSQCYHLVGAIPPQKLILYKALDLTSSASQDVAVKLWSCNFNSQLANAFIIEGDYQSSISALQSGYVCATEISYPDLQMFFATAILHVHLMQWDDENSVLRSINQCDRVWESIDPNRRGQCLGLLFYNELLHIFYRLRICDYKNAAHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLSRPDLPSRERSALAGRQAKLQQRLRSLEDSSLTGKEFLEPSYFGNARQAWGDKLVLAPSPMDGEWLPKSAVYALVDLMVVILGRPKGLFKECMQRIQSGMQTIQDALLKLGITDGVREVDLQHSAIWMAGVYLMLLMQFLENKVAVELTRSGFVEAQEACESMIEMLRGQYAHSVGCYSEAAFHYVEAAKITESKSMQAMCHAYAAVSYFCIGDAESSSQAIDLIGPVYQMKDTINGVREEASLHFAYGLLLMRQQDFQEARNRLAKGLQIAHNHMGNLQLVSQYLTILGNLALALHDTVQAREILRSSLTLAKKLYDIPTQIWALSVLTALYQQLGDRGNEMENDEYRRKKLDELQKRLADAYSSIHHIELISKVKLEVQQFHELDIKRAMANQSMSVNLDIPESIGLSTPLPVQSSSRLIDLDGGRRGKRKI

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		705	2.2.26 [Sep-21-2011]
Q16NZ8		620	MAU2 chromatid cohesion f	N/A	no	0.731	0.832	0.201	3e-13
B4PS83		632	MAU2 chromatid cohesion f	N/A	no	0.726	0.810	0.209	3e-13
Q9VFC0		632	MAU2 chromatid cohesion f	yes	no	0.726	0.810	0.209	3e-13
B3M1B7		639	MAU2 chromatid cohesion f	N/A	no	0.821	0.906	0.209	5e-13
B4JHK2		623	MAU2 chromatid cohesion f	N/A	no	0.730	0.826	0.207	7e-13
B4QZ45		632	MAU2 chromatid cohesion f	N/A	no	0.726	0.810	0.208	7e-13
B4HE12		632	MAU2 chromatid cohesion f	N/A	no	0.726	0.810	0.208	8e-13
B3P0R4		632	MAU2 chromatid cohesion f	N/A	no	0.726	0.810	0.208	8e-13
B4NKT1		663	MAU2 chromatid cohesion f	N/A	no	0.730	0.776	0.205	1e-12
B0WYS3		616	MAU2 chromatid cohesion f	N/A	no	0.727	0.832	0.200	4e-12

>sp\|Q16NZ8\|SCC4_AEDAE MAU2 chromatid cohesion factor homolog OS=Aedes aegypti GN=AAEL011819 PE=3 SV=1	Back alignment and function desciption

 Score = 77.8 bits (190), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 127/629 (20%), Positives = 248/629 (39%), Gaps = 113/629 (17%)

Query: 7   GLWGLADYHENKG--EIGKAVKCLEAICQSHVSFLPI--IEVKTRLRISTLLLKHTHNVN 62
            L GLA+Y        I K ++CL+A+     +F P   +E +T L++  +L+ +T N +
Sbjct: 11  SLLGLAEYFRTSSPPNIKKCIQCLQAL----FTFKPPLKVEARTHLQLGQILMAYTKNTD 66

Query: 63  HAKSHLERSQLLLKAIPSCFELKCRTFSLLSQCYHLVGAIPPQKLILYKALDLTSSASQD 122
            A++HLE++ +L + I +  ++K  T SLL+Q Y         K +L KA++L+      
Sbjct: 67  LARNHLEQAWMLSENINNFDDVKFDTASLLAQLYQQQEQSSLAKPVLRKAIELSQHNV-- 124

Query: 123 VAVKLWSCNFNSQLANAFIIEGDYQSSISALQSGYVCATEISYPDLQMFFATAILHVHLM 182
                W C    QLA     + +Y  +   L  G     E +   L+  F  +   + ++
Sbjct: 125 ----YWHCKLLFQLAQTHATDKEYALASELLAVGVESTDETNATYLKTLFLLSRAMIMMI 180

Query: 183 QWDDENSVLRSINQCDRVWESIDPNRRGQCLGLLFYNELLHI-FYRLRICDYKNAAHHVD 241
           +      VL  +NQ   + ++   N        +   E L + FY L++C Y        
Sbjct: 181 E-RKTGDVLTILNQAGTMIDNAVQN--------IHLKEYLKVFFYVLQVCHYLQLGQ--- 228

Query: 242 NLDAAMKADKQKMQEIQQLSSELDALNQSLSRPDLPSRERSALAGRQAKLQQRLRSLEDS 301
                +K  K  ++++QQ         Q++  P+ P+ E+                    
Sbjct: 229 -----VKTVKTSLKQLQQSI-------QTIMAPNWPADEQ-------------------- 256

Query: 302 SLTGKEFLEPSYFGNARQAWGDKLVLAPSPMDGEWLPKSAVYALVDLMVVILGRPKGLFK 361
                       FG +      ++ +        WLPK  +Y LV L+ V      G   
Sbjct: 257 -----------IFGQS----NTEMFM--------WLPKEQLYVLVYLVTVSHSMMAGYMD 293

Query: 362 ECMQRIQSGMQTIQDALLKLGITDGVREVDLQHSAIWMAGVYLMLLMQFLENKVAV---E 418
           +  +  +  +  I+             ++  Q +   +A   ++LL   +  ++ +    
Sbjct: 294 KAQKYTEKALTQIE-------------KLKSQENKPILAVFQIILLEHIIMCRLVMGNKS 340

Query: 419 LTRSGFVEAQEACES------------MIEMLRGQYAHSVGCYSEAAFHYVEAAKITESK 466
           L       A++ C S             +  L G YA S   +  A   +      T  +
Sbjct: 341 LAIKEIALAKDVCLSSSNKFLLKKHSAQLHCLLGLYAMSASYFEHAERQFFACINDTTER 400

Query: 467 SMQAMCHAYAAVSYFCIGDAESSSQAIDLIGPVYQMKDTINGVREEASLHFAYGLLLMRQ 526
            ++   +   A+ Y  +   +   Q +D +    +     N      S ++  GL    +
Sbjct: 401 DLKLFANLNLAIVYLRMKREQELRQILDQVQQ--ENSQCSNSQALMGSFYYVQGLNAFHK 458

Query: 527 QDFQEARNRLAKGLQIAHNHMGNLQLVSQYLTILGNLALALHDTVQAREILRSSLTLAKK 586
             F EA+  L + L++A+    N +L S  L +L ++ L++ ++ ++  ++  ++ LA K
Sbjct: 459 SSFHEAKRFLRETLKMANAEDLN-RLTSCSLVLLSHVFLSIGNSKESMNMVTPAMQLASK 517

Query: 587 LYDIPTQIWALSVLTALYQQLGDRGNEME 615
           + DI  Q+W  ++L  L++ L +   E E
Sbjct: 518 IPDIHVQLWGSAILKDLHRMLKEPALETE 546

Required for association of the cohesin complex with chromatin during interphase. Plays a role in sister chromatid cohesion and normal progression through prometaphase.
Aedes aegypti (taxid: 7159)

>sp\|B4PS83\|SCC4_DROYA MAU2 chromatid cohesion factor homolog OS=Drosophila yakuba GN=GE24275 PE=3 SV=1	Back alignment and function description

>sp\|Q9VFC0\|SCC4_DROME MAU2 chromatid cohesion factor homolog OS=Drosophila melanogaster GN=CG4203 PE=2 SV=1	Back alignment and function description

>sp\|B3M1B7\|SCC4_DROAN MAU2 chromatid cohesion factor homolog OS=Drosophila ananassae GN=GF17837 PE=3 SV=1	Back alignment and function description

>sp\|B4JHK2\|SCC4_DROGR MAU2 chromatid cohesion factor homolog OS=Drosophila grimshawi GN=GH18976 PE=3 SV=1	Back alignment and function description

>sp\|B4QZ45\|SCC4_DROSI MAU2 chromatid cohesion factor homolog OS=Drosophila simulans GN=GD18992 PE=3 SV=2	Back alignment and function description

>sp\|B4HE12\|SCC4_DROSE MAU2 chromatid cohesion factor homolog OS=Drosophila sechellia GN=GM24202 PE=3 SV=1	Back alignment and function description

>sp\|B3P0R4\|SCC4_DROER MAU2 chromatid cohesion factor homolog OS=Drosophila erecta GN=GG16893 PE=3 SV=1	Back alignment and function description

>sp\|B4NKT1\|SCC4_DROWI MAU2 chromatid cohesion factor homolog OS=Drosophila willistoni GN=GK13302 PE=3 SV=2	Back alignment and function description

>sp\|B0WYS3\|SCC4_CULQU MAU2 chromatid cohesion factor homolog OS=Culex quinquefasciatus GN=CPIJ012302 PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		705
297745732		722	unnamed protein product [Vitis vinifera]	1.0	0.976	0.764	0.0
225434291		755	PREDICTED: MAU2 chromatid cohesion facto	0.997	0.931	0.763	0.0
356500968		722	PREDICTED: uncharacterized protein LOC10	1.0	0.976	0.727	0.0
449456905		718	PREDICTED: uncharacterized protein LOC10	0.994	0.976	0.734	0.0
356553202		722	PREDICTED: uncharacterized protein LOC10	1.0	0.976	0.728	0.0
357491593		728	Cohesin loading complex subunit SCC4-lik	0.998	0.967	0.685	0.0
110738000		726	hypothetical protein [Arabidopsis thalia	0.995	0.966	0.655	0.0
15242058		726	cohesin-load domain-containing protein [	0.995	0.966	0.655	0.0
297792441		725	binding protein [Arabidopsis lyrata subs	0.995	0.968	0.656	0.0
449515149		580	PREDICTED: uncharacterized protein LOC10	0.760	0.924	0.730	0.0

>gi\|297745732\|emb\|CBI15788.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

 Score = 1142 bits (2953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 552/722 (76%), Positives = 624/722 (86%), Gaps = 17/722 (2%)

Query: 1   MEAVAEGLWGLADYHENKGEIGKAVKCLEAICQSHVSFLPIIEVKTRLRISTLLLKHTHN 60
           ME VAEGLWGLAD HE KGEIGKAVKCLEA+CQS VSFLPI+E+KTRLRI+TLLLKH+HN
Sbjct: 1   METVAEGLWGLADMHEKKGEIGKAVKCLEALCQSQVSFLPILEIKTRLRIATLLLKHSHN 60

Query: 61  VNHAKSHLERSQLLLKAIPSCFELKCRTFSLLSQCYHLVGAIPPQKLILYKALDLTSSAS 120
           +NHAKSHLERSQLLLK+IPSCFELKCR +SLLSQCYHLVGAIPPQK IL KAL+LT+S+ 
Sbjct: 61  LNHAKSHLERSQLLLKSIPSCFELKCRAYSLLSQCYHLVGAIPPQKQILNKALELTASSG 120

Query: 121 QDVAVKLWSCNFNSQLANAFIIEGDYQSSISALQSGYVCATEISYPDLQMFFATAILHVH 180
              AVKLW CNFNSQLANA IIEGDYQ+SISAL+ G+ CATEI Y +LQMFFAT+ILHVH
Sbjct: 121 DGFAVKLWFCNFNSQLANALIIEGDYQNSISALERGFNCATEICYIELQMFFATSILHVH 180

Query: 181 LMQWDDENSVLRSINQCDRVWESIDPNRRGQCLGLLFYNELLHIFYRLRICDYKNAAHHV 240
           LMQWDD N V R++N+C+ VW+SI+P++R Q LGLLFYNELLHIFYRLRICDYKNAA HV
Sbjct: 181 LMQWDDVNLVERAVNKCNEVWDSIEPDKRQQSLGLLFYNELLHIFYRLRICDYKNAAQHV 240

Query: 241 DNLDAAMKADKQKMQEIQQLSSELDALNQSLSRPDLPSRERSALAGRQAKLQQRLRSLED 300
           D LDAAMKAD Q+MQ IQ+L+ ELDALNQSLSR DL   +RSAL+ +QA++Q++LR +  
Sbjct: 241 DKLDAAMKADLQQMQHIQELTKELDALNQSLSRHDLHYTDRSALSEKQAQVQEQLRRVTR 300

Query: 301 SSLTGKEFLEPSYFGNARQAWGDKLVLAPSPMDGEWLPKSAVYALVDLMVVILGRPKGLF 360
              +GKE LE +YFGN ++AWGDKL LAP P+DGEWLPKSAVY L+DLMVVI GRPKG F
Sbjct: 301 LGSSGKESLESAYFGNVKRAWGDKLDLAPPPIDGEWLPKSAVYGLIDLMVVIFGRPKGNF 360

Query: 361 KECMQRIQSGMQTIQDALLKLGITDGVREVDLQHSAIWMAGVYLMLLMQFLENKVAVELT 420
           KEC +RIQSG++TIQ+ L+KLGI+D VREVDLQHSAIWMAGVYLMLLMQFLENKVAVELT
Sbjct: 361 KECGKRIQSGLRTIQEELMKLGISDSVREVDLQHSAIWMAGVYLMLLMQFLENKVAVELT 420

Query: 421 RSGFVEAQE-----------------ACESMIEMLRGQYAHSVGCYSEAAFHYVEAAKIT 463
           RS FVEAQE                 ACES+IEMLRGQYAHSVGC+SEAAFH++EAAK+T
Sbjct: 421 RSEFVEAQEALVQMRNWFLRFPTILQACESIIEMLRGQYAHSVGCFSEAAFHFIEAAKLT 480

Query: 464 ESKSMQAMCHAYAAVSYFCIGDAESSSQAIDLIGPVYQMKDTINGVREEASLHFAYGLLL 523
           ESKSMQAMC  YAAVSY CIGDAESSSQA DLIGPVY+M D+  GVRE+ S+ FAYGLLL
Sbjct: 481 ESKSMQAMCQVYAAVSYICIGDAESSSQAFDLIGPVYRMMDSFVGVREKTSVLFAYGLLL 540

Query: 524 MRQQDFQEARNRLAKGLQIAHNHMGNLQLVSQYLTILGNLALALHDTVQAREILRSSLTL 583
           M+Q + QEAR RLA GLQI HNH+GNLQLVSQYLTILG+LALALHDT QAREILRSSLTL
Sbjct: 541 MKQHNLQEARIRLATGLQITHNHLGNLQLVSQYLTILGSLALALHDTGQAREILRSSLTL 600

Query: 584 AKKLYDIPTQIWALSVLTALYQQLGDRGNEMENDEYRRKKLDELQKRLADAYSSIHHIEL 643
           AKKL DIPTQIW LSVLTALYQ+LG+RGNEMEN EY+R+K D+LQKRL DA+SSIHHIEL
Sbjct: 601 AKKLCDIPTQIWVLSVLTALYQELGERGNEMENSEYQRRKADDLQKRLVDAHSSIHHIEL 660

Query: 644 ISKVKLEVQQFHELDIKRAMANQSMSVNLDIPESIGLSTPLPVQSSSRLIDLDGGRRGKR 703
           I KV+LEV+Q HELDIKRA+A  SM V+LDIPES+GL TP P  SSSRL+DLD GRRGKR
Sbjct: 661 IEKVRLEVRQLHELDIKRAVAGSSMRVSLDIPESVGLLTPSPAPSSSRLVDLDTGRRGKR 720

Query: 704 KI 705
           KI
Sbjct: 721 KI 722

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|225434291\|ref\|XP_002275860.1\| PREDICTED: MAU2 chromatid cohesion factor homolog [Vitis vinifera]	Back alignment and taxonomy information

>gi\|356500968\|ref\|XP_003519302.1\| PREDICTED: uncharacterized protein LOC100777199 [Glycine max]	Back alignment and taxonomy information

>gi\|449456905\|ref\|XP_004146189.1\| PREDICTED: uncharacterized protein LOC101207429 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|356553202\|ref\|XP_003544947.1\| PREDICTED: uncharacterized protein LOC100780498 [Glycine max]	Back alignment and taxonomy information

>gi\|357491593\|ref\|XP_003616084.1\| Cohesin loading complex subunit SCC4-like protein [Medicago truncatula] gi\|355517419\|gb\|AES99042.1\| Cohesin loading complex subunit SCC4-like protein [Medicago truncatula]	Back alignment and taxonomy information

>gi\|110738000\|dbj\|BAF00935.1\| hypothetical protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|15242058\|ref\|NP_199947.1\| cohesin-load domain-containing protein [Arabidopsis thaliana] gi\|9759280\|dbj\|BAB09745.1\| unnamed protein product [Arabidopsis thaliana] gi\|332008685\|gb\|AED96068.1\| cohesin-load domain-containing protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|297792441\|ref\|XP_002864105.1\| binding protein [Arabidopsis lyrata subsp. lyrata] gi\|297309940\|gb\|EFH40364.1\| binding protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|449515149\|ref\|XP_004164612.1\| PREDICTED: uncharacterized protein LOC101227912 [Cucumis sativus]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		705
TAIR\|locus:2163655		726	AT5G51340 "AT5G51340" [Arabido	0.946	0.918	0.656	1.8e-245
UNIPROTKB\|Q7PXE1		644	AgaP_AGAP001363 "AGAP001363-PA	0.326	0.357	0.270	3.2e-20
FB\|FBgn0038300		632	CG4203 [Drosophila melanogaste	0.324	0.362	0.265	8.4e-20
UNIPROTKB\|Q16NZ8		620	AAEL011819 "MAU2 chromatid coh	0.326	0.370	0.254	1.3e-19
UNIPROTKB\|B4PS83		632	GE24275 "MAU2 chromatid cohesi	0.324	0.362	0.265	1.4e-19
UNIPROTKB\|B3P0R4		632	GG16893 "MAU2 chromatid cohesi	0.324	0.362	0.261	1.8e-19
UNIPROTKB\|B4HE12		632	GM24202 "MAU2 chromatid cohesi	0.324	0.362	0.261	1.8e-19
UNIPROTKB\|B4QZ45		632	GD18992 "MAU2 chromatid cohesi	0.324	0.362	0.261	1.8e-19
UNIPROTKB\|B3M1B7		639	GF17837 "MAU2 chromatid cohesi	0.324	0.358	0.257	5.6e-19
UNIPROTKB\|B4M4L4		621	GJ10962 "MAU2 chromatid cohesi	0.451	0.512	0.192	8.8e-19

TAIR\|locus:2163655 AT5G51340 "AT5G51340" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 2365 (837.6 bits), Expect = 1.8e-245, P = 1.8e-245
 Identities = 450/685 (65%), Positives = 561/685 (81%)

Query:     3 AVAEGLWGLADYHENKGEIGKAVKCLEAICQSHVSFLPIIEVKTRLRISTLLLKHTHNVN 62
             AVAEGLWGLAD+H+  GEIGK +KCLEAICQS +SFLP++EVK+RLR++ LLL+++HNVN
Sbjct:     5 AVAEGLWGLADHHQKLGEIGKTIKCLEAICQSQISFLPLVEVKSRLRLAALLLRYSHNVN 64

Query:    63 HAKSHLERSQLLLKAIPSCFELKCRTFSLLSQCYHLVGAIPPQKLILYKALDLTSSASQD 122
             HAKSHLERS LLLK+IPS ++LK + +SLLS CYHL+ + PPQ+ +L KAL+L SS  QD
Sbjct:    65 HAKSHLERSLLLLKSIPSSYDLKFQNYSLLSHCYHLLASFPPQRNLLVKALELASSVPQD 124

Query:   123 VAVKLWSCNFNSQLANAFIIEGDYQSSISALQSGYVCATEISYPDLQMFFATAILHVHLM 182
             ++  LWSCNFNSQLAN FII+ D+ SS+SAL+SG++ A+ I +P+LQMFF  ++LHVH+M
Sbjct:   125 ISAYLWSCNFNSQLANTFIIQADFPSSLSALESGFLSASHICFPELQMFFTASMLHVHIM 184

Query:   183 QWDDENSVLRSINQCDRVWESIDPNRRGQCLGLLFYNELLHIFYRLRICDYKNAAHHVDN 242
             QW D+ SV +++ +CD +W++I  ++  +C GL FYNE+LH+FYRLR+CDYKNA HHVD 
Sbjct:   185 QWTDDYSVEKAVQRCDEIWQTISSDKTDRCPGLFFYNEMLHVFYRLRLCDYKNAQHHVDR 244

Query:   243 LDAAMKADKQKMQEIQQLSSELDALNQSLSRPDLPSRERSALAGRQAKLQQRLRSLEDSS 302
             LD AM A   KMQEIQQL  EL +LN SLSR DLPSRERSAL+ RQ++LQ R+ +L  SS
Sbjct:   245 LDQAMNAHSHKMQEIQQLLDELSSLNLSLSRYDLPSRERSALSARQSQLQDRVNALSPSS 304

Query:   303 LTGKEFLEPSYFGNARQAWGDKLVLAPSPMDGEWLPKSAVYALVDLMVVILGRPKGLFKE 362
              T    LEP+YFGN  + W +KL+L+PSP+DGEWLPKSA+ ALV LMVVI GRPKGLFKE
Sbjct:   305 STVNS-LEPAYFGNIDRGWTEKLLLSPSPIDGEWLPKSAIDALVHLMVVISGRPKGLFKE 363

Query:   363 CMQRIQSGMQTIQDALLKLGITDGVREVDLQHSAIWMAGVYLMLLMQFLENKVAVELTRS 422
             C +RI+SG+Q IQD L+KLGITD VRE DL+H+AIWM+ V+LML MQFLEN+VA+ELTRS
Sbjct:   364 CSKRIESGLQIIQDELIKLGITDEVREADLRHTAIWMSRVFLMLQMQFLENRVALELTRS 423

Query:   423 GFVEAQEAC-----------------ESMIEMLRGQYAHSVGCYSEAAFHYVEAAKITES 465
              +VEA+EA                  E MIEMLRGQY+HSVGCYSEAAFH +EA K+TES
Sbjct:   424 DYVEAEEALVDMKNWFTRFPTILQASECMIEMLRGQYSHSVGCYSEAAFHCIEATKLTES 483

Query:   466 KSMQAMCHAYAAVSYFCIGDAESSSQAIDLIGPVYQMKDTINGVREEASLHFAYGLLLMR 525
              SMQA C A+AAVSY  IGDAESSS+A+DLIGP+  M ++++GVREEAS+ FAYGLLLM+
Sbjct:   484 ISMQASCQAFAAVSYLTIGDAESSSKALDLIGPLNGMTNSLSGVREEASILFAYGLLLMK 543

Query:   526 QQDFQEARNRLAKGLQIAHNHMGNLQLVSQYLTILGNLALALHDTVQAREILRSSLTLAK 585
             Q+D QEARNRLAKGLQIAHNHMGNLQLV+QYLT+LGNLAL+LHDTVQAREILRSSLTLAK
Sbjct:   544 QRDLQEARNRLAKGLQIAHNHMGNLQLVAQYLTLLGNLALSLHDTVQAREILRSSLTLAK 603

Query:   586 KLYDIPTQIWALSVLTALYQQLGDRGNEMENDEYRRKKLDELQKRLADAYSSIHHIELIS 645
             KLYDIPTQ+W LS+ TALYQQLG++GNEMEN+E+R+KK DELQ RLA+A  SIHHIEL++
Sbjct:   604 KLYDIPTQLWVLSIFTALYQQLGEKGNEMENEEFRKKKWDELQSRLAEARGSIHHIELVA 663

Query:   646 KVKLEVQQFHELDIKRAMANQSMSV 670
             K ++E+ Q      ++++   + S+
Sbjct:   664 KARIELYQIDNNPQEQSLVASAQSM 688

GO:0003674 "molecular_function" evidence=ND

GO:0005634 "nucleus" evidence=ISM

GO:0008150 "biological_process" evidence=ND

GO:0000956 "nuclear-transcribed mRNA catabolic process" evidence=RCA

GO:0006487 "protein N-linked glycosylation" evidence=RCA

UNIPROTKB\|Q7PXE1 AgaP_AGAP001363 "AGAP001363-PA" [Anopheles gambiae (taxid:7165)]	Back alignment and assigned GO terms

FB\|FBgn0038300 CG4203 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

UNIPROTKB\|Q16NZ8 AAEL011819 "MAU2 chromatid cohesion factor homolog" [Aedes aegypti (taxid:7159)]	Back alignment and assigned GO terms

UNIPROTKB\|B4PS83 GE24275 "MAU2 chromatid cohesion factor homolog" [Drosophila yakuba (taxid:7245)]	Back alignment and assigned GO terms

UNIPROTKB\|B3P0R4 GG16893 "MAU2 chromatid cohesion factor homolog" [Drosophila erecta (taxid:7220)]	Back alignment and assigned GO terms

UNIPROTKB\|B4HE12 GM24202 "MAU2 chromatid cohesion factor homolog" [Drosophila sechellia (taxid:7238)]	Back alignment and assigned GO terms

UNIPROTKB\|B4QZ45 GD18992 "MAU2 chromatid cohesion factor homolog" [Drosophila simulans (taxid:7240)]	Back alignment and assigned GO terms

UNIPROTKB\|B3M1B7 GF17837 "MAU2 chromatid cohesion factor homolog" [Drosophila ananassae (taxid:7217)]	Back alignment and assigned GO terms

UNIPROTKB\|B4M4L4 GJ10962 "MAU2 chromatid cohesion factor homolog" [Drosophila virilis (taxid:7244)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		705
pfam13424		78	pfam13424, TPR_12, Tetratricopeptide repeat	3e-05
pfam10345		592	pfam10345, Cohesin_load, Cohesin loading factor	7e-04

>gnl\|CDD\|205602 pfam13424, TPR_12, Tetratricopeptide repeat	Back alignment and domain information

 Score = 42.4 bits (100), Expect = 3e-05
 Identities = 23/77 (29%), Positives = 35/77 (45%)

Query: 510 REEASLHFAYGLLLMRQQDFQEARNRLAKGLQIAHNHMGNLQLVSQYLTILGNLALALHD 569
            + A+      L+L R  D+ EA   L K L++A     +    ++ L  L  L LAL D
Sbjct: 2   PDLAAALNNLALVLRRLGDYDEALELLEKALELARELGEDHPETARALNNLARLYLALGD 61

Query: 570 TVQAREILRSSLTLAKK 586
             +A E L  +L L + 
Sbjct: 62  YDEALEYLEKALALREA 78

Length = 78

>gnl\|CDD\|220706 pfam10345, Cohesin_load, Cohesin loading factor	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		705
KOG2300		629	consensus Uncharacterized conserved protein [Funct	100.0
PF10345		608	Cohesin_load: Cohesin loading factor; InterPro: IP	100.0
TIGR02917		899	PEP_TPR_lipo putative PEP-CTERM system TPR-repeat	99.77
TIGR02917		899	PEP_TPR_lipo putative PEP-CTERM system TPR-repeat	99.76
PRK11447		1157	cellulose synthase subunit BcsC; Provisional	99.73
TIGR00990		615	3a0801s09 mitochondrial precursor proteins import	99.7
PRK11447		1157	cellulose synthase subunit BcsC; Provisional	99.65
KOG4626		966	consensus O-linked N-acetylglucosamine transferase	99.61
PRK15174		656	Vi polysaccharide export protein VexE; Provisional	99.59
PRK09782		987	bacteriophage N4 receptor, outer membrane subunit;	99.53
TIGR00990		615	3a0801s09 mitochondrial precursor proteins import	99.53
PRK15174		656	Vi polysaccharide export protein VexE; Provisional	99.51
KOG2002		1018	consensus TPR-containing nuclear phosphoprotein th	99.48
KOG1840		508	consensus Kinesin light chain [Cytoskeleton]	99.46
PRK09782		987	bacteriophage N4 receptor, outer membrane subunit;	99.45
PRK10049		765	pgaA outer membrane protein PgaA; Provisional	99.41
KOG1130		639	consensus Predicted G-alpha GTPase interaction pro	99.38
KOG4626		966	consensus O-linked N-acetylglucosamine transferase	99.37
PRK10049		765	pgaA outer membrane protein PgaA; Provisional	99.33
KOG1840		508	consensus Kinesin light chain [Cytoskeleton]	99.3
PRK11788		389	tetratricopeptide repeat protein; Provisional	99.25
PRK14574		822	hmsH outer membrane protein; Provisional	99.23
KOG1130		639	consensus Predicted G-alpha GTPase interaction pro	99.18
PRK11788		389	tetratricopeptide repeat protein; Provisional	99.13
KOG1941		518	consensus Acetylcholine receptor-associated protei	99.12
KOG2002		1018	consensus TPR-containing nuclear phosphoprotein th	99.09
KOG2076		895	consensus RNA polymerase III transcription factor	99.09
KOG1173		611	consensus Anaphase-promoting complex (APC), Cdc16	99.08
TIGR02521		234	type_IV_pilW type IV pilus biogenesis/stability pr	99.08
PRK04841		903	transcriptional regulator MalT; Provisional	99.07
KOG1126		638	consensus DNA-binding cell division cycle control	99.04
TIGR00540		409	hemY_coli hemY protein. This is an uncharacterized	99.02
PRK04841		903	transcriptional regulator MalT; Provisional	99.01
PRK10747		398	putative protoheme IX biogenesis protein; Provisio	98.95
TIGR02521		234	type_IV_pilW type IV pilus biogenesis/stability pr	98.94
PRK14574		822	hmsH outer membrane protein; Provisional	98.9
KOG2300		629	consensus Uncharacterized conserved protein [Funct	98.88
KOG0547		606	consensus Translocase of outer mitochondrial membr	98.83
cd05804		355	StaR_like StaR_like; a well-conserved protein foun	98.78
cd05804		355	StaR_like StaR_like; a well-conserved protein foun	98.77
PRK12370		553	invasion protein regulator; Provisional	98.75
TIGR03302		235	OM_YfiO outer membrane assembly lipoprotein YfiO.	98.74
PRK11189		296	lipoprotein NlpI; Provisional	98.73
COG3063		250	PilF Tfp pilus assembly protein PilF [Cell motilit	98.73
COG3063		250	PilF Tfp pilus assembly protein PilF [Cell motilit	98.73
KOG1126		638	consensus DNA-binding cell division cycle control	98.71
KOG1155		559	consensus Anaphase-promoting complex (APC), Cdc23	98.68
PLN03218		1060	maturation of RBCL 1; Provisional	98.65
TIGR00540		409	hemY_coli hemY protein. This is an uncharacterized	98.64
PF13429		280	TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2	98.64
KOG0548		539	consensus Molecular co-chaperone STI1 [Posttransla	98.62
PRK12370		553	invasion protein regulator; Provisional	98.62
KOG2003		840	consensus TPR repeat-containing protein [General f	98.61
KOG0547		606	consensus Translocase of outer mitochondrial membr	98.6
PF13424		78	TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15	98.6
PRK10747		398	putative protoheme IX biogenesis protein; Provisio	98.54
PF14938		282	SNAP: Soluble NSF attachment protein, SNAP; PDB: 1	98.54
KOG1941		518	consensus Acetylcholine receptor-associated protei	98.54
PLN03081		697	pentatricopeptide (PPR) repeat-containing protein;	98.53
KOG4162		799	consensus Predicted calmodulin-binding protein [Si	98.51
KOG1155		559	consensus Anaphase-promoting complex (APC), Cdc23	98.51
PRK11189		296	lipoprotein NlpI; Provisional	98.51
KOG4162		799	consensus Predicted calmodulin-binding protein [Si	98.49
PF12569		517	NARP1: NMDA receptor-regulated protein 1 ; InterPr	98.46
PF10345		608	Cohesin_load: Cohesin loading factor; InterPro: IP	98.46
TIGR03302		235	OM_YfiO outer membrane assembly lipoprotein YfiO.	98.45
PF13424		78	TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15	98.45
PF14938		282	SNAP: Soluble NSF attachment protein, SNAP; PDB: 1	98.44
PLN03077		857	Protein ECB2; Provisional	98.32
PLN03218		1060	maturation of RBCL 1; Provisional	98.25
PRK15179		694	Vi polysaccharide biosynthesis protein TviE; Provi	98.25
KOG1173		611	consensus Anaphase-promoting complex (APC), Cdc16	98.2
PLN03077		857	Protein ECB2; Provisional	98.2
PLN03081		697	pentatricopeptide (PPR) repeat-containing protein;	98.19
PRK15359		144	type III secretion system chaperone protein SscB;	98.18
PF09976		145	TPR_21: Tetratricopeptide repeat; InterPro: IPR018	98.17
KOG1129		478	consensus TPR repeat-containing protein [General f	98.16
CHL00033		168	ycf3 photosystem I assembly protein Ycf3	98.15
PF13429		280	TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2	98.14
PRK10370		198	formate-dependent nitrite reductase complex subuni	98.13
PRK15359		144	type III secretion system chaperone protein SscB;	98.12
PF09976		145	TPR_21: Tetratricopeptide repeat; InterPro: IPR018	98.1
COG2956		389	Predicted N-acetylglucosaminyl transferase [Carboh	98.1
KOG1125		579	consensus TPR repeat-containing protein [General f	98.09
PRK02603		172	photosystem I assembly protein Ycf3; Provisional	98.07
KOG2003		840	consensus TPR repeat-containing protein [General f	98.06
CHL00033		168	ycf3 photosystem I assembly protein Ycf3	98.02
KOG1129		478	consensus TPR repeat-containing protein [General f	98.01
PRK02603		172	photosystem I assembly protein Ycf3; Provisional	97.99
KOG0624		504	consensus dsRNA-activated protein kinase inhibitor	97.97
PRK15179		694	Vi polysaccharide biosynthesis protein TviE; Provi	97.94
COG3071		400	HemY Uncharacterized enzyme of heme biosynthesis [	97.93
KOG1174		564	consensus Anaphase-promoting complex (APC), subuni	97.91
KOG0495		913	consensus HAT repeat protein [RNA processing and m	97.89
KOG1127		1238	consensus TPR repeat-containing protein [RNA proce	97.88
KOG2076		895	consensus RNA polymerase III transcription factor	97.85
KOG0550		486	consensus Molecular chaperone (DnaJ superfamily) [	97.84
PF12862		94	Apc5: Anaphase-promoting complex subunit 5	97.83
TIGR02552		135	LcrH_SycD type III secretion low calcium response	97.8
TIGR02795		119	tol_pal_ybgF tol-pal system protein YbgF. Members	97.79
PF12688		120	TPR_5: Tetratrico peptide repeat	97.78
PRK10153		517	DNA-binding transcriptional activator CadC; Provis	97.76
TIGR02795		119	tol_pal_ybgF tol-pal system protein YbgF. Members	97.72
cd00189		100	TPR Tetratricopeptide repeat domain; typically con	97.66
KOG0550		486	consensus Molecular chaperone (DnaJ superfamily) [	97.65
PF13414		69	TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A	97.63
PF13414		69	TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A	97.63
PRK15363		157	pathogenicity island 2 chaperone protein SscA; Pro	97.62
cd00189		100	TPR Tetratricopeptide repeat domain; typically con	97.61
PRK10866		243	outer membrane biogenesis protein BamD; Provisiona	97.58
PRK10370		198	formate-dependent nitrite reductase complex subuni	97.57
TIGR02552		135	LcrH_SycD type III secretion low calcium response	97.54
KOG4555		175	consensus TPR repeat-containing protein [Function	97.51
PLN03088		356	SGT1, suppressor of G2 allele of SKP1; Provisional	97.51
PF12569		517	NARP1: NMDA receptor-regulated protein 1 ; InterPr	97.49
KOG0553		304	consensus TPR repeat-containing protein [General f	97.44
PRK10866		243	outer membrane biogenesis protein BamD; Provisiona	97.44
PF13525		203	YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M	97.42
PF12688		120	TPR_5: Tetratrico peptide repeat	97.38
KOG1156		700	consensus N-terminal acetyltransferase [Chromatin	97.34
PLN03088		356	SGT1, suppressor of G2 allele of SKP1; Provisional	97.3
KOG1127		1238	consensus TPR repeat-containing protein [RNA proce	97.28
KOG0548		539	consensus Molecular co-chaperone STI1 [Posttransla	97.26
KOG0624		504	consensus dsRNA-activated protein kinase inhibitor	97.21
KOG1125		579	consensus TPR repeat-containing protein [General f	97.21
PF12895		84	Apc3: Anaphase-promoting complex, cyclosome, subun	97.2
PRK15363		157	pathogenicity island 2 chaperone protein SscA; Pro	97.2
PF12895		84	Apc3: Anaphase-promoting complex, cyclosome, subun	97.18
PF09295		395	ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter	97.17
PF13432		65	TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL	97.16
COG5010		257	TadD Flp pilus assembly protein TadD, contains TPR	97.15
PF13525		203	YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M	97.13
COG2956		389	Predicted N-acetylglucosaminyl transferase [Carboh	97.09
KOG1128		777	consensus Uncharacterized conserved protein, conta	97.09
KOG0495		913	consensus HAT repeat protein [RNA processing and m	97.03
KOG1156		700	consensus N-terminal acetyltransferase [Chromatin	97.0
PLN02789		320	farnesyltranstransferase	96.99
COG5010		257	TadD Flp pilus assembly protein TadD, contains TPR	96.95
COG3071		400	HemY Uncharacterized enzyme of heme biosynthesis [	96.93
KOG1174		564	consensus Anaphase-promoting complex (APC), subuni	96.91
PLN03098		453	LPA1 LOW PSII ACCUMULATION1; Provisional	96.9
KOG0543		397	consensus FKBP-type peptidyl-prolyl cis-trans isom	96.86
PF13432		65	TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL	96.76
PF09295		395	ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter	96.72
PRK10803		263	tol-pal system protein YbgF; Provisional	96.69
KOG1586		288	consensus Protein required for fusion of vesicles	96.67
COG2909		894	MalT ATP-dependent transcriptional regulator [Tran	96.67
PF14559		68	TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN	96.61
PRK10153		517	DNA-binding transcriptional activator CadC; Provis	96.56
KOG3060		289	consensus Uncharacterized conserved protein [Funct	96.49
COG4235		287	Cytochrome c biogenesis factor [Posttranslational	96.44
KOG2376		652	consensus Signal recognition particle, subunit Srp	96.4
PRK15331		165	chaperone protein SicA; Provisional	96.4
KOG1915		677	consensus Cell cycle control protein (crooked neck	96.38
COG2909		894	MalT ATP-dependent transcriptional regulator [Tran	96.36
PRK10803		263	tol-pal system protein YbgF; Provisional	96.32
PF13176		36	TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_	96.3
PLN03098		453	LPA1 LOW PSII ACCUMULATION1; Provisional	96.17
PRK11906		458	transcriptional regulator; Provisional	96.15
PRK15331		165	chaperone protein SicA; Provisional	96.12
PF12968		144	DUF3856: Domain of Unknown Function (DUF3856); Int	96.09
PF13371		73	TPR_9: Tetratricopeptide repeat	96.01
COG4783		484	Putative Zn-dependent protease, contains TPR repea	95.95
KOG0553		304	consensus TPR repeat-containing protein [General f	95.9
PRK14720		906	transcript cleavage factor/unknown domain fusion p	95.86
COG4235		287	Cytochrome c biogenesis factor [Posttranslational	95.82
KOG0543		397	consensus FKBP-type peptidyl-prolyl cis-trans isom	95.79
COG4700		251	Uncharacterized protein conserved in bacteria cont	95.76
PF07719		34	TPR_2: Tetratricopeptide repeat; InterPro: IPR0131	95.7
PF00515		34	TPR_1: Tetratricopeptide repeat; InterPro: IPR0014	95.69
PF04733		290	Coatomer_E: Coatomer epsilon subunit; InterPro: IP	95.62
KOG1585		308	consensus Protein required for fusion of vesicles	95.58
PRK11906		458	transcriptional regulator; Provisional	95.57
PF12968		144	DUF3856: Domain of Unknown Function (DUF3856); Int	95.52
KOG4555		175	consensus TPR repeat-containing protein [Function	95.47
PF09986		214	DUF2225: Uncharacterized protein conserved in bact	95.45
COG4783		484	Putative Zn-dependent protease, contains TPR repea	95.26
KOG3060		289	consensus Uncharacterized conserved protein [Funct	95.22
PF12862		94	Apc5: Anaphase-promoting complex subunit 5	95.18
PF14559		68	TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN	95.15
PF00515		34	TPR_1: Tetratricopeptide repeat; InterPro: IPR0014	95.1
PF13374		42	TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT	95.04
COG4105		254	ComL DNA uptake lipoprotein [General function pred	95.03
KOG1128		777	consensus Uncharacterized conserved protein, conta	95.02
PF07719		34	TPR_2: Tetratricopeptide repeat; InterPro: IPR0131	94.98
PLN02789		320	farnesyltranstransferase	94.96
PRK14720		906	transcript cleavage factor/unknown domain fusion p	94.96
COG1729		262	Uncharacterized protein conserved in bacteria [Fun	94.88
KOG2796		366	consensus Uncharacterized conserved protein [Funct	94.63
PF13181		34	TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_	94.59
KOG2047		835	consensus mRNA splicing factor [RNA processing and	94.54
PF13176		36	TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_	94.44
KOG1070		1710	consensus rRNA processing protein Rrp5 [RNA proces	94.29
COG2976		207	Uncharacterized protein conserved in bacteria [Fun	94.26
KOG3617		1416	consensus WD40 and TPR repeat-containing protein [	94.24
PF04733		290	Coatomer_E: Coatomer epsilon subunit; InterPro: IP	94.08
COG0457		291	NrfG FOG: TPR repeat [General function prediction	94.05
KOG4340		459	consensus Uncharacterized conserved protein [Funct	93.95
PF13371		73	TPR_9: Tetratricopeptide repeat	93.87
COG1729		262	Uncharacterized protein conserved in bacteria [Fun	93.86
KOG2471		696	consensus TPR repeat-containing protein [General f	93.63
PF10602		177	RPN7: 26S proteasome subunit RPN7; InterPro: IPR01	93.58
PF10300		468	DUF3808: Protein of unknown function (DUF3808); In	93.55
PF13181		34	TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_	93.54
KOG1070		1710	consensus rRNA processing protein Rrp5 [RNA proces	93.52
PF04184		539	ST7: ST7 protein; InterPro: IPR007311 The ST7 (for	93.45
COG2976		207	Uncharacterized protein conserved in bacteria [Fun	93.22
COG4785		297	NlpI Lipoprotein NlpI, contains TPR repeats [Gener	93.22
PF13374		42	TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT	92.94
PF08631		278	SPO22: Meiosis protein SPO22/ZIP4 like; InterPro:	92.93
KOG2047		835	consensus mRNA splicing factor [RNA processing and	92.93
PF08631		278	SPO22: Meiosis protein SPO22/ZIP4 like; InterPro:	92.91
PF13512		142	TPR_18: Tetratricopeptide repeat	92.86
KOG4648		536	consensus Uncharacterized conserved protein, conta	92.69
KOG3081		299	consensus Vesicle coat complex COPI, epsilon subun	92.49
PF13428		44	TPR_14: Tetratricopeptide repeat	92.39
PF09986		214	DUF2225: Uncharacterized protein conserved in bact	92.32
KOG4507		886	consensus Uncharacterized conserved protein, conta	92.3
COG4700		251	Uncharacterized protein conserved in bacteria cont	92.26
KOG4642		284	consensus Chaperone-dependent E3 ubiquitin protein	92.03
KOG1586		288	consensus Protein required for fusion of vesicles	91.7
COG4105		254	ComL DNA uptake lipoprotein [General function pred	91.54
PF03704		146	BTAD: Bacterial transcriptional activator domain;	91.53
KOG3081		299	consensus Vesicle coat complex COPI, epsilon subun	91.31
KOG2376		652	consensus Signal recognition particle, subunit Srp	90.91
KOG3785		557	consensus Uncharacterized conserved protein [Funct	90.65
PF10602		177	RPN7: 26S proteasome subunit RPN7; InterPro: IPR01	90.39
KOG2581		493	consensus 26S proteasome regulatory complex, subun	90.38
PF10579		80	Rapsyn_N: Rapsyn N-terminal myristoylation and lin	90.03
KOG4234		271	consensus TPR repeat-containing protein [General f	89.97
KOG1585		308	consensus Protein required for fusion of vesicles	89.83
PF11207		203	DUF2989: Protein of unknown function (DUF2989); In	89.35
smart00028		34	TPR Tetratricopeptide repeats. Repeats present in	89.13
PF13428		44	TPR_14: Tetratricopeptide repeat	88.5
PF11817		247	Foie-gras_1: Foie gras liver health family 1; Inte	88.1
PF10300		468	DUF3808: Protein of unknown function (DUF3808); In	88.09
PF03704		146	BTAD: Bacterial transcriptional activator domain;	88.08
PF13431		34	TPR_17: Tetratricopeptide repeat	87.57
KOG1839		1236	consensus Uncharacterized protein CLU1/cluA/TIF31	85.92
KOG4234		271	consensus TPR repeat-containing protein [General f	85.81
KOG2471		696	consensus TPR repeat-containing protein [General f	85.31
smart00028		34	TPR Tetratricopeptide repeats. Repeats present in	84.89
COG0457		291	NrfG FOG: TPR repeat [General function prediction	84.67
KOG0551		390	consensus Hsp90 co-chaperone CNS1 (contains TPR re	84.46
PF13512		142	TPR_18: Tetratricopeptide repeat	83.82
KOG4642		284	consensus Chaperone-dependent E3 ubiquitin protein	83.56
PF07721		26	TPR_4: Tetratricopeptide repeat; InterPro: IPR0117	83.12
PF10516		38	SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat	82.9
PF13174		33	TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_	82.24
KOG4648		536	consensus Uncharacterized conserved protein, conta	82.12
KOG3617		1416	consensus WD40 and TPR repeat-containing protein [	81.17
COG4649		221	Uncharacterized protein conserved in bacteria [Fun	80.94
COG0790		292	FOG: TPR repeat, SEL1 subfamily [General function	80.25

>KOG2300 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

Probab=100.00  E-value=2.9e-109  Score=878.74  Aligned_cols=601  Identities=40%  Similarity=0.637  Sum_probs=539.1

Q ss_pred             hhHHHHHHHhHHHhhhc--ccHhHHhHHHHHHhccCCCCChHHHHHHHHHHHHHHHHhhcchHHHHHHHHHHHHHhhcCC
Q 005266            2 EAVAEGLWGLADYHENK--GEIGKAVKCLEAICQSHVSFLPIIEVKTRLRISTLLLKHTHNVNHAKSHLERSQLLLKAIP   79 (705)
Q Consensus         2 ~~~~~~L~~lAe~~~~~--~~i~~ai~CLea~~~~~~~~~p~~EA~~rLrla~iL~e~T~N~~~A~thLeka~~l~~~i~   79 (705)
                      |+||++||||||+|||+  |+|++|||||+|+|+|++  |-++|||||||+|.+||.||+|++.|+.||||||.++++||
T Consensus         4 dAva~aLlGlAe~~rt~~PPkIkk~IkClqA~~~~~i--s~~veart~LqLg~lL~~yT~N~elAksHLekA~~i~~~ip   81 (629)
T KOG2300|consen    4 DAVAEALLGLAEHFRTSGPPKIKKCIKCLQAIFQFQI--SFLVEARTHLQLGALLLRYTKNVELAKSHLEKAWLISKSIP   81 (629)
T ss_pred             hHHHHHHHHHHHHHhhcCChhHHHHHHHHHHHhccCC--hHHHHHHHHHHHHHHHHHHhccHHHHHHHHHHHHHHHcccc
Confidence            59999999999999999  599999999999999999  88999999999999999999999999999999999999999


Q ss_pred             chhhhhhhHHHHHHHHHHHcC-CChhHHHHHHHHHhhccccccccccchhhHhHHHHHHHHHhhcCCHHHHHHHHHHHHH
Q 005266           80 SCFELKCRTFSLLSQCYHLVG-AIPPQKLILYKALDLTSSASQDVAVKLWSCNFNSQLANAFIIEGDYQSSISALQSGYV  158 (705)
Q Consensus        80 ~~~dlK~~~~~lLA~~y~~~~-~~~~ak~~l~kai~~~~~~~~~~~~~~W~~~f~~~lA~~~~~~~d~~~A~~~L~~~~~  158 (705)
                      +|+|+||.++++||++|++.+ +.+++|+.++|||+++.+      .++|+|+|+||||++|.+++||.+|++.|..|+.
T Consensus        82 ~fydvKf~a~SlLa~lh~~~~~s~~~~KalLrkaielsq~------~p~wsckllfQLaql~~idkD~~sA~elLavga~  155 (629)
T KOG2300|consen   82 SFYDVKFQAASLLAHLHHQLAQSFPPAKALLRKAIELSQS------VPYWSCKLLFQLAQLHIIDKDFPSALELLAVGAE  155 (629)
T ss_pred             cHHhhhhHHHHHHHHHHHHhcCCCchHHHHHHHHHHHhcC------CchhhHHHHHHHHHHHhhhccchhHHHHHhcccc
Confidence            999999999999999999999 779999999999999997      7899999999999999999999999999999999


Q ss_pred             HHhhcCCchHHHHHHHHHHHHHhcccCChhHHHHHHHHhHHHhhhcCcccccccccchhhhhHHHHHH-HHhhhhhhhhh
Q 005266          159 CATEISYPDLQMFFATAILHVHLMQWDDENSVLRSINQCDRVWESIDPNRRGQCLGLLFYNELLHIFY-RLRICDYKNAA  237 (705)
Q Consensus       159 ~A~~~~~~~~~~~~~La~~~~~L~~~~~~~~v~~al~~~~~~~~~~~~~~~~~~~G~~~~~E~l~v~~-~L~vc~~~~~~  237 (705)
                      .|...+.++.+++|.++.+++++|+| +..+|++++++|+++|+        +|++-+.++|+||||| +|++|.|+..|
T Consensus       156 sAd~~~~~ylr~~ftls~~~ll~me~-d~~dV~~ll~~~~qi~~--------n~~sdk~~~E~LkvFyl~lql~yy~~~g  226 (629)
T KOG2300|consen  156 SADHICFPYLRMLFTLSMLMLLIMER-DDYDVEKLLQRCGQIWQ--------NISSDKTQKEMLKVFYLVLQLSYYLLPG  226 (629)
T ss_pred             ccchhhhHHHHHHHHHHHHHHHHhCc-cHHHHHHHHHHHHHHHh--------ccCCChHHHHHHHHHHHHHHHHHHhccc
Confidence            99999999999999999999999996 78899999999999997        6666778899999999 89999999999


Q ss_pred             hhhhhhHHHHHHHHHHHHHHHHHhhhhHHhhhhcCCCCCChhhhhHHHHHHHHHHHHHHhccCCCCCccccccccccCCc
Q 005266          238 HHVDNLDAAMKADKQKMQEIQQLSSELDALNQSLSRPDLPSRERSALAGRQAKLQQRLRSLEDSSLTGKEFLEPSYFGNA  317 (705)
Q Consensus       238 ~~v~~l~~~l~~~~qk~~~~q~l~~~l~~l~~~L~~~~~~~~~~~~l~~~~~~lq~~i~~~~~~~~~~~~~l~~~~~~~~  317 (705)
                      + |+.+++|+                                         +|||+.|+++.++++-             
T Consensus       227 q-~rt~k~~l-----------------------------------------kQLQ~siqtist~~~~-------------  251 (629)
T KOG2300|consen  227 Q-VRTVKPAL-----------------------------------------KQLQDSIQTISTSSRG-------------  251 (629)
T ss_pred             c-hhhhHHHH-----------------------------------------HHHHHHHhccCCCCCC-------------
Confidence            8 66666665                                         5888999995555433             


Q ss_pred             ccccccccccCC-CCcccccccchhhHHHHHHHHHHHhcCCCChHHHHHHHHHHHHHHHHHHHhcCCCCCccccchhhhH
Q 005266          318 RQAWGDKLVLAP-SPMDGEWLPKSAVYALVDLMVVILGRPKGLFKECMQRIQSGMQTIQDALLKLGITDGVREVDLQHSA  396 (705)
Q Consensus       318 ~~~~~~~~~~~~-~~l~~~WLpk~~~~aL~yll~~~~~~~~g~~~ka~k~l~~al~~i~~~l~~~~~~~~~~e~~l~~~~  396 (705)
                         .+++ .+|. ++..|.||||+++|||||+++++++|++|+|+||.||.+|++..    ++++...|.          
T Consensus       252 ---h~e~-ilgsps~~l~~wlpkeqicaLV~l~tv~hsm~~gy~~~~~K~tDe~i~q----~eklkq~d~----------  313 (629)
T KOG2300|consen  252 ---HDEK-ILGSPSPILFEWLPKEQICALVYLVTVIHSMPAGYFKKAQKYTDEAIKQ----TEKLKQADL----------  313 (629)
T ss_pred             ---cccc-ccCCCChHHHhhccHhhhHhhhhhhHHhhhhhhHHHHHHHHHHHHHHHH----Hhhcccccc----------
Confidence               2334 4554 45669999999999999999999999999999999999999998    444443332          


Q ss_pred             HHHHHHHHHHHHHHHhHHHHHhhhhhhhHHhhhh-------------------hHHHHHHHHHHHHHHcCCHHHHHHHHH
Q 005266          397 IWMAGVYLMLLMQFLENKVAVELTRSGFVEAQEA-------------------CESMIEMLRGQYAHSVGCYSEAAFHYV  457 (705)
Q Consensus       397 ~w~~~~~~~l~~~~Le~~~~~~L~~~~~~~a~~~-------------------~~a~~~~llG~~~~~~g~~~eA~~~f~  457 (705)
                        +.+++.|++|++||++++|++++++.++|.+.                   .+|++|+++|.|+++.|++++|+.||.
T Consensus       314 --~srilsm~km~~LE~iv~c~lv~~~~~~al~~i~dm~~w~~r~p~~~Llr~~~~~ih~LlGlys~sv~~~enAe~hf~  391 (629)
T KOG2300|consen  314 --MSRILSMFKMILLEHIVMCRLVRGDYVEALEEIVDMKNWCTRFPTPLLLRAHEAQIHMLLGLYSHSVNCYENAEFHFI  391 (629)
T ss_pred             --hhHHHHHHHHHHHHHHHHHHHHhCCHHHHHHHHHHHHHHHHhCCchHHHHHhHHHHHHHHhhHhhhcchHHHHHHHHH
Confidence              33666788999999999999998888877543                   579999999999999999999999999


Q ss_pred             HHHHhcCChhHHHHHHHHHHHHHHhhCChhhHHHHHHhhccccccCCccchhhhHHHHHHHHHHHHHHhcCHHHHHHHHH
Q 005266          458 EAAKITESKSMQAMCHAYAAVSYFCIGDAESSSQAIDLIGPVYQMKDTINGVREEASLHFAYGLLLMRQQDFQEARNRLA  537 (705)
Q Consensus       458 ~Al~l~~~~~g~a~a~~nlalv~l~~gd~d~~~~ALeli~~~~~~~~~~~g~~~qA~al~~lG~~~~~~g~~~eA~~~L~  537 (705)
                      .|.+++.+...+++|.+|+|++|++.|+.+.+.+++|.++|..+++-++..+  ++.++|+.|+..+.+++++||+++++
T Consensus       392 ~a~k~t~~~dl~a~~nlnlAi~YL~~~~~ed~y~~ld~i~p~nt~s~ssq~l--~a~~~~v~glfaf~qn~lnEaK~~l~  469 (629)
T KOG2300|consen  392 EATKLTESIDLQAFCNLNLAISYLRIGDAEDLYKALDLIGPLNTNSLSSQRL--EASILYVYGLFAFKQNDLNEAKRFLR  469 (629)
T ss_pred             HHHHhhhHHHHHHHHHHhHHHHHHHhccHHHHHHHHHhcCCCCCCcchHHHH--HHHHHHHHHHHHHHhccHHHHHHHHH
Confidence            9999999999999999999999999999888999999999976555444444  89999999999999999999999999


Q ss_pred             HHHHHHHhcccCHHHHHHHHHHHHHHHHHCCChHHHHHHHHHHHHHHHHcCChhhHHHHHHHHHHHHHHcCCchHHHHHH
Q 005266          538 KGLQIAHNHMGNLQLVSQYLTILGNLALALHDTVQAREILRSSLTLAKKLYDIPTQIWALSVLTALYQQLGDRGNEMEND  617 (705)
Q Consensus       538 eAL~la~~e~gn~~l~a~aL~~LG~i~~~lg~~~qA~~~~~~Al~LArk~gD~~~q~~al~~L~~l~~~~Gd~~~A~e~~  617 (705)
                      ++|+++|.++ +-|++++.|++||++++..|++.||+++++++++||+|++|+++|+|++..+.++|+++|+-+..++.-
T Consensus       470 e~Lkmanaed-~~rL~a~~LvLLs~v~lslgn~~es~nmvrpamqlAkKi~Di~vqLws~si~~~L~~a~g~~~~~~e~e  548 (629)
T KOG2300|consen  470 ETLKMANAED-LNRLTACSLVLLSHVFLSLGNTVESRNMVRPAMQLAKKIPDIPVQLWSSSILTDLYQALGEKGNEMENE  548 (629)
T ss_pred             HHHhhcchhh-HHHHHHHHHHHHHHHHHHhcchHHHHhccchHHHHHhcCCCchHHHHHHHHHHHHHHHhCcchhhHHHH
Confidence            9999997654 559999999999999999999999999999999999999999999999999999999999965554443


Q ss_pred             HHHHHHHHHHHHHHHHhhcchhhHHHHhhhccchhccchhhHHHhhhcccccccccCCcccCCCCCCCCcccccccccCC
Q 005266          618 EYRRKKLDELQKRLADAYSSIHHIELISKVKLEVQQFHELDIKRAMANQSMSVNLDIPESIGLSTPLPVQSSSRLIDLDG  697 (705)
Q Consensus       618 ~~~~~~~~~l~~~~~~a~~~~~h~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  697 (705)
                      ...+   +.+.++...|..+++|.++....++.++++.+-+.  ...+|+|+.|||||| +||.+|.|+|||+|+|.+|+
T Consensus       549 ~~~~---~ql~Sr~lla~~~i~~~~~~~pa~~ll~wfdgdPp--v~s~p~~~~~l~~pe-t~l~~~~p~~~ss~~~~~~~  622 (629)
T KOG2300|consen  549 AFRK---HQLQSRLLLADGSIHHIELVAPAHILLYWFDGDPP--VASAPSMQGNLDIPE-TSLEGPSPAPSSSRLVGLDT  622 (629)
T ss_pred             HHHH---HHHHHHHHHhccCcchHhhcccHHhhhhhccCCCc--cccCCccCCccCCCc-ccccCCCCCccccccccCcc
Confidence            3333   66777777888888888888788888777755443  457899999999999 99999999999999999999


Q ss_pred             -CCcccc
Q 005266          698 -GRRGKR  703 (705)
Q Consensus       698 -~~~~~~  703 (705)
                       +|||||
T Consensus       623 g~~~~~~  629 (629)
T KOG2300|consen  623 GKRWGKR  629 (629)
T ss_pred             cccccCC
Confidence             788886

>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi	Back alignment and domain information

>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein	Back alignment and domain information

>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein	Back alignment and domain information

>PRK11447 cellulose synthase subunit BcsC; Provisional	Back alignment and domain information

>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70)	Back alignment and domain information

>PRK11447 cellulose synthase subunit BcsC; Provisional	Back alignment and domain information

>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>PRK15174 Vi polysaccharide export protein VexE; Provisional	Back alignment and domain information

>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional	Back alignment and domain information

>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70)	Back alignment and domain information

>PRK15174 Vi polysaccharide export protein VexE; Provisional	Back alignment and domain information

>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG1840 consensus Kinesin light chain [Cytoskeleton]	Back alignment and domain information

>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional	Back alignment and domain information

>PRK10049 pgaA outer membrane protein PgaA; Provisional	Back alignment and domain information

>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms]	Back alignment and domain information

>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>PRK10049 pgaA outer membrane protein PgaA; Provisional	Back alignment and domain information

>KOG1840 consensus Kinesin light chain [Cytoskeleton]	Back alignment and domain information

>PRK11788 tetratricopeptide repeat protein; Provisional	Back alignment and domain information

>PRK14574 hmsH outer membrane protein; Provisional	Back alignment and domain information

>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms]	Back alignment and domain information

>PRK11788 tetratricopeptide repeat protein; Provisional	Back alignment and domain information

>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures]	Back alignment and domain information

>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription]	Back alignment and domain information

>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW	Back alignment and domain information

>PRK04841 transcriptional regulator MalT; Provisional	Back alignment and domain information

>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>TIGR00540 hemY_coli hemY protein	Back alignment and domain information

>PRK04841 transcriptional regulator MalT; Provisional	Back alignment and domain information

>PRK10747 putative protoheme IX biogenesis protein; Provisional	Back alignment and domain information

>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW	Back alignment and domain information

>PRK14574 hmsH outer membrane protein; Provisional	Back alignment and domain information

>KOG2300 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals	Back alignment and domain information

>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals	Back alignment and domain information

>PRK12370 invasion protein regulator; Provisional	Back alignment and domain information

>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO	Back alignment and domain information

>PRK11189 lipoprotein NlpI; Provisional	Back alignment and domain information

>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN03218 maturation of RBCL 1; Provisional	Back alignment and domain information

>TIGR00540 hemY_coli hemY protein	Back alignment and domain information

>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B	Back alignment and domain information

>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK12370 invasion protein regulator; Provisional	Back alignment and domain information

>KOG2003 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H	Back alignment and domain information

>PRK10747 putative protoheme IX biogenesis protein; Provisional	Back alignment and domain information

>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A	Back alignment and domain information

>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures]	Back alignment and domain information

>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional	Back alignment and domain information

>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms]	Back alignment and domain information

>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK11189 lipoprotein NlpI; Provisional	Back alignment and domain information

>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms]	Back alignment and domain information

>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala	Back alignment and domain information

>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi	Back alignment and domain information

>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO	Back alignment and domain information

>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H	Back alignment and domain information

>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A	Back alignment and domain information

>PLN03077 Protein ECB2; Provisional	Back alignment and domain information

>PLN03218 maturation of RBCL 1; Provisional	Back alignment and domain information

>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional	Back alignment and domain information

>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN03077 Protein ECB2; Provisional	Back alignment and domain information

>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional	Back alignment and domain information

>PRK15359 type III secretion system chaperone protein SscB; Provisional	Back alignment and domain information

>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function	Back alignment and domain information

>KOG1129 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>CHL00033 ycf3 photosystem I assembly protein Ycf3	Back alignment and domain information

>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B	Back alignment and domain information

>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional	Back alignment and domain information

>PRK15359 type III secretion system chaperone protein SscB; Provisional	Back alignment and domain information

>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function	Back alignment and domain information

>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism]	Back alignment and domain information

>KOG1125 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>PRK02603 photosystem I assembly protein Ycf3; Provisional	Back alignment and domain information

>KOG2003 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>CHL00033 ycf3 photosystem I assembly protein Ycf3	Back alignment and domain information

>KOG1129 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>PRK02603 photosystem I assembly protein Ycf3; Provisional	Back alignment and domain information

>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms]	Back alignment and domain information

>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional	Back alignment and domain information

>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism]	Back alignment and domain information

>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0495 consensus HAT repeat protein [RNA processing and modification]	Back alignment and domain information

>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification]	Back alignment and domain information

>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription]	Back alignment and domain information

>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF12862 Apc5: Anaphase-promoting complex subunit 5	Back alignment and domain information

>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD	Back alignment and domain information

>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF	Back alignment and domain information

>PF12688 TPR_5: Tetratrico peptide repeat	Back alignment and domain information

>PRK10153 DNA-binding transcriptional activator CadC; Provisional	Back alignment and domain information

>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF	Back alignment and domain information

>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C

Back alignment and domain information

>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A	Back alignment and domain information

>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A	Back alignment and domain information

>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional	Back alignment and domain information

Back alignment and domain information

>PRK10866 outer membrane biogenesis protein BamD; Provisional	Back alignment and domain information

>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional	Back alignment and domain information

>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD	Back alignment and domain information

>KOG4555 consensus TPR repeat-containing protein [Function unknown]	Back alignment and domain information

>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional	Back alignment and domain information

>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala	Back alignment and domain information

>KOG0553 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>PRK10866 outer membrane biogenesis protein BamD; Provisional	Back alignment and domain information

>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A	Back alignment and domain information

>PF12688 TPR_5: Tetratrico peptide repeat	Back alignment and domain information

>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics]	Back alignment and domain information

>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional	Back alignment and domain information

>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification]	Back alignment and domain information

>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms]	Back alignment and domain information

>KOG1125 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A	Back alignment and domain information

>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional	Back alignment and domain information

>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A	Back alignment and domain information

>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi	Back alignment and domain information

>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B	Back alignment and domain information

>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion]	Back alignment and domain information

>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A	Back alignment and domain information

>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism]	Back alignment and domain information

>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only]	Back alignment and domain information

>KOG0495 consensus HAT repeat protein [RNA processing and modification]	Back alignment and domain information

>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics]	Back alignment and domain information

>PLN02789 farnesyltranstransferase	Back alignment and domain information

>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion]	Back alignment and domain information

>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism]	Back alignment and domain information

>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional	Back alignment and domain information

>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B	Back alignment and domain information

>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi	Back alignment and domain information

>PRK10803 tol-pal system protein YbgF; Provisional	Back alignment and domain information

>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG2909 MalT ATP-dependent transcriptional regulator [Transcription]	Back alignment and domain information

>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A	Back alignment and domain information

>PRK10153 DNA-binding transcriptional activator CadC; Provisional	Back alignment and domain information

>KOG3060 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK15331 chaperone protein SicA; Provisional	Back alignment and domain information

>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>COG2909 MalT ATP-dependent transcriptional regulator [Transcription]	Back alignment and domain information

>PRK10803 tol-pal system protein YbgF; Provisional	Back alignment and domain information

>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A	Back alignment and domain information

>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional	Back alignment and domain information

>PRK11906 transcriptional regulator; Provisional	Back alignment and domain information

>PRK15331 chaperone protein SicA; Provisional	Back alignment and domain information

>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT	Back alignment and domain information

>PF13371 TPR_9: Tetratricopeptide repeat	Back alignment and domain information

>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only]	Back alignment and domain information

>KOG0553 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional	Back alignment and domain information

>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown]	Back alignment and domain information

>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ]	Back alignment and domain information

>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ]	Back alignment and domain information

>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK11906 transcriptional regulator; Provisional	Back alignment and domain information

>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT	Back alignment and domain information

>KOG4555 consensus TPR repeat-containing protein [Function unknown]	Back alignment and domain information

>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function	Back alignment and domain information

>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only]	Back alignment and domain information

>KOG3060 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF12862 Apc5: Anaphase-promoting complex subunit 5	Back alignment and domain information

>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A	Back alignment and domain information

>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ]	Back alignment and domain information

>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A	Back alignment and domain information

>COG4105 ComL DNA uptake lipoprotein [General function prediction only]	Back alignment and domain information

>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only]	Back alignment and domain information

>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ]	Back alignment and domain information

>PLN02789 farnesyltranstransferase	Back alignment and domain information

>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional	Back alignment and domain information

>COG1729 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>KOG2796 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A	Back alignment and domain information

>KOG2047 consensus mRNA splicing factor [RNA processing and modification]	Back alignment and domain information

>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A	Back alignment and domain information

>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification]	Back alignment and domain information

>COG2976 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>COG0457 NrfG FOG: TPR repeat [General function prediction only]	Back alignment and domain information

>KOG4340 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF13371 TPR_9: Tetratricopeptide repeat	Back alignment and domain information

>COG1729 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>KOG2471 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome	Back alignment and domain information

>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans	Back alignment and domain information

>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A	Back alignment and domain information

>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification]	Back alignment and domain information

>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene	Back alignment and domain information

>COG2976 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only]	Back alignment and domain information

>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A	Back alignment and domain information

>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis []	Back alignment and domain information

>KOG2047 consensus mRNA splicing factor [RNA processing and modification]	Back alignment and domain information

>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis []	Back alignment and domain information

>PF13512 TPR_18: Tetratricopeptide repeat	Back alignment and domain information

>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown]	Back alignment and domain information

>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF13428 TPR_14: Tetratricopeptide repeat	Back alignment and domain information

>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function	Back alignment and domain information

>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown]	Back alignment and domain information

>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown]	Back alignment and domain information

>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG4105 ComL DNA uptake lipoprotein [General function prediction only]	Back alignment and domain information

>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production	Back alignment and domain information

>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG3785 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome	Back alignment and domain information

>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane	Back alignment and domain information

>KOG4234 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed	Back alignment and domain information

>smart00028 TPR Tetratricopeptide repeats	Back alignment and domain information

>PF13428 TPR_14: Tetratricopeptide repeat	Back alignment and domain information

>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease []	Back alignment and domain information

>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans	Back alignment and domain information

>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production	Back alignment and domain information

>PF13431 TPR_17: Tetratricopeptide repeat	Back alignment and domain information

>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only]	Back alignment and domain information

>KOG4234 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG2471 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>smart00028 TPR Tetratricopeptide repeats	Back alignment and domain information

>COG0457 NrfG FOG: TPR repeat [General function prediction only]	Back alignment and domain information

>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13512 TPR_18: Tetratricopeptide repeat	Back alignment and domain information

>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models	Back alignment and domain information

>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ]	Back alignment and domain information

>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A	Back alignment and domain information

>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown]	Back alignment and domain information

>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>COG4649 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		705
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	6e-12
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	5e-07
3sf4_A		406	G-protein-signaling modulator 2; tetratricopeptide	1e-09
3sf4_A		406	G-protein-signaling modulator 2; tetratricopeptide	1e-04
3ulq_A		383	Response regulator aspartate phosphatase F; tetrat	9e-09
3ulq_A		383	Response regulator aspartate phosphatase F; tetrat	4e-06
3ulq_A		383	Response regulator aspartate phosphatase F; tetrat	2e-04
3gw4_A		203	Uncharacterized protein; structural genomics, PSI-	1e-08
3gw4_A		203	Uncharacterized protein; structural genomics, PSI-	2e-08
4a1s_A		411	PINS, partner of inscuteable; cell cycle, LGN, mit	5e-08
4a1s_A		411	PINS, partner of inscuteable; cell cycle, LGN, mit	1e-07
4a1s_A		411	PINS, partner of inscuteable; cell cycle, LGN, mit	1e-04
3q15_A		378	PSP28, response regulator aspartate phosphatase H;	2e-07
3q15_A		378	PSP28, response regulator aspartate phosphatase H;	6e-07
3q15_A		378	PSP28, response regulator aspartate phosphatase H;	3e-04
2ifu_A		307	Gamma-SNAP; membrane fusion, snare complex disasse	1e-06
3ro3_A		164	PINS homolog, G-protein-signaling modulator 2; asy	1e-06
3ro3_A		164	PINS homolog, G-protein-signaling modulator 2; asy	5e-05
3ro2_A		338	PINS homolog, G-protein-signaling modulator 2; TPR	2e-06
3ro2_A		338	PINS homolog, G-protein-signaling modulator 2; TPR	2e-06
3ro2_A		338	PINS homolog, G-protein-signaling modulator 2; TPR	2e-05
3ro2_A		338	PINS homolog, G-protein-signaling modulator 2; TPR	8e-05
1hz4_A		373	MALT regulatory protein; two-helix bundles, helix	9e-06

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

 Score = 68.3 bits (166), Expect = 6e-12
 Identities = 76/518 (14%), Positives = 153/518 (29%), Gaps = 173/518 (33%)

Query: 238 HHVDNLDAAMKADKQKMQEIQQLSSELDALNQSLSRPDLPSRERSALAGRQAKLQQRLRS 297
           HH  ++D      + + ++I  LS   DA   +    D+    +S L             
Sbjct: 2   HHHHHMDFETGEHQYQYKDI--LSVFEDAFVDNFDCKDVQDMPKSIL------------- 46

Query: 298 LEDSSLTGKEFLEPSYFGNARQAWGDKLVLAPSPMDGE----WL----PKSAVYALVD-- 347
                 + +E               D ++++   + G     W      +  V   V+  
Sbjct: 47  ------SKEEI--------------DHIIMSKDAVSGTLRLFWTLLSKQEEMVQKFVEEV 86

Query: 348 -------LMVVILGRPKG------LFKECMQRIQSGMQ--------------TIQDALLK 380
                  LM  I    +       ++ E   R+ +  Q               ++ ALL+
Sbjct: 87  LRINYKFLMSPIKTEQRQPSMMTRMYIEQRDRLYNDNQVFAKYNVSRLQPYLKLRQALLE 146

Query: 381 LGITDGVREVDLQHSAIWMAGVYLMLLMQFLENK--VAVELTRSGFVEAQEAC------- 431
           L     V    L      + G            K  VA+++  S  V+ +          
Sbjct: 147 LRPAKNV----LIDG---VLGS----------GKTWVALDVCLSYKVQCKMDFKIFWLNL 189

Query: 432 ------ESMIEMLRGQYAHSVGCYSEAAFHY------VEAAKITESKSMQAMCHAYA--- 476
                 E+++EML+         ++  + H       + + +    + +++  +      
Sbjct: 190 KNCNSPETVLEMLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSKPYENCLLV 249

Query: 477 --------AVSYFCIG--------DAESSSQAIDLIGPVYQMKDTINGVREEASLHFAYG 520
                   A + F +           + +            +      +  +        
Sbjct: 250 LLNVQNAKAWNAFNLSCKILLTTRFKQVTDFLSAATTTHISLDHHSMTLTPDEVK----S 305

Query: 521 LLL----MRQQDF-QEAR--NRLAKGLQIAHNHMGNLQLVSQYLTILGNLALALHDTVQA 573
           LLL     R QD  +E    N     + IA       + +   L    N      D +  
Sbjct: 306 LLLKYLDCRPQDLPREVLTTNPRRLSI-IA-------ESIRDGLATWDNWKHVNCDKLT- 356

Query: 574 REILRSSL-----TLAKKLY----------DIPTQIWALSVLTALYQQLGDRGNEMENDE 618
             I+ SSL        +K++           IPT      +L+ ++  +      +  ++
Sbjct: 357 -TIIESSLNVLEPAEYRKMFDRLSVFPPSAHIPTI-----LLSLIWFDVIKSDVMVVVNK 410

Query: 619 YRRKKLDELQKRLADAYSSIHHIELISKVKLE-VQQFH 655
             +  L  ++K+  ++  SI  I L  KVKLE     H
Sbjct: 411 LHKYSL--VEKQPKESTISIPSIYLELKVKLENEYALH 446

PyMOL of 1vt4

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406	Back alignment and structure

>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406	Back alignment and structure

>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383	Back alignment and structure

>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383	Back alignment and structure

>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383	Back alignment and structure

>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203	Back alignment and structure

>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203	Back alignment and structure

>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411	Back alignment and structure

>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411	Back alignment and structure

>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411	Back alignment and structure

>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378	Back alignment and structure

>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378	Back alignment and structure

>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378	Back alignment and structure

>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307	Back alignment and structure

>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164	Back alignment and structure

>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164	Back alignment and structure

>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338	Back alignment and structure

>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338	Back alignment and structure

>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338	Back alignment and structure

>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338	Back alignment and structure

>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		705
1w3b_A		388	UDP-N-acetylglucosamine--peptide N-acetylglucosami	99.84
1w3b_A		388	UDP-N-acetylglucosamine--peptide N-acetylglucosami	99.83
3sf4_A		406	G-protein-signaling modulator 2; tetratricopeptide	99.83
2xpi_A		597	Anaphase-promoting complex subunit CUT9; cell cycl	99.79
4a1s_A		411	PINS, partner of inscuteable; cell cycle, LGN, mit	99.79
3ro2_A		338	PINS homolog, G-protein-signaling modulator 2; TPR	99.77
2gw1_A		514	Mitochondrial precursor proteins import receptor;	99.77
3sf4_A		406	G-protein-signaling modulator 2; tetratricopeptide	99.76
3fp2_A		537	TPR repeat-containing protein YHR117W; TOM71, mito	99.75
3ieg_A		359	DNAJ homolog subfamily C member 3; TPR motif, chap	99.73
3ulq_A		383	Response regulator aspartate phosphatase F; tetrat	99.72
2y4t_A		450	DNAJ homolog subfamily C member 3; chaperone, endo	99.72
2xpi_A		597	Anaphase-promoting complex subunit CUT9; cell cycl	99.71
2y4t_A		450	DNAJ homolog subfamily C member 3; chaperone, endo	99.7
2gw1_A		514	Mitochondrial precursor proteins import receptor;	99.69
3ro2_A		338	PINS homolog, G-protein-signaling modulator 2; TPR	99.68
3ulq_A		383	Response regulator aspartate phosphatase F; tetrat	99.68
4a1s_A		411	PINS, partner of inscuteable; cell cycle, LGN, mit	99.67
3fp2_A		537	TPR repeat-containing protein YHR117W; TOM71, mito	99.67
3q15_A		378	PSP28, response regulator aspartate phosphatase H;	99.66
4g1t_A		472	Interferon-induced protein with tetratricopeptide	99.64
3ieg_A		359	DNAJ homolog subfamily C member 3; TPR motif, chap	99.64
1fch_A		368	Peroxisomal targeting signal 1 receptor; protein-p	99.61
3gw4_A		203	Uncharacterized protein; structural genomics, PSI-	99.6
3gw4_A		203	Uncharacterized protein; structural genomics, PSI-	99.59
3q15_A		378	PSP28, response regulator aspartate phosphatase H;	99.58
2ifu_A		307	Gamma-SNAP; membrane fusion, snare complex disasse	99.58
3nf1_A		311	KLC 1, kinesin light chain 1; TPR, structural geno	99.57
2xm6_A		490	Protein corresponding to locus C5321 from CFT073 s	99.55
3edt_B		283	KLC 2, kinesin light chain 2; superhelical, struct	99.55
3hym_B		330	Cell division cycle protein 16 homolog; APC, anaph	99.55
2xm6_A		490	Protein corresponding to locus C5321 from CFT073 s	99.54
1fch_A		368	Peroxisomal targeting signal 1 receptor; protein-p	99.53
3hym_B		330	Cell division cycle protein 16 homolog; APC, anaph	99.5
4eqf_A		365	PEX5-related protein; accessory protein, tetratric	99.48
1hz4_A		373	MALT regulatory protein; two-helix bundles, helix	99.48
1qqe_A		292	Vesicular transport protein SEC17; helix-turn-heli	99.48
3cv0_A		327	Peroxisome targeting signal 1 receptor PEX5; TPR m	99.47
3ro3_A		164	PINS homolog, G-protein-signaling modulator 2; asy	99.46
3nf1_A		311	KLC 1, kinesin light chain 1; TPR, structural geno	99.45
3ro3_A		164	PINS homolog, G-protein-signaling modulator 2; asy	99.45
2qfc_A		293	PLCR protein; TPR, HTH, transcription regulation;	99.43
1hz4_A		373	MALT regulatory protein; two-helix bundles, helix	99.43
2pl2_A		217	Hypothetical conserved protein TTC0263; TPR, prote	99.41
3u3w_A		293	Transcriptional activator PLCR protein; ternary co	99.4
2ifu_A		307	Gamma-SNAP; membrane fusion, snare complex disasse	99.37
3u3w_A		293	Transcriptional activator PLCR protein; ternary co	99.37
3cv0_A		327	Peroxisome targeting signal 1 receptor PEX5; TPR m	99.36
3vtx_A		184	MAMA; tetratricopeptide repeats (TPR) containing p	99.36
4gyw_A		723	UDP-N-acetylglucosamine--peptide N- acetylglucosam	99.36
4g1t_A		472	Interferon-induced protein with tetratricopeptide	99.35
4eqf_A		365	PEX5-related protein; accessory protein, tetratric	99.35
2pl2_A		217	Hypothetical conserved protein TTC0263; TPR, prote	99.34
3edt_B		283	KLC 2, kinesin light chain 2; superhelical, struct	99.34
3uq3_A		258	Heat shock protein STI1; HSP90, peptide binding, c	99.33
2qfc_A		293	PLCR protein; TPR, HTH, transcription regulation;	99.32
3u4t_A		272	TPR repeat-containing protein; structural genomics	99.29
1qqe_A		292	Vesicular transport protein SEC17; helix-turn-heli	99.29
3u4t_A		272	TPR repeat-containing protein; structural genomics	99.26
4i17_A		228	Hypothetical protein; TPR repeats protein, structu	99.25
2q7f_A		243	YRRB protein; TPR, protein binding; 2.49A {Bacillu	99.24
2ho1_A		252	Type 4 fimbrial biogenesis protein PILF; type IV p	99.23
3vtx_A		184	MAMA; tetratricopeptide repeats (TPR) containing p	99.23
4abn_A		474	Tetratricopeptide repeat protein 5; P53 cofactor,	99.22
4b4t_Q		434	26S proteasome regulatory subunit RPN6; hydrolase,	99.19
2vq2_A		225	PILW, putative fimbrial biogenesis and twitching m	99.17
3qky_A		261	Outer membrane assembly lipoprotein YFIO; membrane	99.15
4gyw_A		723	UDP-N-acetylglucosamine--peptide N- acetylglucosam	99.15
2vq2_A		225	PILW, putative fimbrial biogenesis and twitching m	99.14
1ouv_A		273	Conserved hypothetical secreted protein; TPR repea	99.13
3uq3_A		258	Heat shock protein STI1; HSP90, peptide binding, c	99.12
3qky_A		261	Outer membrane assembly lipoprotein YFIO; membrane	99.11
3as5_A		186	MAMA; tetratricopeptide repeats (TPR) containing p	99.11
2ho1_A		252	Type 4 fimbrial biogenesis protein PILF; type IV p	99.07
4i17_A		228	Hypothetical protein; TPR repeats protein, structu	99.07
4abn_A		474	Tetratricopeptide repeat protein 5; P53 cofactor,	99.05
4b4t_Q		434	26S proteasome regulatory subunit RPN6; hydrolase,	99.04
2h6f_A		382	Protein farnesyltransferase/geranylgeranyltransfer	99.03
3e4b_A		452	ALGK; tetratricopeptide repeat, superhelix, algina	99.03
4gcn_A		127	Protein STI-1; structural genomics, PSI-biology, m	99.0
2ooe_A		530	Cleavage stimulation factor 77 kDa subunit; HAT do	98.98
2yhc_A		225	BAMD, UPF0169 lipoprotein YFIO; essential BAM comp	98.98
2q7f_A		243	YRRB protein; TPR, protein binding; 2.49A {Bacillu	98.97
2ooe_A		530	Cleavage stimulation factor 77 kDa subunit; HAT do	98.94
1ouv_A		273	Conserved hypothetical secreted protein; TPR repea	98.91
2h6f_A		382	Protein farnesyltransferase/geranylgeranyltransfer	98.91
1xnf_A		275	Lipoprotein NLPI; TPR, tetratricopeptide, structur	98.9
3rjv_A		212	Putative SEL1 repeat protein; alpha-alpha superhel	98.89
3mkr_A		291	Coatomer subunit epsilon; tetratricopeptide repeat	98.88
3urz_A		208	Uncharacterized protein; tetratricopeptide repeats	98.86
4ga2_A		150	E3 SUMO-protein ligase ranbp2; TPR motif, nuclear	98.85
3qou_A		287	Protein YBBN; thioredoxin-like fold, tetratricopep	98.85
1xnf_A		275	Lipoprotein NLPI; TPR, tetratricopeptide, structur	98.8
3as5_A		186	MAMA; tetratricopeptide repeats (TPR) containing p	98.78
2yhc_A		225	BAMD, UPF0169 lipoprotein YFIO; essential BAM comp	98.78
3e4b_A		452	ALGK; tetratricopeptide repeat, superhelix, algina	98.77
3upv_A		126	Heat shock protein STI1; TPR-fold, adaptor protein	98.75
4ga2_A		150	E3 SUMO-protein ligase ranbp2; TPR motif, nuclear	98.74
3gyz_A		151	Chaperone protein IPGC; asymmetric homodimer, tetr	98.74
1hh8_A		213	P67PHOX, NCF-2, neutrophil cytosol factor 2; cell	98.74
2fo7_A		136	Synthetic consensus TPR protein; tetratricopeptide	98.74
3n71_A		490	Histone lysine methyltransferase SMYD1; heart deve	98.74
2pzi_A		681	Probable serine/threonine-protein kinase PKNG; ATP	98.73
1a17_A		166	Serine/threonine protein phosphatase 5; hydrolase,	98.73
4gcn_A		127	Protein STI-1; structural genomics, PSI-biology, m	98.71
3mkr_A		291	Coatomer subunit epsilon; tetratricopeptide repeat	98.69
2vsy_A		568	XCC0866; transferase, glycosyl transferase, GT-B,	98.68
3urz_A		208	Uncharacterized protein; tetratricopeptide repeats	98.68
3qou_A		287	Protein YBBN; thioredoxin-like fold, tetratricopep	98.66
2r5s_A		176	Uncharacterized protein VP0806; APC090868.1, vibri	98.65
4gco_A		126	Protein STI-1; structural genomics, PSI-biology, m	98.65
3sz7_A		164	HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G	98.63
2pzi_A		681	Probable serine/threonine-protein kinase PKNG; ATP	98.62
1p5q_A		336	FKBP52, FK506-binding protein 4; isomerase; 2.80A	98.61
2r5s_A		176	Uncharacterized protein VP0806; APC090868.1, vibri	98.6
2hr2_A		159	Hypothetical protein; alpha-alpha superhelix fold,	98.57
1elr_A		131	TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp	98.57
3n71_A		490	Histone lysine methyltransferase SMYD1; heart deve	98.56
1hh8_A		213	P67PHOX, NCF-2, neutrophil cytosol factor 2; cell	98.54
2vsy_A		568	XCC0866; transferase, glycosyl transferase, GT-B,	98.52
4f3v_A		282	ESX-1 secretion system protein ECCA1; tetratricope	98.49
2vyi_A		131	SGTA protein; chaperone, TPR repeat, phosphoprotei	98.49
2ond_A		308	Cleavage stimulation factor 77 kDa subunit; HAT do	98.46
3rjv_A		212	Putative SEL1 repeat protein; alpha-alpha superhel	98.46
2xcb_A		142	PCRH, regulatory protein PCRH; protein transport,	98.46
4gco_A		126	Protein STI-1; structural genomics, PSI-biology, m	98.44
2vgx_A		148	Chaperone SYCD; alternative dimer assembly, tetrat	98.44
3q49_B		137	STIP1 homology and U box-containing protein 1; E3	98.43
2hr2_A		159	Hypothetical protein; alpha-alpha superhelix fold,	98.41
2ond_A		308	Cleavage stimulation factor 77 kDa subunit; HAT do	98.41
2lni_A		133	Stress-induced-phosphoprotein 1; structural genomi	98.41
1a17_A		166	Serine/threonine protein phosphatase 5; hydrolase,	98.4
2fbn_A		198	70 kDa peptidylprolyl isomerase, putative; sulfur	98.38
3rkv_A		162	Putative peptidylprolyl isomerase; structural geno	98.36
1elr_A		131	TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp	98.36
2fo7_A		136	Synthetic consensus TPR protein; tetratricopeptide	98.36
3rkv_A		162	Putative peptidylprolyl isomerase; structural geno	98.36
2c2l_A		281	CHIP, carboxy terminus of HSP70-interacting protei	98.36
2vgx_A		148	Chaperone SYCD; alternative dimer assembly, tetrat	98.35
1xi4_A		1630	Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle	98.34
1na0_A		125	Designed protein CTPR3; de novo protein; HET: IPT;	98.33
1kt0_A		457	FKBP51, 51 kDa FK506-binding protein; FKBP-like pp	98.33
2xev_A		129	YBGF; tetratricopeptide, alpha-helical, metal bind	98.31
3upv_A		126	Heat shock protein STI1; TPR-fold, adaptor protein	98.29
2fbn_A		198	70 kDa peptidylprolyl isomerase, putative; sulfur	98.29
3qww_A		433	SET and MYND domain-containing protein 2; methyltr	98.26
3sz7_A		164	HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G	98.25
3gyz_A		151	Chaperone protein IPGC; asymmetric homodimer, tetr	98.25
2vyi_A		131	SGTA protein; chaperone, TPR repeat, phosphoprotei	98.24
3qwp_A		429	SET and MYND domain-containing protein 3; SMYD3,SE	98.22
2e2e_A		177	Formate-dependent nitrite reductase complex NRFG;	98.21
2dba_A		148	Smooth muscle cell associated protein-1, isoform 2	98.21
1na0_A		125	Designed protein CTPR3; de novo protein; HET: IPT;	98.2
1hxi_A		121	PEX5, peroxisome targeting signal 1 receptor PEX5;	98.17
2lni_A		133	Stress-induced-phosphoprotein 1; structural genomi	98.15
2xev_A		129	YBGF; tetratricopeptide, alpha-helical, metal bind	98.15
1elw_A		118	TPR1-domain of HOP; HOP, TPR-domain, peptide-compl	98.14
3q49_B		137	STIP1 homology and U box-containing protein 1; E3	98.14
3qww_A		433	SET and MYND domain-containing protein 2; methyltr	98.13
3ma5_A		100	Tetratricopeptide repeat domain protein; NESG, str	98.12
2l6j_A		111	TPR repeat-containing protein associated with HSP;	98.11
1ihg_A		370	Cyclophilin 40; ppiase immunophilin tetratricopept	98.1
2l6j_A		111	TPR repeat-containing protein associated with HSP;	98.09
2if4_A		338	ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha,	98.08
2xcb_A		142	PCRH, regulatory protein PCRH; protein transport,	98.06
1p5q_A		336	FKBP52, FK506-binding protein 4; isomerase; 2.80A	98.06
2kck_A		112	TPR repeat; tetratricopeptide repeat, structural g	98.04
2dba_A		148	Smooth muscle cell associated protein-1, isoform 2	98.04
3k9i_A		117	BH0479 protein; putative protein binding protein,	98.04
1elw_A		118	TPR1-domain of HOP; HOP, TPR-domain, peptide-compl	98.03
1xi4_A		1630	Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle	98.03
2e2e_A		177	Formate-dependent nitrite reductase complex NRFG;	98.03
1wao_1		477	Serine/threonine protein phosphatase 5; hydrolase,	98.01
1hxi_A		121	PEX5, peroxisome targeting signal 1 receptor PEX5;	98.01
3ma5_A		100	Tetratricopeptide repeat domain protein; NESG, str	97.93
1kt0_A		457	FKBP51, 51 kDa FK506-binding protein; FKBP-like pp	97.9
4f3v_A		282	ESX-1 secretion system protein ECCA1; tetratricope	97.87
2kat_A		115	Uncharacterized protein; NESG, structure, structur	97.84
1ihg_A		370	Cyclophilin 40; ppiase immunophilin tetratricopept	97.83
3qwp_A		429	SET and MYND domain-containing protein 3; SMYD3,SE	97.81
2kck_A		112	TPR repeat; tetratricopeptide repeat, structural g	97.8
2c2l_A		281	CHIP, carboxy terminus of HSP70-interacting protei	97.68
1na3_A		91	Designed protein CTPR2; de novo protein; HET: IPT;	97.68
2kat_A		115	Uncharacterized protein; NESG, structure, structur	97.64
3k9i_A		117	BH0479 protein; putative protein binding protein,	97.61
3ly7_A		372	Transcriptional activator CADC; alpha/beta domain,	97.54
1wao_1		477	Serine/threonine protein phosphatase 5; hydrolase,	97.46
1klx_A		138	Cysteine rich protein B; structural genomics, heli	97.35
3dra_A		306	Protein farnesyltransferase/geranylgeranyltransfer	97.34
2if4_A		338	ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha,	97.33
1b89_A		449	Protein (clathrin heavy chain); triskelion, coated	97.32
3mv2_B		310	Coatomer subunit epsilon; vesicular membrane coat	97.17
1zu2_A		158	Mitochondrial import receptor subunit TOM20-3; TPR	97.13
2v5f_A		104	Prolyl 4-hydroxylase subunit alpha-1; endoplasmic	97.09
1na3_A		91	Designed protein CTPR2; de novo protein; HET: IPT;	97.07
3mv2_B		310	Coatomer subunit epsilon; vesicular membrane coat	97.02
3txn_A		394	26S proteasome regulatory complex subunit P42B; PC	96.8
1klx_A		138	Cysteine rich protein B; structural genomics, heli	96.7
1b89_A		449	Protein (clathrin heavy chain); triskelion, coated	96.69
2kc7_A		99	BFR218_protein; tetratricopeptide repeat, all-alph	96.62
3ly7_A		372	Transcriptional activator CADC; alpha/beta domain,	96.56
4b4t_P		445	26S proteasome regulatory subunit RPN5; hydrolase,	96.52
4e6h_A		679	MRNA 3'-END-processing protein RNA14; HAT domain,	96.49
3q7a_A		349	Farnesyltransferase alpha subunit; protein prenylt	96.4
3u64_A		301	Protein TP_0956; tetratrico peptide repeat, protei	96.32
2kc7_A		99	BFR218_protein; tetratricopeptide repeat, all-alph	96.3
1zu2_A		158	Mitochondrial import receptor subunit TOM20-3; TPR	95.88
3dss_A		331	Geranylgeranyl transferase type-2 subunit alpha; p	95.85
3ffl_A		167	Anaphase-promoting complex subunit 7; tetratricope	95.72
3txn_A		394	26S proteasome regulatory complex subunit P42B; PC	95.59
3dra_A		306	Protein farnesyltransferase/geranylgeranyltransfer	95.42
3bee_A		93	Putative YFRE protein; putaive YFRE protein, struc	95.26
3u64_A		301	Protein TP_0956; tetratrico peptide repeat, protei	95.01
4g26_A		501	Pentatricopeptide repeat-containing protein AT2G3	94.95
3bee_A		93	Putative YFRE protein; putaive YFRE protein, struc	94.93
2v5f_A		104	Prolyl 4-hydroxylase subunit alpha-1; endoplasmic	94.89
3ffl_A		167	Anaphase-promoting complex subunit 7; tetratricope	94.61
1pc2_A		152	Mitochondria fission protein; unknown function; NM	94.46
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	94.12
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	93.5
4b4t_P		445	26S proteasome regulatory subunit RPN5; hydrolase,	92.9
4b4t_S		523	RPN3, 26S proteasome regulatory subunit RPN3; hydr	92.43
4e6h_A		679	MRNA 3'-END-processing protein RNA14; HAT domain,	92.29
4h7y_A		161	Dual specificity protein kinase TTK; mitotic check	92.07
1nzn_A		126	CGI-135 protein, fission protein FIS1P; TPR, unkno	91.42
3dss_A		331	Geranylgeranyl transferase type-2 subunit alpha; p	90.88
3q7a_A		349	Farnesyltransferase alpha subunit; protein prenylt	90.79
1pc2_A		152	Mitochondria fission protein; unknown function; NM	90.22
3o48_A		134	Mitochondria fission 1 protein; tetratricopeptide	88.39
4b4t_R		429	RPN7, 26S proteasome regulatory subunit RPN7; hydr	88.29
1y8m_A		144	FIS1; mitochondria, unknown function; NMR {Sacchar	88.1
3mkq_A		814	Coatomer beta'-subunit; beta-propeller, alpha-sole	87.31
4b4t_R		429	RPN7, 26S proteasome regulatory subunit RPN7; hydr	85.75
4g26_A		501	Pentatricopeptide repeat-containing protein AT2G3	85.61
2uy1_A		493	Cleavage stimulation factor 77; RNA-binding protei	84.18

>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

Probab=99.84  E-value=6.5e-18  Score=180.99  Aligned_cols=383  Identities=12%  Similarity=0.041  Sum_probs=238.2

Q ss_pred             HHHhHHHhhhcccHhHHhHHHHHHhccCCCCChHHHHHHHHHHHHHHHHhhcchHHHHHHHHHHHHHhhcCCchhhhhhh
Q 005266            8 LWGLADYHENKGEIGKAVKCLEAICQSHVSFLPIIEVKTRLRISTLLLKHTHNVNHAKSHLERSQLLLKAIPSCFELKCR   87 (705)
Q Consensus         8 L~~lAe~~~~~~~i~~ai~CLea~~~~~~~~~p~~EA~~rLrla~iL~e~T~N~~~A~thLeka~~l~~~i~~~~dlK~~   87 (705)
                      ++.+|...-..+++..|+.+++.+++..|.   ..+  +..-+|.++ ...+++++|...++++....+..+       .
T Consensus         2 ~~~~a~~~~~~g~~~~A~~~~~~~~~~~p~---~~~--~~~~l~~~~-~~~~~~~~a~~~~~~a~~~~p~~~-------~   68 (388)
T 1w3b_A            2 PMELAHREYQAGDFEAAERHCMQLWRQEPD---NTG--VLLLLSSIH-FQCRRLDRSAHFSTLAIKQNPLLA-------E   68 (388)
T ss_dssp             CCTHHHHHHHHTCHHHHHHHHHHHHHHCTT---CHH--HHHHHHHHH-HHTTCHHHHHHHHHHHHHHCTTCH-------H
T ss_pred             hhhHHHHHHHCCCHHHHHHHHHHHHHhCCC---CHH--HHHHHHHHH-HHcCCHHHHHHHHHHHHhcCCCch-------H
Confidence            456677777778888888888887765551   122  334455543 446777888888887777666655       6


Q ss_pred             HHHHHHHHHHHcCCChhHHHHHHHHHhhccccccccccchhhHhHHHHHHHHHhhcCCHHHHHHHHHHHHHHHhhcCCch
Q 005266           88 TFSLLSQCYHLVGAIPPQKLILYKALDLTSSASQDVAVKLWSCNFNSQLANAFIIEGDYQSSISALQSGYVCATEISYPD  167 (705)
Q Consensus        88 ~~~lLA~~y~~~~~~~~ak~~l~kai~~~~~~~~~~~~~~W~~~f~~~lA~~~~~~~d~~~A~~~L~~~~~~A~~~~~~~  167 (705)
                      +++.++.+|...|.+..|...++++++..+       .+..   .++.+|.++...|++..|++.+++....    ++..
T Consensus        69 ~~~~lg~~~~~~g~~~~A~~~~~~al~~~p-------~~~~---~~~~l~~~~~~~g~~~~A~~~~~~al~~----~p~~  134 (388)
T 1w3b_A           69 AYSNLGNVYKERGQLQEAIEHYRHALRLKP-------DFID---GYINLAAALVAAGDMEGAVQAYVSALQY----NPDL  134 (388)
T ss_dssp             HHHHHHHHHHHHTCHHHHHHHHHHHHHHCT-------TCHH---HHHHHHHHHHHHSCSSHHHHHHHHHHHH----CTTC
T ss_pred             HHHHHHHHHHHCCCHHHHHHHHHHHHHcCc-------chHH---HHHHHHHHHHHcCCHHHHHHHHHHHHHh----CCCc
Confidence            777788888888888888778888877765       3232   3455777788888888888888776665    5666


Q ss_pred             HHHHHHHHHHHHHhcccCChhHHHHHHHHhHHHhhhcCcccccccccchhhhhHHHHHHHHhhhhhhhhhhhhhhhHHHH
Q 005266          168 LQMFFATAILHVHLMQWDDENSVLRSINQCDRVWESIDPNRRGQCLGLLFYNELLHIFYRLRICDYKNAAHHVDNLDAAM  247 (705)
Q Consensus       168 ~~~~~~La~~~~~L~~~~~~~~v~~al~~~~~~~~~~~~~~~~~~~G~~~~~E~l~v~~~L~vc~~~~~~~~v~~l~~~l  247 (705)
                      ..+.+.++.++..+   .++++++..+.++...-    |+             ...+++.|-. .               
T Consensus       135 ~~~~~~l~~~~~~~---g~~~~A~~~~~~al~~~----p~-------------~~~~~~~l~~-~---------------  178 (388)
T 1w3b_A          135 YCVRSDLGNLLKAL---GRLEEAKACYLKAIETQ----PN-------------FAVAWSNLGC-V---------------  178 (388)
T ss_dssp             THHHHHHHHHHHTT---SCHHHHHHHHHHHHHHC----TT-------------CHHHHHHHHH-H---------------
T ss_pred             HHHHHHHHHHHHHc---cCHHHHHHHHHHHHHhC----CC-------------CHHHHHHHHH-H---------------
Confidence            66666677666555   55555555544432221    10             0000110000 0               


Q ss_pred             HHHHHHHHHHHHHhhhhHHhhhhcCCCCCChhhhhHHHHHHHHHHHHHHhccCCCCCccccccccccCCccccccccccc
Q 005266          248 KADKQKMQEIQQLSSELDALNQSLSRPDLPSRERSALAGRQAKLQQRLRSLEDSSLTGKEFLEPSYFGNARQAWGDKLVL  327 (705)
Q Consensus       248 ~~~~qk~~~~q~l~~~l~~l~~~L~~~~~~~~~~~~l~~~~~~lq~~i~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~  327 (705)
                                            +..+++.        .++++..++.+.. .|.                          
T Consensus       179 ----------------------~~~~g~~--------~~A~~~~~~al~~-~p~--------------------------  201 (388)
T 1w3b_A          179 ----------------------FNAQGEI--------WLAIHHFEKAVTL-DPN--------------------------  201 (388)
T ss_dssp             ----------------------HHTTTCH--------HHHHHHHHHHHHH-CTT--------------------------
T ss_pred             ----------------------HHHcCCH--------HHHHHHHHHHHhc-CCC--------------------------
Confidence                                  1111111        2222333333332 000                          


Q ss_pred             CCCCcccccccchhhHHHHHHHHHHHhcCCCChHHHHHHHHHHHHHHHHHHHhcCCCCCccccchhhhHHHHHHHHHHHH
Q 005266          328 APSPMDGEWLPKSAVYALVDLMVVILGRPKGLFKECMQRIQSGMQTIQDALLKLGITDGVREVDLQHSAIWMAGVYLMLL  407 (705)
Q Consensus       328 ~~~~l~~~WLpk~~~~aL~yll~~~~~~~~g~~~ka~k~l~~al~~i~~~l~~~~~~~~~~e~~l~~~~~w~~~~~~~l~  407 (705)
                                     .+-++...+.++...|.+++|.+.+++++..          .                       
T Consensus       202 ---------------~~~~~~~lg~~~~~~~~~~~A~~~~~~al~~----------~-----------------------  233 (388)
T 1w3b_A          202 ---------------FLDAYINLGNVLKEARIFDRAVAAYLRALSL----------S-----------------------  233 (388)
T ss_dssp             ---------------CHHHHHHHHHHHHTTTCTTHHHHHHHHHHHH----------C-----------------------
T ss_pred             ---------------cHHHHHHHHHHHHHcCCHHHHHHHHHHHHhh----------C-----------------------
Confidence                           1123344455555666666666665555553          1                       


Q ss_pred             HHHHhHHHHHhhhhhhhHHhhhhhHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhcCChhHHHHHHHHHHHHHHhhCChh
Q 005266          408 MQFLENKVAVELTRSGFVEAQEACESMIEMLRGQYAHSVGCYSEAAFHYVEAAKITESKSMQAMCHAYAAVSYFCIGDAE  487 (705)
Q Consensus       408 ~~~Le~~~~~~L~~~~~~~a~~~~~a~~~~llG~~~~~~g~~~eA~~~f~~Al~l~~~~~g~a~a~~nlalv~l~~gd~d  487 (705)
                                            |..+.++..+|.++...|++++|...|++++++.++..   .+..+++.++...|+++
T Consensus       234 ----------------------p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~---~~~~~l~~~~~~~g~~~  288 (388)
T 1w3b_A          234 ----------------------PNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFP---DAYCNLANALKEKGSVA  288 (388)
T ss_dssp             ----------------------TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTCSSCH---HHHHHHHHHHHHHSCHH
T ss_pred             ----------------------cCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhCCCCH---HHHHHHHHHHHHcCCHH
Confidence                                  11223334678888888888888888888888876532   34677888888888876


Q ss_pred             h----HHHHHHhhccccccCCccchhhhHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHHHHhcccCHHHHHHHHHHHHHH
Q 005266          488 S----SSQAIDLIGPVYQMKDTINGVREEASLHFAYGLLLMRQQDFQEARNRLAKGLQIAHNHMGNLQLVSQYLTILGNL  563 (705)
Q Consensus       488 ~----~~~ALeli~~~~~~~~~~~g~~~qA~al~~lG~~~~~~g~~~eA~~~L~eAL~la~~e~gn~~l~a~aL~~LG~i  563 (705)
                      +    +.+++++      .|++       +.+++.+|.++...|++++|...+++++++. .  .+    ..++..+|.+
T Consensus       289 ~A~~~~~~al~~------~p~~-------~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~-p--~~----~~~~~~l~~~  348 (388)
T 1w3b_A          289 EAEDCYNTALRL------CPTH-------ADSLNNLANIKREQGNIEEAVRLYRKALEVF-P--EF----AAAHSNLASV  348 (388)
T ss_dssp             HHHHHHHHHHHH------CTTC-------HHHHHHHHHHHHTTTCHHHHHHHHHHHTTSC-T--TC----HHHHHHHHHH
T ss_pred             HHHHHHHHHHhh------Cccc-------HHHHHHHHHHHHHcCCHHHHHHHHHHHHhcC-C--Cc----HHHHHHHHHH
Confidence            6    5555552      2332       4578888888888888888888888887653 1  12    3477888888


Q ss_pred             HHHCCChHHHHHHHHHHHHHHHHcCChhhHHHHHHHHHHHHHHcCC
Q 005266          564 ALALHDTVQAREILRSSLTLAKKLYDIPTQIWALSVLTALYQQLGD  609 (705)
Q Consensus       564 ~~~lg~~~qA~~~~~~Al~LArk~gD~~~q~~al~~L~~l~~~~Gd  609 (705)
                      +...|++++|.+.+++++.+      .+....++..||.++...|+
T Consensus       349 ~~~~g~~~~A~~~~~~a~~~------~p~~~~a~~~lg~~~~~~~~  388 (388)
T 1w3b_A          349 LQQQGKLQEALMHYKEAIRI------SPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             HHTTTCCHHHHHHHHHHHTT------CTTCHHHHHHHHHHHHHTCC
T ss_pred             HHHcCCHHHHHHHHHHHHhh------CCCCHHHHHhHHHHHHHccC
Confidence            88888888888888888764      12345667778888877764

PyMOL of 1w3b

>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens}	Back alignment and structure

>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe}	Back alignment and structure

>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster}	Back alignment and structure

>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus}	Back alignment and structure

>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae}	Back alignment and structure

>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens}	Back alignment and structure

>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A	Back alignment and structure

>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus}	Back alignment and structure

>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis}	Back alignment and structure

>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A	Back alignment and structure

>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe}	Back alignment and structure

>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A	Back alignment and structure

>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae}	Back alignment and structure

>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus}	Back alignment and structure

>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis}	Back alignment and structure

>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster}	Back alignment and structure

>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A	Back alignment and structure

>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis}	Back alignment and structure

>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens}	Back alignment and structure

>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus}	Back alignment and structure

>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A	Back alignment and structure

>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1}	Back alignment and structure

>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1}	Back alignment and structure

>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis}	Back alignment and structure

>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio}	Back alignment and structure

>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens}	Back alignment and structure

>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli}	Back alignment and structure

>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A	Back alignment and structure

>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens}	Back alignment and structure

>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli}	Back alignment and structure

>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A	Back alignment and structure

>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens}	Back alignment and structure

>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus}	Back alignment and structure

>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2	Back alignment and structure

>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1	Back alignment and structure

>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A	Back alignment and structure

>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus}	Back alignment and structure

>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens}	Back alignment and structure

>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus}	Back alignment and structure

>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646}	Back alignment and structure

>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2	Back alignment and structure

>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus}	Back alignment and structure

>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A	Back alignment and structure

>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio}	Back alignment and structure

>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A	Back alignment and structure

>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A	Back alignment and structure

>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A	Back alignment and structure

>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A*	Back alignment and structure

>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens}	Back alignment and structure

>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus}	Back alignment and structure

>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus}	Back alignment and structure

>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A	Back alignment and structure

>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646}	Back alignment and structure

>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii}	Back alignment and structure

>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1	Back alignment and structure

>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii}	Back alignment and structure

>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis}	Back alignment and structure

>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1	Back alignment and structure

>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A	Back alignment and structure

>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A	Back alignment and structure

>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus}	Back alignment and structure

>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis}	Back alignment and structure

>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus}	Back alignment and structure

>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A*	Back alignment and structure

>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis}	Back alignment and structure

>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1	Back alignment and structure

>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus}	Back alignment and structure

>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A	Back alignment and structure

>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A	Back alignment and structure

>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis}	Back alignment and structure

>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus}	Back alignment and structure

>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ...

Back alignment and structure

>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens}	Back alignment and structure

>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans}	Back alignment and structure

>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7	Back alignment and structure

>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A	Back alignment and structure

>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1	Back alignment and structure

>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7	Back alignment and structure

>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1	Back alignment and structure

Back alignment and structure

>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1	Back alignment and structure

>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp}	Back alignment and structure

>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus}	Back alignment and structure

>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus}	Back alignment and structure

>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A*	Back alignment and structure

>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A*	Back alignment and structure

>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1	Back alignment and structure

>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A	Back alignment and structure

>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A	Back alignment and structure

>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens}	Back alignment and structure

>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae}	Back alignment and structure

>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A*	Back alignment and structure

>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A	Back alignment and structure

>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B*	Back alignment and structure

>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A	Back alignment and structure

>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus}	Back alignment and structure

>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis}	Back alignment and structure

>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A	Back alignment and structure

>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans}	Back alignment and structure

>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus}	Back alignment and structure

>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A*	Back alignment and structure

>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus}	Back alignment and structure

>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A*	Back alignment and structure

>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus}	Back alignment and structure

>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans}	Back alignment and structure

>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus}	Back alignment and structure

>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis}	Back alignment and structure

>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A	Back alignment and structure

>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus}	Back alignment and structure

>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8	Back alignment and structure

>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A	Back alignment and structure

>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus}	Back alignment and structure

>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B*	Back alignment and structure

>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A*	Back alignment and structure

>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis}	Back alignment and structure

>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1	Back alignment and structure

>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7	Back alignment and structure

>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp}	Back alignment and structure

>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A	Back alignment and structure

>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans}	Back alignment and structure

>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A*	Back alignment and structure

>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B*	Back alignment and structure

>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8	Back alignment and structure

>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7	Back alignment and structure

>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens}	Back alignment and structure

>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A	Back alignment and structure

>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1	Back alignment and structure

>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans}	Back alignment and structure

>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A	Back alignment and structure

>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A	Back alignment and structure

>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans}	Back alignment and structure

>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2	Back alignment and structure

>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A*	Back alignment and structure

>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A	Back alignment and structure

>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A	Back alignment and structure

>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A	Back alignment and structure

>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris}	Back alignment and structure

>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae}	Back alignment and structure

>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1	Back alignment and structure

>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A*	Back alignment and structure

>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus}	Back alignment and structure

>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A	Back alignment and structure

>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1	Back alignment and structure

>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A*	Back alignment and structure

>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli}	Back alignment and structure

>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A	Back alignment and structure

>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1	Back alignment and structure

>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens}	Back alignment and structure

>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris}	Back alignment and structure

>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B*	Back alignment and structure

>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A*	Back alignment and structure

>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A	Back alignment and structure

>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A	Back alignment and structure

>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana}	Back alignment and structure

>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A	Back alignment and structure

>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A	Back alignment and structure

>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis}	Back alignment and structure

>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans}	Back alignment and structure

>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A	Back alignment and structure

>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli}	Back alignment and structure

>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3	Back alignment and structure

>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1	Back alignment and structure

>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A	Back alignment and structure

>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A	Back alignment and structure

>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis}	Back alignment and structure

>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis}	Back alignment and structure

>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A	Back alignment and structure

>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A*	Back alignment and structure

>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis}	Back alignment and structure

>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2	Back alignment and structure

>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A	Back alignment and structure

>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis}	Back alignment and structure

>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans}	Back alignment and structure

>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A	Back alignment and structure

>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3	Back alignment and structure

>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1	Back alignment and structure

>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans}	Back alignment and structure

>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana}	Back alignment and structure

>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3	Back alignment and structure

>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B	Back alignment and structure

>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1	Back alignment and structure

>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A	Back alignment and structure

>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A	Back alignment and structure

>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B	Back alignment and structure

>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A	Back alignment and structure

>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1	Back alignment and structure

>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3	Back alignment and structure

>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis}	Back alignment and structure

>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A	Back alignment and structure

>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A	Back alignment and structure

>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A*	Back alignment and structure

>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A*	Back alignment and structure

>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis}	Back alignment and structure

>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1	Back alignment and structure

>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A*	Back alignment and structure

>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens}	Back alignment and structure

>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A	Back alignment and structure

>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans}	Back alignment and structure

>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633}	Back alignment and structure

>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A*	Back alignment and structure

>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A	Back alignment and structure

>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633}	Back alignment and structure

>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A	Back alignment and structure

>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens}	Back alignment and structure

>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A	Back alignment and structure

>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A	Back alignment and structure

>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A	Back alignment and structure

>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A*	Back alignment and structure

>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A*	Back alignment and structure

>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A	Back alignment and structure

>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1	Back alignment and structure

>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A	Back alignment and structure

>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A	Back alignment and structure

>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		705
d1w3ba_		388	O-GlcNAc transferase p110 subunit, OGT {Human (Hom	99.79
d1w3ba_		388	O-GlcNAc transferase p110 subunit, OGT {Human (Hom	99.71
d1hz4a_		366	Transcription factor MalT domain III {Escherichia	99.61
d1hz4a_		366	Transcription factor MalT domain III {Escherichia	99.55
d1fcha_		323	Peroxin pex5 (peroxisomal targeting signal 1 (PTS1	99.36
d1fcha_		323	Peroxin pex5 (peroxisomal targeting signal 1 (PTS1	99.29
d1qqea_		290	Vesicular transport protein sec17 {Baker's yeast (	99.15
d1qqea_		290	Vesicular transport protein sec17 {Baker's yeast (	99.01
d1xnfa_		259	Lipoprotein NlpI {Escherichia coli [TaxId: 562]}	98.87
d1elra_		128	Hop {Human (Homo sapiens) [TaxId: 9606]}	98.8
d2hr2a1		156	Hypothetical protein CT2138 {Chlorobium tepidum [T	98.76
d2hr2a1		156	Hypothetical protein CT2138 {Chlorobium tepidum [T	98.7
d2h6fa1		315	Protein farnesyltransferase alpha-subunit {Human (	98.66
d1hh8a_		192	Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H	98.6
d1xnfa_		259	Lipoprotein NlpI {Escherichia coli [TaxId: 562]}	98.57
d1hh8a_		192	Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H	98.54
d1p5qa1		170	FKBP52 (FKBP4), C-terminal domain {Human (Homo sap	98.44
d2h6fa1		315	Protein farnesyltransferase alpha-subunit {Human (	98.43
d1elra_		128	Hop {Human (Homo sapiens) [TaxId: 9606]}	98.43
d1a17a_		159	Protein phosphatase 5 {Human (Homo sapiens) [TaxId	98.42
d2c2la1		201	STIP1 homology and U box-containing protein 1, STU	98.38
d1elwa_		117	Hop {Human (Homo sapiens) [TaxId: 9606]}	98.25
d1hxia_		112	Peroxin pex5 (peroxisomal targeting signal 1 (PTS1	98.25
d1tjca_		95	Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human	98.2
d1hxia_		112	Peroxin pex5 (peroxisomal targeting signal 1 (PTS1	98.2
d1kt1a1		168	FKBP51, C-terminal domain {Monkey (Saimiri bolivie	98.18
d2c2la1		201	STIP1 homology and U box-containing protein 1, STU	98.15
d2fbna1		153	Putative 70 kda peptidylprolyl isomerase PFL2275c	98.14
d1nzna_		122	Mitochondria fission protein Fis1 {Human (Homo sap	98.09
d1ihga1		169	Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]}	98.07
d1a17a_		159	Protein phosphatase 5 {Human (Homo sapiens) [TaxId	98.03
d1p5qa1		170	FKBP52 (FKBP4), C-terminal domain {Human (Homo sap	98.02
d1kt1a1		168	FKBP51, C-terminal domain {Monkey (Saimiri bolivie	97.99
d1elwa_		117	Hop {Human (Homo sapiens) [TaxId: 9606]}	97.99
d2fbna1		153	Putative 70 kda peptidylprolyl isomerase PFL2275c	97.95
d1dcea1		334	Rab geranylgeranyltransferase alpha-subunit, N-ter	97.82
d1ihga1		169	Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]}	97.69
d1dcea1		334	Rab geranylgeranyltransferase alpha-subunit, N-ter	97.64
d1ya0a1		497	SMG-7 {Human (Homo sapiens) [TaxId: 9606]}	97.64
d1ouva_		265	Cysteine rich protein C (HcpC) {Helicobacter pylor	97.58
d2ff4a2		179	Probable regulatory protein EmbR, middle domain {M	97.57
d1nzna_		122	Mitochondria fission protein Fis1 {Human (Homo sap	97.36
d2ff4a2		179	Probable regulatory protein EmbR, middle domain {M	97.34
d1ya0a1		497	SMG-7 {Human (Homo sapiens) [TaxId: 9606]}	97.29
d1zu2a1		145	Mitochondrial import receptor subunit tom20-3 {Tha	97.11
d2onda1		308	Cleavage stimulation factor 77 kDa subunit CSTF3 {	97.1
d1ouva_		265	Cysteine rich protein C (HcpC) {Helicobacter pylor	97.07
d1tjca_		95	Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human	97.06
d1zu2a1		145	Mitochondrial import receptor subunit tom20-3 {Tha	96.96
d2onda1		308	Cleavage stimulation factor 77 kDa subunit CSTF3 {	96.59
d1zbpa1		264	Hypothetical protein VPA1032 {Vibrio parahaemolyti	96.37
d1zbpa1		264	Hypothetical protein VPA1032 {Vibrio parahaemolyti	95.74
d1klxa_		133	Cysteine rich protein B (HcpB) {Helicobacter pylor	95.68
d2pqrb1		124	Mitochondria fission protein Fis1 {Baker's yeast (	93.84
d1klxa_		133	Cysteine rich protein B (HcpB) {Helicobacter pylor	92.89
d2pqrb1		124	Mitochondria fission protein Fis1 {Baker's yeast (	91.7

>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.79  E-value=5.7e-17  Score=167.05  Aligned_cols=377  Identities=11%  Similarity=-0.001  Sum_probs=243.6

Q ss_pred             HHHHHHHHHhhcchHHHHHHHHHHHHHhhcCCchhhhhhhHHHHHHHHHHHcCCChhHHHHHHHHHhhccccccccccch
Q 005266           48 LRISTLLLKHTHNVNHAKSHLERSQLLLKAIPSCFELKCRTFSLLSQCYHLVGAIPPQKLILYKALDLTSSASQDVAVKL  127 (705)
Q Consensus        48 Lrla~iL~e~T~N~~~A~thLeka~~l~~~i~~~~dlK~~~~~lLA~~y~~~~~~~~ak~~l~kai~~~~~~~~~~~~~~  127 (705)
                      |.+|...| ..+|+++|+..+++++...|..+       .++..++.+|...|++..|...++++++..+       .+.
T Consensus         3 l~la~~~~-~~G~~~~A~~~~~~~l~~~p~~~-------~~~~~la~~~~~~~~~~~A~~~~~~al~~~p-------~~~   67 (388)
T d1w3ba_           3 MELAHREY-QAGDFEAAERHCMQLWRQEPDNT-------GVLLLLSSIHFQCRRLDRSAHFSTLAIKQNP-------LLA   67 (388)
T ss_dssp             CTHHHHHH-HHTCHHHHHHHHHHHHHHCTTCH-------HHHHHHHHHHHHTTCHHHHHHHHHHHHHHCT-------TCH
T ss_pred             HHHHHHHH-HcCCHHHHHHHHHHHHHhCCCCH-------HHHHHHHHHHHHcCCHHHHHHHHHHHHHhCC-------CCH
Confidence            34566654 56889999999999888777666       7888999999999999999999999999887       333


Q ss_pred             hhHhHHHHHHHHHhhcCCHHHHHHHHHHHHHHHhhcCCchHHHHHHHHHHHHHhcccCChhHHHHHHHHhHHHhhhcCcc
Q 005266          128 WSCNFNSQLANAFIIEGDYQSSISALQSGYVCATEISYPDLQMFFATAILHVHLMQWDDENSVLRSINQCDRVWESIDPN  207 (705)
Q Consensus       128 W~~~f~~~lA~~~~~~~d~~~A~~~L~~~~~~A~~~~~~~~~~~~~La~~~~~L~~~~~~~~v~~al~~~~~~~~~~~~~  207 (705)
                      .   .++.+|.++...|++..|+..++.....    .+................   ..................     
T Consensus        68 ~---a~~~l~~~~~~~g~~~~A~~~~~~~~~~----~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~-----  132 (388)
T d1w3ba_          68 E---AYSNLGNVYKERGQLQEAIEHYRHALRL----KPDFIDGYINLAAALVAA---GDMEGAVQAYVSALQYNP-----  132 (388)
T ss_dssp             H---HHHHHHHHHHHHTCHHHHHHHHHHHHHH----CTTCHHHHHHHHHHHHHH---SCSSHHHHHHHHHHHHCT-----
T ss_pred             H---HHHHHHHHhhhhcccccccccccccccc----cccccccccccccccccc---cccccccccccccccccc-----
Confidence            3   4567899999999999999999997775    554455454444444443   222222211111111100     


Q ss_pred             cccccccchhhhhHHHHHHHHhhhhhhhhhhhhhhhHHHHHHHHHHHHHHHHHhhhhHHhhhhcCCCCCChhhhhHHHHH
Q 005266          208 RRGQCLGLLFYNELLHIFYRLRICDYKNAAHHVDNLDAAMKADKQKMQEIQQLSSELDALNQSLSRPDLPSRERSALAGR  287 (705)
Q Consensus       208 ~~~~~~G~~~~~E~l~v~~~L~vc~~~~~~~~v~~l~~~l~~~~qk~~~~q~l~~~l~~l~~~L~~~~~~~~~~~~l~~~  287 (705)
                         .  ..    ..                        ...    .    ..         ........        ...
T Consensus       133 ---~--~~----~~------------------------~~~----~----~~---------~~~~~~~~--------~~~  154 (388)
T d1w3ba_         133 ---D--LY----CV------------------------RSD----L----GN---------LLKALGRL--------EEA  154 (388)
T ss_dssp             ---T--CT----HH------------------------HHH----H----HH---------HHHTTSCH--------HHH
T ss_pred             ---c--cc----cc------------------------ccc----c----cc---------cccccchh--------hhh
Confidence               0  00    00                        000    0    00         00000000        111


Q ss_pred             HHHHHHHHHhccCCCCCccccccccccCCcccccccccccCCCCcccccccchhhHHHHHHHHHHHhcCCCChHHHHHHH
Q 005266          288 QAKLQQRLRSLEDSSLTGKEFLEPSYFGNARQAWGDKLVLAPSPMDGEWLPKSAVYALVDLMVVILGRPKGLFKECMQRI  367 (705)
Q Consensus       288 ~~~lq~~i~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~l~~~WLpk~~~~aL~yll~~~~~~~~g~~~ka~k~l  367 (705)
                      .....+.+..                                          ....+.++...+..+...|.+++|.+++
T Consensus       155 ~~~~~~~~~~------------------------------------------~~~~~~~~~~l~~~~~~~~~~~~A~~~~  192 (388)
T d1w3ba_         155 KACYLKAIET------------------------------------------QPNFAVAWSNLGCVFNAQGEIWLAIHHF  192 (388)
T ss_dssp             HHHHHHHHHH------------------------------------------CTTCHHHHHHHHHHHHTTTCHHHHHHHH
T ss_pred             HHHHHHhhcc------------------------------------------CcchhHHHHhhcccccccCcHHHHHHHH
Confidence            1122222222                                          1123445566678888899999999999


Q ss_pred             HHHHHHHHHHHHhcCCCCCccccchhhhHHHHHHHHHHHHHHHHhHHHHHhhhhhhhHHh---------hhhhHHHHHHH
Q 005266          368 QSGMQTIQDALLKLGITDGVREVDLQHSAIWMAGVYLMLLMQFLENKVAVELTRSGFVEA---------QEACESMIEML  438 (705)
Q Consensus       368 ~~al~~i~~~l~~~~~~~~~~e~~l~~~~~w~~~~~~~l~~~~Le~~~~~~L~~~~~~~a---------~~~~~a~~~~l  438 (705)
                      ++++..          .|..       ...|.....+             .....++..|         ..+..+..+..
T Consensus       193 ~~al~~----------~p~~-------~~~~~~l~~~-------------~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~  242 (388)
T d1w3ba_         193 EKAVTL----------DPNF-------LDAYINLGNV-------------LKEARIFDRAVAAYLRALSLSPNHAVVHGN  242 (388)
T ss_dssp             HHHHHH----------CTTC-------HHHHHHHHHH-------------HHTTTCTTHHHHHHHHHHHHCTTCHHHHHH
T ss_pred             HHHHHh----------Cccc-------HHHHHHHhhh-------------hhccccHHHHHHHHHHhHHHhhhHHHHHHH
Confidence            998874          2221       1222111100             0011122222         22355677788


Q ss_pred             HHHHHHHcCCHHHHHHHHHHHHHhcCChhHHHHHHHHHHHHHHhhCChhhHHHHHHhhccccccCCccchhhhHHHHHHH
Q 005266          439 RGQYAHSVGCYSEAAFHYVEAAKITESKSMQAMCHAYAAVSYFCIGDAESSSQAIDLIGPVYQMKDTINGVREEASLHFA  518 (705)
Q Consensus       439 lG~~~~~~g~~~eA~~~f~~Al~l~~~~~g~a~a~~nlalv~l~~gd~d~~~~ALeli~~~~~~~~~~~g~~~qA~al~~  518 (705)
                      +|.++...|++++|...|++|+++.++..   .+..++|.++...|++++....++....  ..|.       .+..++.
T Consensus       243 l~~~~~~~~~~~~A~~~~~~al~~~p~~~---~~~~~l~~~~~~~~~~~~A~~~~~~~~~--~~~~-------~~~~~~~  310 (388)
T d1w3ba_         243 LACVYYEQGLIDLAIDTYRRAIELQPHFP---DAYCNLANALKEKGSVAEAEDCYNTALR--LCPT-------HADSLNN  310 (388)
T ss_dssp             HHHHHHHTTCHHHHHHHHHHHHHTCSSCH---HHHHHHHHHHHHHSCHHHHHHHHHHHHH--HCTT-------CHHHHHH
T ss_pred             HHHHHHHCCCHHHHHHHHHHHHHhCCCCH---HHHHHHHHHHHHcCCHHHHHHHHHhhhc--cCCc-------cchhhhH
Confidence            99999999999999999999999987643   4577889999998987663222221111  2233       2568899


Q ss_pred             HHHHHHHhcCHHHHHHHHHHHHHHHHhcccCHHHHHHHHHHHHHHHHHCCChHHHHHHHHHHHHHHHHcCChhhHHHHHH
Q 005266          519 YGLLLMRQQDFQEARNRLAKGLQIAHNHMGNLQLVSQYLTILGNLALALHDTVQAREILRSSLTLAKKLYDIPTQIWALS  598 (705)
Q Consensus       519 lG~~~~~~g~~~eA~~~L~eAL~la~~e~gn~~l~a~aL~~LG~i~~~lg~~~qA~~~~~~Al~LArk~gD~~~q~~al~  598 (705)
                      +|.++...|++++|...+++++++. .  .+    +.++..||.+|..+|++++|.++|++|+.+-      +.-..++.
T Consensus       311 l~~~~~~~~~~~~A~~~~~~al~~~-p--~~----~~~~~~la~~~~~~g~~~~A~~~~~~al~l~------P~~~~a~~  377 (388)
T d1w3ba_         311 LANIKREQGNIEEAVRLYRKALEVF-P--EF----AAAHSNLASVLQQQGKLQEALMHYKEAIRIS------PTFADAYS  377 (388)
T ss_dssp             HHHHHHTTTCHHHHHHHHHHHTTSC-T--TC----HHHHHHHHHHHHTTTCCHHHHHHHHHHHTTC------TTCHHHHH
T ss_pred             HHHHHHHCCCHHHHHHHHHHHHHhC-C--CC----HHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC------CCCHHHHH
Confidence            9999999999999999999998773 2  12    4578899999999999999999999998762      22355678


Q ss_pred             HHHHHHHHcCC
Q 005266          599 VLTALYQQLGD  609 (705)
Q Consensus       599 ~L~~l~~~~Gd  609 (705)
                      .||.+|...||
T Consensus       378 ~lg~~~~~~~D  388 (388)
T d1w3ba_         378 NMGNTLKEMQD  388 (388)
T ss_dssp             HHHHHHHHTCC
T ss_pred             HHHHHHHHcCC
Confidence            89999999987

PyMOL of d1w3ba_

>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]}	Back information, alignment and structure

>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]}	Back information, alignment and structure

>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]}	Back information, alignment and structure

>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]}	Back information, alignment and structure

>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]}	Back information, alignment and structure

>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]}	Back information, alignment and structure

>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]}	Back information, alignment and structure

>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]}	Back information, alignment and structure

>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]}	Back information, alignment and structure

>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]}	Back information, alignment and structure

>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure