Citrus Sinensis ID: 005315

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700--

MGDVLIMNEIDATANRLGIDLLQVDLDSIQLPPGEDLGIISDDEDVYEDDDQEVESGFGNIIVVDNLPVVPKEKFEKLEGVIKEDGLWMPVDPETQKSLGYCFIEYNTPQEAELAKEKTNGYKLDRAHIFAVNMFDDFDKFMKVPDEWAPPEHKPYTPGENLQKWLTDEKARDQFVIRSGTDTEVLWNDARHLKPEPVYKRSYWTESFVQWSPLGTYLATVHRQGAAVWGGANTFNRLMRYAHPQVKLIDFSPGEKYLVTYSSHEPSNPRDANRVVINIFDVRTGKVMRDFKGSADEFAVGGTGGVAGVSWPVFRWGGGKDKYFAKLGKNMISVYETESFTLIDKKSLKVENVMDFSWSPTDPIISLFVPELGGGNQPARVSLVQIPSKEELRQKNLFSVSDCKMYWQSSGDYLAVKVDRYTKTKKSTYTGFELFRIKERDIPIEVLELDNKNDKIIAFAWEPKGHRFAVIHGDSPRPDISFYSMRTAQHAGRVSKLTTLKGKQANALFWSPSGRFIVLAGLKGFNGQLEFYNVDELETMATAEHFMATDVEWDPTGRYVATAVTSVHEMENGFNIWSFNGKLLYRTLKDHFFQFLWRPRPPSFLTPEKEEEIAKNLKKYSKKYEAEDQDVSMQLSEQEREKRRSLKNEWEKKISEWKRLHEEEKMERQMLRDGEASDEEEEYEAKEVEVEEVLDVTEEVEE

ccccEEcHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccHHHHHHHHcccccccEEEEccccccEEEEEEEEEEccHHHHHHHHHHHcccccccccEEEEEEcHHHHHHcccccccccccccccccccccHHHccccccccEEEEEEcccEEEEEEccccccccccccccccEEEEEEEcccccEEEEEEcccEEEEEcccccEEEEEEEcccEEEEEEcccccEEEEEEcccccccccccccEEEEEEcccccEEEEccccccccccccccccccccccEEEEEccccEEEEEccccEEEEEEccccEEEEEEEEEEccEEEEEEcccccEEEEEEEccccccccEEEEEEEccccccEEEEEccccccEEEEEcccccEEEEEEEEEEEcccEEEccEEEEEEEcccccEEEEEEccccccEEEEEEEEcccEEEEEEcccccccEEEEEcccccccccEEEEEEcccccEEEEEEcccccEEEEEEccccccEEEEEEccccEEEEEcccccEEEEEEcccccEEEEEEEEccccccEEEEEEEcccEEEEEEcccEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHcccHHHHccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHccccEEEEEEEEEEEEEEEEc

ccHEEcHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHccccccccccEEEEEcccccccHHHHHHHHHHHHccccEccccccccccEEEEEEEEccHHHHHHHHHHHcccccccccEEEEEcccHHHHHcccccccccccccccccccHHHHHHcccccccEEEEEEcccEEEEEccccccccccEEccccccccEEEEccccEEEEEEccccEEEEcccccHHHEEEcccccEEEEEEcccccEEEEEccccccccccccccEEEEEEEccccEEEcccccccccccccccccccccccEEEEcccccEEEEEEcccEEEEEEccccccccccEEEEcccEEccccccccEEEEEEcccccccccEEEEEEEcccHHHHHEccEEEEccEEEEEcccccEEEEEEEEEEccccEEEEcEEEEEEEEccccEEEEEEccccccEEEEEEcccccEEEEEEccccccEEEEEccccccccccEEEEEEcccccccEEEEcccccEEEEEEEccccccEEEEEccccEEEcccccccccEEEEcccccEEEEEEEccccccccEEEEEEccHHHHcccHHHHHEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHccccEEEEEEEEEEEEEHcc

MGDVLIMNEIDATANRLGIDLLQVdldsiqlppgedlgiisddedvyedddqevesgfgniivvdnlpvvpkekFEKLEGvikedglwmpvdpetqkslgycfieyntpqEAELAKEKtngykldraHIFAVNMfddfdkfmkvpdewappehkpytpgenlQKWLTDEKARDQFVIRSGTDTEVLwndarhlkpepvykrsywtesfvqwsplgTYLATVHRQgaavwggantFNRLMryahpqvklidfspgekylvtysshepsnprdanrvvINIFDvrtgkvmrdfkgsadefavggtggvagvswpvfrwgggkdKYFAKLGKNMISVYetesftlidkkslkvenvmdfswsptdpiislfvpelgggnqparvslvqipskeelrqknlfsvsDCKMYWQSSGDYLAVKVDRytktkkstytgfelfrikerdipievleldnkndKIIAfawepkghrfavihgdsprpdisfysmrtaqhagrvsklttlkgkqanalfwspsGRFIVLAGLkgfngqlefynvdeletMATAEHFMAtdvewdptgrYVATAVTSVHEMENGFNIWSFNGKLLYRTLKDHFfqflwrprppsfltpeKEEEIAKNLKKYSKKYEAEDQDVSMQLSEQEREKRRSLKNEWEKKISEWKRLHEEEKMERQMlrdgeasdeeeeYEAKEVEVEEVLDVTEEVEE

MGDVLIMNEIDATANRLGIDLLQVDLDSIQLPPGEDLGIISDDEDVYEDDDQEvesgfgniivvdnlpvvpkEKFEKLEgvikedglwmpVDPETQKSLGYCFIEYNTPQEAELAKEKTNGYKLDRAHIFAVNMFDDFDKFMKVPDEwappehkpytpgenlQKWLTDEKARDQFVIrsgtdtevlwndarhlkpepvyKRSYWTESFVQWSPLGTYLATVHRQGAAVWGGANTFNRLMRYAHPQVKLIDFSPGEKYLVTYSshepsnprdanrvvINIFDVRTGKVMRDFKGSADEFAVGGTGGVAGVSWPVFRWGGGKDKYFAKLGKNMISVYETEsftlidkkslKVENVMDFSWSPTDPIISLFVPELGGGNQPARVSLVQIPSKEELRQKNLFSVSDCKMYWQSSGDYLAVKVDRytktkkstytgfelfrikerdipievleldnKNDKIIAFAWEPKGHRFAVIHGDSPRPDISFYSMRTAQHAGRVSKLTTLKGKQANALFWSPSGRFIVLAGLKGFNGQLEFYNVDELETMATAEHFMATDVEWDPTGRYVATAVTSVHEMENGFNIWSFNGKLLYRTLKDHFFQFLwrprppsfltpeKEEEIAKNLKKYSKkyeaedqdvsmqlseqerekrrslknewekkisewkrlheeekmerqmlrdgeasdeeeeyeakeveveevldvteevee

MGDVLIMNEIDATANRLGIDLLQVDLDSIQLPPGEDLGIISddedvyedddqeveSGFGNIIVVDNLPVVPKEKFEKLEGVIKEDGLWMPVDPETQKSLGYCFIEYNTPQEAELAKEKTNGYKLDRAHIFAVNMFDDFDKFMKVPDEWAPPEHKPYTPGENLQKWLTDEKARDQFVIRSGTDTEVLWNDARHLKPEPVYKRSYWTESFVQWSPLGTYLATVHRQGAAVWGGANTFNRLMRYAHPQVKLIDFSPGEKYLVTYSSHEPSNPRDANRVVINIFDVRTGKVMRDFKGSADEFavggtggvagvSWPVFRWGGGKDKYFAKLGKNMISVYETESFTLIDKKSLKVENVMDFSWSPTDPIISLFVPELGGGNQPARVSLVQIPSKEELRQKNLFSVSDCKMYWQSSGDYLAVKVDRYTKTKKSTYTGFELFRIKERDIPIEVLELDNKNDKIIAFAWEPKGHRFAVIHGDSPRPDISFYSMRTAQHAGRVSKLTTLKGKQANALFWSPSGRFIVLAGLKGFNGQLEFYNVDELETMATAEHFMATDVEWDPTGRYVATAVTSVHEMENGFNIWSFNGKLLYRTLKDHFFQFLWRPRPPSFLTPEKEEEIAKNLKKYSKKYEAEDQDVSMQLSEQEREKRRSLKNEWEKKISEWKRLHEEEKMERQMLRDGEASDeeeeyeakeveveevldvteevee

***VLIMNEIDATANRLGIDLLQVDLDSIQLPPGEDLGIISDDEDVYE****EVESGFGNIIVVDNLPVVPKEKFEKLEGVIKEDGLWMPVDPETQKSLGYCFIEYNTPQEAELAKEKTNGYKLDRAHIFAVNMFDDFDKFMKVPDEWA***********NLQKWLTDEKARDQFVIRSGTDTEVLWNDARHLKPEPVYKRSYWTESFVQWSPLGTYLATVHRQGAAVWGGANTFNRLMRYAHPQVKLIDFSPGEKYLVTY***********NRVVINIFDVRTGKVMRDFKGSADEFAVGGTGGVAGVSWPVFRWGGGKDKYFAKLGKNMISVYETESFTLIDKKSLKVENVMDFSWSPTDPIISLFVPELGGGNQPARVSLVQI*****LRQKNLFSVSDCKMYWQSSGDYLAVKVDRYTKTKKSTYTGFELFRIKERDIPIEVLELDNKNDKIIAFAWEPKGHRFAVIHGDSPRPDISFYSMRTAQHAGRVSKLTTLKGKQANALFWSPSGRFIVLAGLKGFNGQLEFYNVDELETMATAEHFMATDVEWDPTGRYVATAVTSVHEMENGFNIWSFNGKLLYRTLKDHFFQFLWRP*******************************************************************************************************

***************RLGIDLLQVDLDSIQLPPGEDLGIISDDEDVYEDDDQEVESGFGNIIVVDNLPVVPKEKFEKLEGVIKEDGLWMPVDPETQKSLGYCFIEYNTPQEAELAKEKTNGYKLDRAHIFAVNMFDDFDKFMKVPDEWAPPEHKPYTPGENLQKWLTDEKARDQFVIRSGTDTEVLWNDARHLKPEPVYKRSYWTESFVQWSPLGTYLATVHRQGAAVWGGANTFNRLMRYAHPQVKLIDFSPGEKYLVTYSSHEPSNPRDANRVVINIFDVRTGKVMRDFKGSADEFAVGGTGGVAGVSWPVFRWGGGKDKYFAKLGKNMISVYETESFTLIDKKSLKVENVMDFSWSPTDPIISLFVPELGGGNQPARVSLVQIPSKEELRQKNLFSVSDCKMYWQSSGDYLAVKVDRYTKTKKSTYTGFELFRIKERDIPIEVLELDNKNDKIIAFAWEPKGHRFAVIHGDSPRPDISFYSMRTAQHAGRVSKLTTLKGKQANALFWSPSGRFIVLAGLKGFNGQLEFYNVDELETMATAEHFMATDVEWDPTGRYVATAVTSVHEMENGFNIWSFNGKLLYRTLKDHFFQFLWRPRPP********************************************************************************YEAKEVEVEEVLDVTEEVE*

MGDVLIMNEIDATANRLGIDLLQVDLDSIQLPPGEDLGIISDDEDVYEDDDQEVESGFGNIIVVDNLPVVPKEKFEKLEGVIKEDGLWMPVDPETQKSLGYCFIEYNTPQEAELAKEKTNGYKLDRAHIFAVNMFDDFDKFMKVPDEWAPPEHKPYTPGENLQKWLTDEKARDQFVIRSGTDTEVLWNDARHLKPEPVYKRSYWTESFVQWSPLGTYLATVHRQGAAVWGGANTFNRLMRYAHPQVKLIDFSPGEKYLVTYSSHEPSNPRDANRVVINIFDVRTGKVMRDFKGSADEFAVGGTGGVAGVSWPVFRWGGGKDKYFAKLGKNMISVYETESFTLIDKKSLKVENVMDFSWSPTDPIISLFVPELGGGNQPARVSLVQIPSKEELRQKNLFSVSDCKMYWQSSGDYLAVKVDRYTKTKKSTYTGFELFRIKERDIPIEVLELDNKNDKIIAFAWEPKGHRFAVIHGDSPRPDISFYSMRTAQHAGRVSKLTTLKGKQANALFWSPSGRFIVLAGLKGFNGQLEFYNVDELETMATAEHFMATDVEWDPTGRYVATAVTSVHEMENGFNIWSFNGKLLYRTLKDHFFQFLWRPRPPSFLTPEKEEEIAKNLKKYSKK************************NEWEKKISEWKRLHEEE************************EVEEV*********

********EIDATANRLGIDLLQVDLDSIQLPPGEDLGIISDDEDVYEDDDQEVESGFGNIIVVDNLPVVPKEKFEKLEGVIKEDGLWMPVDPETQKSLGYCFIEYNTPQEAELAKEKTNGYKLDRAHIFAVNMFDDFDKFMKVPDEWAPPEHKPYTPGENLQKWLTDEKARDQFVIRSGTDTEVLWNDARHLKPEPVYKRSYWTESFVQWSPLGTYLATVHRQGAAVWGGANTFNRLMRYAHPQVKLIDFSPGEKYLVTYSSHEPSNPRDANRVVINIFDVRTGKVMRDFKGSAD**********AGVSWPVFRWGGGKDKYFAKLGKNMISVYETESFTLIDKKSLKVENVMDFSWSPTDPIISLFVPELGGGNQPARVSLVQIPSKEELRQKNLFSVSDCKMYWQSSGDYLAVKVDRYTKTKKSTYTGFELFRIKERDIPIEVLELDNKNDKIIAFAWEPKGHRFAVIHGDSPRPDISFYSMRTAQHAGRVSKLTTLKGKQANALFWSPSGRFIVLAGLKGFNGQLEFYNVDELETMATAEHFMATDVEWDPTGRYVATAVTSVHEMENGFNIWSFNGKLLYRTLKDHFFQFLWRPRPPSFLTPEKEEEIAKNLKKYSKKYEAEDQDVSMQLSEQEREKRRSLKNEWEKKISEWKRLHEEEKMERQML*****SDEEEEYEAKEVEVEEVLDVTEEVE*

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MGDVLIMNEIDATANRLGIDLLQVDLDSIQLPPGEDLGIISDDEDVYEDDDQEVESGFGNIIVVDNLPVVPKEKFEKLEGVIKEDGLWMPVDPETQKSLGYCFIEYNTPQEAELAKEKTNGYKLDRAHIFAVNMFDDFDKFMKVPDEWAPPEHKPYTPGENLQKWLTDEKARDQFVIRSGTDTEVLWNDARHLKPEPVYKRSYWTESFVQWSPLGTYLATVHRQGAAVWGGANTFNRLMRYAHPQVKLIDFSPGEKYLVTYSSHEPSNPRDANRVVINIFDVRTGKVMRDFKGSADEFAVGGTGGVAGVSWPVFRWGGGKDKYFAKLGKNMISVYETESFTLIDKKSLKVENVMDFSWSPTDPIISLFVPELGGGNQPARVSLVQIPSKEELRQKNLFSVSDCKMYWQSSGDYLAVKVDRYTKTKKSTYTGFELFRIKERDIPIEVLELDNKNDKIIAFAWEPKGHRFAVIHGDSPRPDISFYSMRTAQHAGRVSKLTTLKGKQANALFWSPSGRFIVLAGLKGFNGQLEFYNVDELETMATAEHFMATDVEWDPTGRYVATAVTSVHEMENGFNIWSFNGKLLYRTLKDHFFQFLWRPRPPSFLTPEKEEEIAKNLKKYSKKYEAEDQDVSMQLSEQEREKRRSLxxxxxxxxxxxxxxxxxxxxxRQMLRDGExxxxxxxxxxxxxxxxxxxxxTEEVEE

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		702	2.2.26 [Sep-21-2011]
Q9C5Z1		712	Eukaryotic translation in	yes	no	0.985	0.971	0.795	0.0
P56821		719	Eukaryotic translation in	N/A	no	0.994	0.970	0.814	0.0
P55884		814	Eukaryotic translation in	yes	no	0.864	0.745	0.431	1e-151
Q569Z1		688	Eukaryotic translation in	N/A	no	0.898	0.917	0.424	1e-151
Q8JZQ9		803	Eukaryotic translation in	yes	no	0.864	0.755	0.427	1e-150
Q4G061		797	Eukaryotic translation in	yes	no	0.864	0.761	0.427	1e-150
A7MB16		786	Eukaryotic translation in	yes	no	0.864	0.772	0.427	1e-150
Q0IEY3		688	Eukaryotic translation in	N/A	no	0.854	0.872	0.417	1e-139
Q1HDZ5		695	Eukaryotic translation in	N/A	no	0.866	0.874	0.420	1e-138
B0W562		688	Eukaryotic translation in	N/A	no	0.854	0.872	0.402	1e-135

>sp\|Q9C5Z1\|EIF3B_ARATH Eukaryotic translation initiation factor 3 subunit B OS=Arabidopsis thaliana GN=TIF3B1 PE=1 SV=1	Back alignment and function desciption

 Score = 1178 bits (3047), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 560/704 (79%), Positives = 626/704 (88%), Gaps = 12/704 (1%)

Query: 9   EIDATANRLGIDLLQVDLDSIQLPPGEDLGIISDDEDVYEDDDQEVESGFGNIIVVDNLP 68
           +IDA A +LGID  QV+ DSIQLPPGED GI SDDE VY+DD  E ++GFGNIIVVD+LP
Sbjct: 5   DIDARAAKLGIDWSQVNFDSIQLPPGEDFGIESDDEAVYQDDQSEFDTGFGNIIVVDHLP 64

Query: 69  VVPKEKFEKLEGV----------IKEDGLWMPVDPETQKSLGYCFIEYNTPQEAELAKEK 118
           VVPKEKFEKLEGV          IKE+GLWMPVDP+T+ +LGYCFIE+NTPQEA+ AKEK
Sbjct: 65  VVPKEKFEKLEGVVKKIYNQLGVIKENGLWMPVDPDTKMTLGYCFIEFNTPQEAQNAKEK 124

Query: 119 TNGYKLDRAHIFAVNMFDDFDKFMKVPDEWAPPEHKPYTPGENLQKWLTDEKARDQFVIR 178
           ++GYKLD++HIFAVNMFDDFD+ M V +EW PP+ +PY PGENLQKWLTDEKARDQ VIR
Sbjct: 125 SHGYKLDKSHIFAVNMFDDFDRLMNVKEEWEPPQARPYVPGENLQKWLTDEKARDQLVIR 184

Query: 179 SGTDTEVLWNDARHLKPEPVYKRSYWTESFVQWSPLGTYLATVHRQGAAVWGGANTFNRL 238
           SG DTEV WND R   PEPV+KR YWTES+VQWSPLGTYL T+H+QGAAVWGGA+TF RL
Sbjct: 185 SGPDTEVFWNDTRQKAPEPVHKRPYWTESYVQWSPLGTYLVTLHKQGAAVWGGADTFTRL 244

Query: 239 MRYAHPQVKLIDFSPGEKYLVTYSSHEPSNPRDANRVVINIFDVRTGKVMRDFKGSADEF 298
           MRY H  VKL+DFSPGEKYLVTY S EPSNPRDA++V I +FDVRTG++MRDFKGSADEF
Sbjct: 245 MRYQHSMVKLVDFSPGEKYLVTYHSQEPSNPRDASKVEIKVFDVRTGRMMRDFKGSADEF 304

Query: 299 AVGGTGGVAGVSWPVFRWGGGKD-KYFAKLGKNMISVYETESFTLIDKKSLKVENVMDFS 357
           ++GG GGVAG SWPVFRW GGKD KYFAKL KN ISVYETE+F+LIDKKS+KV+NV+D  
Sbjct: 305 SIGGPGGVAGASWPVFRWAGGKDDKYFAKLSKNTISVYETETFSLIDKKSMKVDNVVDIC 364

Query: 358 WSPTDPIISLFVPELGGGNQPARVSLVQIPSKEELRQKNLFSVSDCKMYWQSSGDYLAVK 417
           WSPTD I+SLFVPE GGGNQPA+V+LVQIPSK ELRQKNLFSVSDCKMYWQSSG+YLAVK
Sbjct: 365 WSPTDSILSLFVPEQGGGNQPAKVALVQIPSKVELRQKNLFSVSDCKMYWQSSGEYLAVK 424

Query: 418 VDRYTKTKKSTYTGFELFRIKERDIPIEVLELDNKNDKIIAFAWEPKGHRFAVIHGDSPR 477
           VDRYTKTKKSTY+GFELFRIKERDIPIEVLELDNKNDKIIAFAWEPKGHRFAVIHGD PR
Sbjct: 425 VDRYTKTKKSTYSGFELFRIKERDIPIEVLELDNKNDKIIAFAWEPKGHRFAVIHGDQPR 484

Query: 478 PDISFYSMRTAQHAGRVSKLTTLKGKQANALFWSPSGRFIVLAGLKGFNGQLEFYNVDEL 537
           PD+SFYSM+TAQ+ GRVSKL TLK KQANALFWSP+G++I+LAGLKGFNGQLEF+NVDEL
Sbjct: 485 PDVSFYSMKTAQNTGRVSKLATLKAKQANALFWSPTGKYIILAGLKGFNGQLEFFNVDEL 544

Query: 538 ETMATAEHFMATDVEWDPTGRYVATAVTSVHEMENGFNIWSFNGKLLYRTLKDHFFQFLW 597
           ETMATAEHFMATD+EWDPTGRYVATAVTSVHEMENGF IWSFNG +LYR LKDHFFQ  W
Sbjct: 545 ETMATAEHFMATDIEWDPTGRYVATAVTSVHEMENGFTIWSFNGIMLYRILKDHFFQLAW 604

Query: 598 RPRPPSFLTPEKEEEIAKNLKKYSKKYEAEDQDVSMQLSEQEREKRRSLKNEWEKKISEW 657
           RPRPPSFLT EKEEEIAK LKKYSKKYEAEDQDVS+ LSEQ+REKR++LK EWEK + +W
Sbjct: 605 RPRPPSFLTAEKEEEIAKTLKKYSKKYEAEDQDVSLLLSEQDREKRKALKEEWEKWVMQW 664

Query: 658 KRLHEEEKMERQMLRDGEASD-EEEEYEAKEVEVEEVLDVTEEV 700
           K LHEEEK+ RQ LRDGE SD EE+EYEAKEVE E+++DVTEE+
Sbjct: 665 KSLHEEEKLVRQNLRDGEVSDVEEDEYEAKEVEFEDLIDVTEEI 708

Binds to the 40S ribosome and promotes the binding of methionyl-tRNAi and mRNA.
Arabidopsis thaliana (taxid: 3702)

>sp\|P56821\|EIF3B_TOBAC Eukaryotic translation initiation factor 3 subunit B OS=Nicotiana tabacum GN=TIF3B1 PE=2 SV=1	Back alignment and function description

>sp\|P55884\|EIF3B_HUMAN Eukaryotic translation initiation factor 3 subunit B OS=Homo sapiens GN=EIF3B PE=1 SV=3	Back alignment and function description

>sp\|Q569Z1\|EIF3B_XENLA Eukaryotic translation initiation factor 3 subunit B OS=Xenopus laevis GN=eif3b PE=2 SV=1	Back alignment and function description

>sp\|Q8JZQ9\|EIF3B_MOUSE Eukaryotic translation initiation factor 3 subunit B OS=Mus musculus GN=Eif3b PE=1 SV=1	Back alignment and function description

>sp\|Q4G061\|EIF3B_RAT Eukaryotic translation initiation factor 3 subunit B OS=Rattus norvegicus GN=Eif3b PE=1 SV=1	Back alignment and function description

>sp\|A7MB16\|EIF3B_BOVIN Eukaryotic translation initiation factor 3 subunit B OS=Bos taurus GN=EIF3B PE=2 SV=1	Back alignment and function description

>sp\|Q0IEY3\|EIF3B_AEDAE Eukaryotic translation initiation factor 3 subunit B OS=Aedes aegypti GN=eIF3-S9 PE=3 SV=1	Back alignment and function description

>sp\|Q1HDZ5\|EIF3B_BOMMO Eukaryotic translation initiation factor 3 subunit B OS=Bombyx mori GN=eIF3-S9 PE=2 SV=1	Back alignment and function description

>sp\|B0W562\|EIF3B_CULQU Eukaryotic translation initiation factor 3 subunit B OS=Culex quinquefasciatus GN=eIF3-S9 PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		702
449496864		718	PREDICTED: LOW QUALITY PROTEIN: eukaryot	0.997	0.974	0.862	0.0
255548666		720	Eukaryotic translation initiation factor	0.997	0.972	0.852	0.0
356506676		718	PREDICTED: eukaryotic translation initia	0.995	0.973	0.850	0.0
356520818		718	PREDICTED: eukaryotic translation initia	0.995	0.973	0.849	0.0
225430549		718	PREDICTED: eukaryotic translation initia	0.995	0.973	0.863	0.0
449465352		718	PREDICTED: eukaryotic translation initia	0.997	0.974	0.863	0.0
147766289		719	hypothetical protein VITISV_017587 [Viti	0.994	0.970	0.863	0.0
224089426		719	predicted protein [Populus trichocarpa]	0.995	0.972	0.851	0.0
449443992		718	PREDICTED: eukaryotic translation initia	0.997	0.974	0.845	0.0
357465911		731	Eukaryotic translation initiation factor	0.995	0.956	0.822	0.0

>gi\|449496864\|ref\|XP_004160247.1\| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation factor 3 subunit B-like [Cucumis sativus]	Back alignment and taxonomy information

 Score = 1253 bits (3241), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 613/711 (86%), Positives = 664/711 (93%), Gaps = 11/711 (1%)

Query: 1   MGDVLIMNEIDATANRLGIDLLQVDLDSIQLPPGEDLGIISDDEDVYEDDDQEVESGFGN 60
           M DV++M EI+ TA RLGIDL QVD D+I+LPPGED GIISDDE+V +++  E +SGFGN
Sbjct: 1   MADVVLMKEIEETAGRLGIDLSQVDFDAIRLPPGEDFGIISDDEEVLQEESLEFDSGFGN 60

Query: 61  IIVVDNLPVVPKEKFEKLEGV----------IKEDGLWMPVDPETQKSLGYCFIEYNTPQ 110
           IIVVDNLPVVP EKF+KLEGV          IK+DGLWMPVD  TQK+LGYCFIEY TPQ
Sbjct: 61  IIVVDNLPVVPPEKFDKLEGVVRKIFGQIGVIKDDGLWMPVDRTTQKTLGYCFIEYGTPQ 120

Query: 111 EAELAKEKTNGYKLDRAHIFAVNMFDDFDKFMKVPDEWAPPEHKPYTPGENLQKWLTDEK 170
           EAELAKEKT+GYKLDRAHIF VNMF+DFD+FMKVPDEWAPPE  PYTPGENLQ+WLTDEK
Sbjct: 121 EAELAKEKTDGYKLDRAHIFTVNMFEDFDRFMKVPDEWAPPEVNPYTPGENLQQWLTDEK 180

Query: 171 ARDQFVIRSGTDTEVLWNDARHLKPEPVYKRSYWTESFVQWSPLGTYLATVHRQGAAVWG 230
           ARDQFVIR+G+DTEV WNDARHLKPEPVYKR++WTESFVQWS LGTYLAT+HRQGAAVWG
Sbjct: 181 ARDQFVIRAGSDTEVFWNDARHLKPEPVYKRTFWTESFVQWSSLGTYLATIHRQGAAVWG 240

Query: 231 GANTFNRLMRYAHPQVKLIDFSPGEKYLVTYSSHEPSNPRDANRVVINIFDVRTGKVMRD 290
           GA TFNRLMR+AH QVKLIDFSPGEKYLVTYSSHEPSNPRDANR+VINIFDVRTGK MRD
Sbjct: 241 GAGTFNRLMRFAHQQVKLIDFSPGEKYLVTYSSHEPSNPRDANRIVINIFDVRTGKGMRD 300

Query: 291 FKGSADEFAVGGTGGVAGVSWPVFRWGGGKD-KYFAKLGKNMISVYETESFTLIDKKSLK 349
           FKGS D+FA+GGTGGVAGVSWPVFRWGGGKD KYFA++GKN+ISVYETE+F+LIDKKSLK
Sbjct: 301 FKGSPDDFAIGGTGGVAGVSWPVFRWGGGKDDKYFARIGKNVISVYETETFSLIDKKSLK 360

Query: 350 VENVMDFSWSPTDPIISLFVPELGGGNQPARVSLVQIPSKEELRQKNLFSVSDCKMYWQS 409
           VENVMDF WSPTDPII+LFVPELGGGNQPARVSLVQIPSKEELRQKNLFSVSDCKMYWQS
Sbjct: 361 VENVMDFCWSPTDPIIALFVPELGGGNQPARVSLVQIPSKEELRQKNLFSVSDCKMYWQS 420

Query: 410 SGDYLAVKVDRYTKTKKSTYTGFELFRIKERDIPIEVLELDNKNDKIIAFAWEPKGHRFA 469
           +GDYLAVKVDRYTK KKSTYTGFELFRIKERDIPIEVLEL+NKNDKIIAFAWEPKGHRFA
Sbjct: 421 NGDYLAVKVDRYTKXKKSTYTGFELFRIKERDIPIEVLELENKNDKIIAFAWEPKGHRFA 480

Query: 470 VIHGDSPRPDISFYSMRTAQHAGRVSKLTTLKGKQANALFWSPSGRFIVLAGLKGFNGQL 529
           VIHGD+PRPD+SFYSMR+  ++GRVSKL TLKGKQANALFWSP+GRFI+LAGLKGFNGQL
Sbjct: 481 VIHGDNPRPDVSFYSMRSTNNSGRVSKLATLKGKQANALFWSPAGRFIILAGLKGFNGQL 540

Query: 530 EFYNVDELETMATAEHFMATDVEWDPTGRYVATAVTSVHEMENGFNIWSFNGKLLYRTLK 589
           EFYNVDELETMATAEHFMATD+EWDPTGRYVATAVTSVHEMENGFNIWSFNGKLLYR LK
Sbjct: 541 EFYNVDELETMATAEHFMATDIEWDPTGRYVATAVTSVHEMENGFNIWSFNGKLLYRILK 600

Query: 590 DHFFQFLWRPRPPSFLTPEKEEEIAKNLKKYSKKYEAEDQDVSMQLSEQEREKRRSLKNE 649
           DHFFQF WRPRPPSFL+PEKEEEIAKNLKKYSKKYEAEDQDVSM LSEQERE+RR LK+E
Sbjct: 601 DHFFQFAWRPRPPSFLSPEKEEEIAKNLKKYSKKYEAEDQDVSMLLSEQERERRRMLKDE 660

Query: 650 WEKKISEWKRLHEEEKMERQMLRDGEASDEEEEYEAKEVEVEEVLDVTEEV 700
           W+K ++EWKRLHEEEK+ RQ LRDGEASDEEEEYEAKEVEVEE+LDV+EEV
Sbjct: 661 WDKWVNEWKRLHEEEKLLRQKLRDGEASDEEEEYEAKEVEVEEILDVSEEV 711

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|255548666\|ref\|XP_002515389.1\| Eukaryotic translation initiation factor 3 subunit, putative [Ricinus communis] gi\|223545333\|gb\|EEF46838.1\| Eukaryotic translation initiation factor 3 subunit, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|356506676\|ref\|XP_003522102.1\| PREDICTED: eukaryotic translation initiation factor 3 subunit B-like [Glycine max]	Back alignment and taxonomy information

>gi\|356520818\|ref\|XP_003529057.1\| PREDICTED: eukaryotic translation initiation factor 3 subunit B-like [Glycine max]	Back alignment and taxonomy information

>gi\|225430549\|ref\|XP_002285591.1\| PREDICTED: eukaryotic translation initiation factor 3 subunit B [Vitis vinifera] gi\|296082169\|emb\|CBI21174.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|449465352\|ref\|XP_004150392.1\| PREDICTED: eukaryotic translation initiation factor 3 subunit B-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|147766289\|emb\|CAN76773.1\| hypothetical protein VITISV_017587 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224089426\|ref\|XP_002308719.1\| predicted protein [Populus trichocarpa] gi\|222854695\|gb\|EEE92242.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|449443992\|ref\|XP_004139759.1\| PREDICTED: eukaryotic translation initiation factor 3 subunit B-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|357465911\|ref\|XP_003603240.1\| Eukaryotic translation initiation factor 3 subunit B [Medicago truncatula] gi\|355492288\|gb\|AES73491.1\| Eukaryotic translation initiation factor 3 subunit B [Medicago truncatula]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		702
TAIR\|locus:2143621		738	TIF3B1 "translation initiation	0.810	0.771	0.807	2e-294
TAIR\|locus:2145289		714	EIF3B-2 "eukaryotic translatio	0.954	0.938	0.759	1e-290
ZFIN\|ZDB-GENE-030131-2748		683	eif3ba "eukaryotic translation	0.511	0.525	0.462	2.1e-154
UNIPROTKB\|P55884		814	EIF3B "Eukaryotic translation	0.511	0.441	0.455	1.4e-142
UNIPROTKB\|F1P969		813	EIF3B "Uncharacterized protein	0.511	0.441	0.452	2.4e-142
UNIPROTKB\|A7MB16		786	EIF3B "Eukaryotic translation	0.511	0.456	0.449	1.7e-141
MGI\|MGI:106478		803	Eif3b "eukaryotic translation	0.511	0.447	0.447	2.1e-141
RGD\|1309018		797	Eif3b "eukaryotic translation	0.511	0.450	0.447	2.1e-141
UNIPROTKB\|Q4G061		797	Eif3b "Eukaryotic translation	0.511	0.450	0.447	2.1e-141
UNIPROTKB\|Q569Z1		688	eif3b "Eukaryotic translation	0.511	0.521	0.449	2.1e-141

TAIR\|locus:2143621 TIF3B1 "translation initiation factor 3B1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 2515 (890.4 bits), Expect = 2.0e-294, Sum P(2) = 2.0e-294
 Identities = 460/570 (80%), Positives = 507/570 (88%)

Query:   110 QEAELAKEKTNGYKLDRAHIFAVNMFDDFDKFMKVPDEWAPPEHKPYTPGENLQKWLTDE 169
             QEA+ AKEK++GYKLD++HIFAVNMFDDFD+ M V +EW PP+ +PY PGENLQKWLTDE
Sbjct:   142 QEAQNAKEKSHGYKLDKSHIFAVNMFDDFDRLMNVKEEWEPPQARPYVPGENLQKWLTDE 201

Query:   170 KARDQFVIRSGTDTEVLWNDARHLKPEPVYKRSYWTESFVQWSPLGTYLATVHRQGAAVW 229
             KARDQ VIRSG DTEV WND R   PEPV+KR YWTES+VQWSPLGTYL T+H+QGAAVW
Sbjct:   202 KARDQLVIRSGPDTEVFWNDTRQKAPEPVHKRPYWTESYVQWSPLGTYLVTLHKQGAAVW 261

Query:   230 GGANTFNRLMRYAHPQVKLIDFSPGEKYLVTYSSHEPSNPRDANRVVINIFDVRTGKVMR 289
             GGA+TF RLMRY H  VKL+DFSPGEKYLVTY S EPSNPRDA++V I +FDVRTG++MR
Sbjct:   262 GGADTFTRLMRYQHSMVKLVDFSPGEKYLVTYHSQEPSNPRDASKVEIKVFDVRTGRMMR 321

Query:   290 DFKGSADEFXXXXXXXXXXXSWPVFRWGGGKD-KYFAKLGKNMISVYETESFTLIDKKSL 348
             DFKGSADEF           SWPVFRW GGKD KYFAKL KN ISVYETE+F+LIDKKS+
Sbjct:   322 DFKGSADEFSIGGPGGVAGASWPVFRWAGGKDDKYFAKLSKNTISVYETETFSLIDKKSM 381

Query:   349 KVENVMDFSWSPTDPIISLFVPELGGGNQPARVSLVQIPSKEELRQKNLFSVSDCKMYWQ 408
             KV+NV+D  WSPTD I+SLFVPE GGGNQPA+V+LVQIPSK ELRQKNLFSVSDCKMYWQ
Sbjct:   382 KVDNVVDICWSPTDSILSLFVPEQGGGNQPAKVALVQIPSKVELRQKNLFSVSDCKMYWQ 441

Query:   409 SSGDYLAVKVDRYTKTKKSTYTGFELFRIKERDIPIEVLELDNKNDKIIAFAWEPKGHRF 468
             SSG+YLAVKVDRYTKTKKSTY+GFELFRIKERDIPIEVLELDNKNDKIIAFAWEPKGHRF
Sbjct:   442 SSGEYLAVKVDRYTKTKKSTYSGFELFRIKERDIPIEVLELDNKNDKIIAFAWEPKGHRF 501

Query:   469 AVIHGDSPRPDISFYSMRTAQHAGRVSKLTTLKGKQANALFWSPSGRFIVLAGLKGFNGQ 528
             AVIHGD PRPD+SFYSM+TAQ+ GRVSKL TLK KQANALFWSP+G++I+LAGLKGFNGQ
Sbjct:   502 AVIHGDQPRPDVSFYSMKTAQNTGRVSKLATLKAKQANALFWSPTGKYIILAGLKGFNGQ 561

Query:   529 LEFYNVDELETMATAEHFMATDVEWDPTGRYVATAVTSVHEMENGFNIWSFNGKLLYRTL 588
             LEF+NVDELETMATAEHFMATD+EWDPTGRYVATAVTSVHEMENGF IWSFNG +LYR L
Sbjct:   562 LEFFNVDELETMATAEHFMATDIEWDPTGRYVATAVTSVHEMENGFTIWSFNGIMLYRIL 621

Query:   589 KDHFFQFLWRPRPPSFLTPEKEEEIAKNLKKYSKKYEAEDQDVSMQLSEQEREKRRSLKN 648
             KDHFFQ  WRPRPPSFLT EKEEEIAK LKKYSKKYEAEDQDVS+ LSEQ+REKR++LK 
Sbjct:   622 KDHFFQLAWRPRPPSFLTAEKEEEIAKTLKKYSKKYEAEDQDVSLLLSEQDREKRKALKE 681

Query:   649 EWEKKISEWKRLHEEEKMERQMLRDGEASD 678
             EWEK + +WK LHEEEK+ RQ LRDGE SD
Sbjct:   682 EWEKWVMQWKSLHEEEKLVRQNLRDGEVSD 711

GO:0000166 "nucleotide binding" evidence=IEA

GO:0003676 "nucleic acid binding" evidence=IEA;ISS

GO:0003723 "RNA binding" evidence=IEA

GO:0003743 "translation initiation factor activity" evidence=IEA;ISS;TAS

GO:0005737 "cytoplasm" evidence=ISM

GO:0006413 "translational initiation" evidence=IEA

GO:0005852 "eukaryotic translation initiation factor 3 complex" evidence=ISS

GO:0005634 "nucleus" evidence=IDA

GO:0005829 "cytosol" evidence=IDA

TAIR\|locus:2145289 EIF3B-2 "eukaryotic translation initiation factor 3B-2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-030131-2748 eif3ba "eukaryotic translation initiation factor 3, subunit Ba" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|P55884 EIF3B "Eukaryotic translation initiation factor 3 subunit B" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|F1P969 EIF3B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|A7MB16 EIF3B "Eukaryotic translation initiation factor 3 subunit B" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

MGI\|MGI:106478 Eif3b "eukaryotic translation initiation factor 3, subunit B" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

RGD\|1309018 Eif3b "eukaryotic translation initiation factor 3, subunit B" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|Q4G061 Eif3b "Eukaryotic translation initiation factor 3 subunit B" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|Q569Z1 eif3b "Eukaryotic translation initiation factor 3 subunit B" [Xenopus laevis (taxid:8355)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
P56821	EIF3B_TOBAC	No assigned EC number	0.8148	0.9943	0.9707	N/A	no
A2Q908	EIF3B_ASPNC	No assigned EC number	0.3746	0.9045	0.8581	yes	no
Q0E940	EIF3B_DROME	No assigned EC number	0.3968	0.8903	0.9057	yes	no
Q9XWI6	EIF3B_CAEEL	No assigned EC number	0.3215	0.8760	0.8482	yes	no
Q6C1H8	EIF3B_YARLI	No assigned EC number	0.3569	0.8817	0.8633	yes	no
Q54QW1	EIF3B_DICDI	No assigned EC number	0.3654	0.8803	0.9223	yes	no
Q758X9	EIF3B_ASHGO	No assigned EC number	0.3299	0.8390	0.8002	yes	no
Q4WKL7	EIF3B_ASPFU	No assigned EC number	0.3713	0.8732	0.8283	yes	no
A3LY29	EIF3B_PICST	No assigned EC number	0.3550	0.8490	0.8370	yes	no
Q9C5Z1	EIF3B_ARATH	No assigned EC number	0.7954	0.9857	0.9719	yes	no
B5E081	EIF3B_DROPS	No assigned EC number	0.3937	0.8518	0.8666	yes	no
P0CN44	EIF3B_CRYNJ	No assigned EC number	0.3481	0.9102	0.8486	yes	no
Q10425	EIF3B_SCHPO	No assigned EC number	0.3737	0.8689	0.8413	yes	no
Q2URB7	EIF3B_ASPOR	No assigned EC number	0.3824	0.8732	0.8272	yes	no
Q7PZY1	EIF3B_ANOGA	No assigned EC number	0.3933	0.8561	0.8799	yes	no
Q5BGH1	EIF3B_EMENI	No assigned EC number	0.3819	0.8547	0.8130	yes	no
Q6BLY5	EIF3B_DEBHA	No assigned EC number	0.3678	0.8262	0.8066	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		702
pfam08662		194	pfam08662, eIF2A, Eukaryotic translation initiatio	2e-93
COG5354		561	COG5354, COG5354, Uncharacterized protein, contain	5e-88
cd12278		84	cd12278, RRM_eIF3B, RNA recognition motif in eukar	1e-28
smart00360		73	smart00360, RRM, RNA recognition motif	4e-07
cd12370		76	cd12370, RRM1_PUF60, RNA recognition motif 1 in (U	5e-06
cd12371		77	cd12371, RRM2_PUF60, RNA recognition motif 2 in (U	1e-05
cd12240		78	cd12240, RRM_NCBP2, RNA recognition motif found in	1e-05
cd12368		75	cd12368, RRM3_RBM45, RNA recognition motif 3 in RN	2e-05
cd12284		73	cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2	3e-05
cd12365		73	cd12365, RRM_RNPS1, RNA recognition motif in RNA-b	6e-05
pfam00076		70	pfam00076, RRM_1, RNA recognition motif	9e-05
cd12277		86	cd12277, RRM3_MEI2_EAR1_like, RNA recognition moti	1e-04
cd12408		77	cd12408, RRM_eIF3G_like, RNA recognition motif in	1e-04
cd00200		289	cd00200, WD40, WD40 domain, found in a number of e	2e-04
COG2319		466	COG2319, COG2319, FOG: WD40 repeat [General functi	2e-04
cd00590		72	cd00590, RRM_SF, RNA recognition motif (RRM) super	3e-04
cd12378		80	cd12378, RRM1_I_PABPs, RNA recognition motif 1 in	3e-04
cd12390		92	cd12390, RRM3_RAVER, RNA recognition motif 3 in ri	3e-04
cd12362		73	cd12362, RRM3_CELF1-6, RNA recognition motif 3 in	4e-04
cd12375		77	cd12375, RRM1_Hu_like, RNA recognition motif 1 in	0.001
cd12313		84	cd12313, RRM1_RRM2_RBM5_like, RNA recognition moti	0.002
cd12355		80	cd12355, RRM_RBM18, RNA recognition motif in eukar	0.002
cd12447		76	cd12447, RRM1_gar2, RNA recognition motif 1 in yea	0.003
cd12650		78	cd12650, RRM1_Hu, RNA recognition motif 1 in the H	0.004
cd12344		81	cd12344, RRM1_SECp43_like, RNA recognition motif 1	0.004
cd12382		80	cd12382, RRM_RBMX_like, RNA recognition motif in h	0.004

>gnl\|CDD\|149648 pfam08662, eIF2A, Eukaryotic translation initiation factor eIF2A	Back alignment and domain information

 Score =  288 bits (738), Expect = 2e-93
 Identities = 83/203 (40%), Positives = 112/203 (55%), Gaps = 11/203 (5%)

Query: 395 KNLFSVSDCKMYWQSSGDYLAVKVD-RYTKTKKSTYTGFELFRIKERDIPIEVLELDNKN 453
           K+ F     KM W  +G YL V V     KT KS Y  F L+ I E   P EV+ELD + 
Sbjct: 1   KSFFKADKVKMKWNKNGTYLLVLVSTDVDKTNKSYYGEFNLYLIGETGGPDEVVELDKEG 60

Query: 454 DKIIAFAWEPKGHRFAVIHGDSPRPDISFYSMRTAQHAGRVSKLTTLKGKQANALFWSPS 513
             I  FAW P G  FAVI+G  P   I+F+ ++        + + +L  +  N +FWSP 
Sbjct: 61  P-IHDFAWSPNGKEFAVIYGYMPA-KITFFDLK-------GNVIHSLGEQPRNTIFWSPF 111

Query: 514 GRFIVLAGLKGFNGQLEFYNVDELETMATAEHFMATDVEWDPTGRYVATAVTS-VHEMEN 572
           GR ++LAG     GQ+EF++V   + +ATAE   ATD EW P GRY  TA TS    ++N
Sbjct: 112 GRLVLLAGFGNLAGQIEFWDVKNKKKIATAEASNATDCEWSPDGRYFLTATTSPRLRVDN 171

Query: 573 GFNIWSFNGKLLYRTLKDHFFQF 595
           GF IW ++GKL+Y+   D  +Q 
Sbjct: 172 GFKIWHYSGKLVYKYDFDELYQV 194

This is a family of eukaryotic translation initiation factors. Length = 194

>gnl\|CDD\|227657 COG5354, COG5354, Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|240724 cd12278, RRM_eIF3B, RNA recognition motif in eukaryotic translation initiation factor 3 subunit B (eIF-3B) and similar proteins	Back alignment and domain information

>gnl\|CDD\|214636 smart00360, RRM, RNA recognition motif	Back alignment and domain information

>gnl\|CDD\|240816 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U)-binding-splicing factor PUF60 and similar proteins	Back alignment and domain information

>gnl\|CDD\|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U)-binding-splicing factor PUF60 and similar proteins	Back alignment and domain information

>gnl\|CDD\|240686 cd12240, RRM_NCBP2, RNA recognition motif found in nuclear cap-binding protein subunit 2 (CBP20) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240814 cd12368, RRM3_RBM45, RNA recognition motif 3 in RNA-binding protein 45 (RBM45) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins	Back alignment and domain information

>gnl\|CDD\|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins	Back alignment and domain information

>gnl\|CDD\|215696 pfam00076, RRM_1, RNA recognition motif	Back alignment and domain information

>gnl\|CDD\|240723 cd12277, RRM3_MEI2_EAR1_like, RNA recognition motif 3 in Mei2-like proteins and terminal EAR1-like proteins	Back alignment and domain information

>gnl\|CDD\|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins	Back alignment and domain information

>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment

Back alignment and domain information

>gnl\|CDD\|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily	Back alignment and domain information

>gnl\|CDD\|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins	Back alignment and domain information

>gnl\|CDD\|240836 cd12390, RRM3_RAVER, RNA recognition motif 3 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins	Back alignment and domain information

>gnl\|CDD\|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins	Back alignment and domain information

>gnl\|CDD\|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins	Back alignment and domain information

>gnl\|CDD\|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in RNA-binding protein 5 (RBM5) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins	Back alignment and domain information

>gnl\|CDD\|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins	Back alignment and domain information

>gnl\|CDD\|241094 cd12650, RRM1_Hu, RNA recognition motif 1 in the Hu proteins family	Back alignment and domain information

>gnl\|CDD\|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins	Back alignment and domain information

>gnl\|CDD\|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		702
KOG2314		698	consensus Translation initiation factor 3, subunit	100.0
COG5354		561	Uncharacterized protein, contains Trp-Asp (WD) rep	100.0
KOG0271		480	consensus Notchless-like WD40 repeat-containing pr	100.0
KOG2315		566	consensus Predicted translation initiation factor	100.0
KOG0271		480	consensus Notchless-like WD40 repeat-containing pr	100.0
KOG0272		459	consensus U4/U6 small nuclear ribonucleoprotein Pr	100.0
KOG0318		603	consensus WD40 repeat stress protein/actin interac	100.0
KOG0318		603	consensus WD40 repeat stress protein/actin interac	100.0
KOG0291		893	consensus WD40-repeat-containing subunit of the 18	100.0
KOG0286		343	consensus G-protein beta subunit [General function	100.0
KOG0273		524	consensus Beta-transducin family (WD-40 repeat) pr	100.0
KOG0272		459	consensus U4/U6 small nuclear ribonucleoprotein Pr	100.0
KOG0319		775	consensus WD40-repeat-containing subunit of the 18	100.0
KOG0306		888	consensus WD40-repeat-containing subunit of the 18	100.0
KOG0291		893	consensus WD40-repeat-containing subunit of the 18	100.0
KOG0279		315	consensus G protein beta subunit-like protein [Sig	99.98
KOG0315		311	consensus G-protein beta subunit-like protein (con	99.98
KOG0319		775	consensus WD40-repeat-containing subunit of the 18	99.97
KOG0279		315	consensus G protein beta subunit-like protein [Sig	99.97
KOG0286		343	consensus G-protein beta subunit [General function	99.97
KOG0306		888	consensus WD40-repeat-containing subunit of the 18	99.97
KOG0273		524	consensus Beta-transducin family (WD-40 repeat) pr	99.97
KOG0645		312	consensus WD40 repeat protein [General function pr	99.97
KOG0293		519	consensus WD40 repeat-containing protein [Function	99.97
KOG0315		311	consensus G-protein beta subunit-like protein (con	99.97
KOG0265		338	consensus U5 snRNP-specific protein-like factor an	99.97
KOG0295		406	consensus WD40 repeat-containing protein [Function	99.97
KOG0296		399	consensus Angio-associated migratory cell protein	99.96
KOG0282		503	consensus mRNA splicing factor [Function unknown]	99.96
KOG0284		464	consensus Polyadenylation factor I complex, subuni	99.96
KOG1407		313	consensus WD40 repeat protein [Function unknown]	99.96
KOG0263		707	consensus Transcription initiation factor TFIID, s	99.96
cd00200		289	WD40 WD40 domain, found in a number of eukaryotic	99.96
KOG0284		464	consensus Polyadenylation factor I complex, subuni	99.96
KOG0266		456	consensus WD40 repeat-containing protein [General	99.95
PLN00181		793	protein SPA1-RELATED; Provisional	99.95
PF08662		194	eIF2A: Eukaryotic translation initiation factor eI	99.95
KOG0296		399	consensus Angio-associated migratory cell protein	99.95
KOG0295		406	consensus WD40 repeat-containing protein [Function	99.94
KOG0292		1202	consensus Vesicle coat complex COPI, alpha subunit	99.94
KOG0285		460	consensus Pleiotropic regulator 1 [RNA processing	99.94
KOG0293		519	consensus WD40 repeat-containing protein [Function	99.94
KOG2106		626	consensus Uncharacterized conserved protein, conta	99.94
KOG2096		420	consensus WD40 repeat protein [General function pr	99.94
KOG0973		942	consensus Histone transcription regulator HIRA, WD	99.94
KOG1539		910	consensus WD repeat protein [General function pred	99.94
KOG0645		312	consensus WD40 repeat protein [General function pr	99.94
KOG0305		484	consensus Anaphase promoting complex, Cdc20, Cdh1,	99.94
KOG0292		1202	consensus Vesicle coat complex COPI, alpha subunit	99.94
KOG1407		313	consensus WD40 repeat protein [Function unknown]	99.94
KOG0263		707	consensus Transcription initiation factor TFIID, s	99.93
cd00200		289	WD40 WD40 domain, found in a number of eukaryotic	99.93
KOG0316		307	consensus Conserved WD40 repeat-containing protein	99.93
KOG0275		508	consensus Conserved WD40 repeat-containing protein	99.93
KOG0265		338	consensus U5 snRNP-specific protein-like factor an	99.93
KOG1408		1080	consensus WD40 repeat protein [Function unknown]	99.93
KOG0643		327	consensus Translation initiation factor 3, subunit	99.93
KOG0282		503	consensus mRNA splicing factor [Function unknown]	99.93
KOG0266		456	consensus WD40 repeat-containing protein [General	99.93
KOG0285		460	consensus Pleiotropic regulator 1 [RNA processing	99.93
KOG0973		942	consensus Histone transcription regulator HIRA, WD	99.92
KOG0772		641	consensus Uncharacterized conserved protein, conta	99.92
KOG0278		334	consensus Serine/threonine kinase receptor-associa	99.92
KOG0276		794	consensus Vesicle coat complex COPI, beta' subunit	99.92
KOG2106		626	consensus Uncharacterized conserved protein, conta	99.92
KOG1446		311	consensus Histone H3 (Lys4) methyltransferase comp	99.92
KOG0305		484	consensus Anaphase promoting complex, Cdc20, Cdh1,	99.92
KOG0643		327	consensus Translation initiation factor 3, subunit	99.92
KOG0316		307	consensus Conserved WD40 repeat-containing protein	99.92
KOG1063		764	consensus RNA polymerase II elongator complex, sub	99.92
KOG0275		508	consensus Conserved WD40 repeat-containing protein	99.91
KOG0276		794	consensus Vesicle coat complex COPI, beta' subunit	99.91
KOG0310		487	consensus Conserved WD40 repeat-containing protein	99.91
PLN00181		793	protein SPA1-RELATED; Provisional	99.91
KOG0268		433	consensus Sof1-like rRNA processing protein (conta	99.91
KOG2314		698	consensus Translation initiation factor 3, subunit	99.91
KOG0288		459	consensus WD40 repeat protein TipD [General functi	99.91
KOG2055		514	consensus WD40 repeat protein [General function pr	99.91
KOG0283		712	consensus WD40 repeat-containing protein [Function	99.9
KOG0299		479	consensus U3 snoRNP-associated protein (contains W	99.9
KOG1446		311	consensus Histone H3 (Lys4) methyltransferase comp	99.89
KOG1539		910	consensus WD repeat protein [General function pred	99.89
TIGR03866		300	PQQ_ABC_repeats PQQ-dependent catabolism-associate	99.89
KOG0313		423	consensus Microtubule binding protein YTM1 (contai	99.89
KOG0313		423	consensus Microtubule binding protein YTM1 (contai	99.89
KOG0641		350	consensus WD40 repeat protein [General function pr	99.89
KOG0278		334	consensus Serine/threonine kinase receptor-associa	99.89
KOG0310		487	consensus Conserved WD40 repeat-containing protein	99.88
KOG1273		405	consensus WD40 repeat protein [General function pr	99.88
KOG2048		691	consensus WD40 repeat protein [General function pr	99.88
KOG0289		506	consensus mRNA splicing factor [General function p	99.88
KOG0640		430	consensus mRNA cleavage stimulating factor complex	99.88
PTZ00420		568	coronin; Provisional	99.88
KOG0281		499	consensus Beta-TrCP (transducin repeats containing	99.88
KOG0277		311	consensus Peroxisomal targeting signal type 2 rece	99.88
KOG0268		433	consensus Sof1-like rRNA processing protein (conta	99.88
KOG2096		420	consensus WD40 repeat protein [General function pr	99.88
KOG1063		764	consensus RNA polymerase II elongator complex, sub	99.88
KOG1273		405	consensus WD40 repeat protein [General function pr	99.87
KOG1408		1080	consensus WD40 repeat protein [Function unknown]	99.87
KOG4497		447	consensus Uncharacterized conserved protein WDR8,	99.87
TIGR03866		300	PQQ_ABC_repeats PQQ-dependent catabolism-associate	99.87
KOG0772		641	consensus Uncharacterized conserved protein, conta	99.87
PTZ00421		493	coronin; Provisional	99.87
KOG1274		933	consensus WD40 repeat protein [General function pr	99.87
KOG0647		347	consensus mRNA export protein (contains WD40 repea	99.87
KOG0283		712	consensus WD40 repeat-containing protein [Function	99.86
KOG0288		459	consensus WD40 repeat protein TipD [General functi	99.86
KOG0639		705	consensus Transducin-like enhancer of split protei	99.86
KOG0640		430	consensus mRNA cleavage stimulating factor complex	99.86
KOG0641		350	consensus WD40 repeat protein [General function pr	99.86
KOG0289		506	consensus mRNA splicing factor [General function p	99.86
KOG2055		514	consensus WD40 repeat protein [General function pr	99.85
KOG0646		476	consensus WD40 repeat protein [General function pr	99.85
KOG0281		499	consensus Beta-TrCP (transducin repeats containing	99.85
KOG1036		323	consensus Mitotic spindle checkpoint protein BUB3,	99.85
PTZ00421		493	coronin; Provisional	99.84
KOG0300		481	consensus WD40 repeat-containing protein [Function	99.84
PTZ00420		568	coronin; Provisional	99.84
KOG0274		537	consensus Cdc4 and related F-box and WD-40 protein	99.84
KOG0639		705	consensus Transducin-like enhancer of split protei	99.84
KOG0294		362	consensus WD40 repeat-containing protein [Function	99.84
KOG1445		1012	consensus Tumor-specific antigen (contains WD repe	99.83
KOG0277		311	consensus Peroxisomal targeting signal type 2 rece	99.83
KOG1274		933	consensus WD40 repeat protein [General function pr	99.82
KOG1538		1081	consensus Uncharacterized conserved protein WDR10,	99.82
KOG0650		733	consensus WD40 repeat nucleolar protein Bop1, invo	99.82
KOG2048		691	consensus WD40 repeat protein [General function pr	99.82
KOG4283		397	consensus Transcription-coupled repair protein CSA	99.81
KOG0646		476	consensus WD40 repeat protein [General function pr	99.81
KOG1009		434	consensus Chromatin assembly complex 1 subunit B/C	99.81
KOG0294		362	consensus WD40 repeat-containing protein [Function	99.8
KOG1332		299	consensus Vesicle coat complex COPII, subunit SEC1	99.8
KOG0299		479	consensus U3 snoRNP-associated protein (contains W	99.79
KOG0269		839	consensus WD40 repeat-containing protein [Function	99.79
KOG1538		1081	consensus Uncharacterized conserved protein WDR10,	99.79
KOG0300		481	consensus WD40 repeat-containing protein [Function	99.79
KOG0647		347	consensus mRNA export protein (contains WD40 repea	99.79
KOG0650		733	consensus WD40 repeat nucleolar protein Bop1, invo	99.79
KOG1963		792	consensus WD40 repeat protein [General function pr	99.78
KOG1332		299	consensus Vesicle coat complex COPII, subunit SEC1	99.78
KOG0301		745	consensus Phospholipase A2-activating protein (con	99.78
KOG0264		422	consensus Nucleosome remodeling factor, subunit CA	99.78
KOG4497		447	consensus Uncharacterized conserved protein WDR8,	99.77
KOG0308		735	consensus Conserved WD40 repeat-containing protein	99.77
KOG2919		406	consensus Guanine nucleotide-binding protein [Gene	99.77
KOG0274		537	consensus Cdc4 and related F-box and WD-40 protein	99.77
KOG0308		735	consensus Conserved WD40 repeat-containing protein	99.76
KOG2445		361	consensus Nuclear pore complex component (sc Seh1)	99.75
KOG4378		673	consensus Nuclear protein COP1 [Signal transductio	99.75
KOG1034		385	consensus Transcriptional repressor EED/ESC/FIE, r	99.75
KOG0269		839	consensus WD40 repeat-containing protein [Function	99.75
KOG2110		391	consensus Uncharacterized conserved protein, conta	99.74
KOG2139		445	consensus WD40 repeat protein [General function pr	99.73
PRK03629		429	tolB translocation protein TolB; Provisional	99.73
KOG0307		1049	consensus Vesicle coat complex COPII, subunit SEC3	99.73
KOG4378		673	consensus Nuclear protein COP1 [Signal transductio	99.72
KOG1036		323	consensus Mitotic spindle checkpoint protein BUB3,	99.72
KOG0267		825	consensus Microtubule severing protein katanin p80	99.72
KOG2919		406	consensus Guanine nucleotide-binding protein [Gene	99.72
KOG1034		385	consensus Transcriptional repressor EED/ESC/FIE, r	99.72
KOG4328		498	consensus WD40 protein [Function unknown]	99.71
KOG1445		1012	consensus Tumor-specific antigen (contains WD repe	99.71
COG5354		561	Uncharacterized protein, contains Trp-Asp (WD) rep	99.71
KOG2445		361	consensus Nuclear pore complex component (sc Seh1)	99.71
KOG0264		422	consensus Nucleosome remodeling factor, subunit CA	99.7
KOG4283		397	consensus Transcription-coupled repair protein CSA	99.7
KOG0301		745	consensus Phospholipase A2-activating protein (con	99.7
PRK11028		330	6-phosphogluconolactonase; Provisional	99.7
KOG2315		566	consensus Predicted translation initiation factor	99.7
KOG0321		720	consensus WD40 repeat-containing protein L2DTL [Fu	99.69
KOG1524		737	consensus WD40 repeat-containing protein CHE-2 [Ge	99.69
KOG0267		825	consensus Microtubule severing protein katanin p80	99.68
PRK11028		330	6-phosphogluconolactonase; Provisional	99.68
PRK05137		435	tolB translocation protein TolB; Provisional	99.68
KOG1963		792	consensus WD40 repeat protein [General function pr	99.68
COG2319		466	FOG: WD40 repeat [General function prediction only	99.67
PRK01742		429	tolB translocation protein TolB; Provisional	99.67
PF02239		369	Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO	99.66
PRK01742		429	tolB translocation protein TolB; Provisional	99.66
PRK05137		435	tolB translocation protein TolB; Provisional	99.66
PRK03629		429	tolB translocation protein TolB; Provisional	99.66
KOG1009		434	consensus Chromatin assembly complex 1 subunit B/C	99.65
KOG0290		364	consensus Conserved WD40 repeat-containing protein	99.65
PRK02889		427	tolB translocation protein TolB; Provisional	99.65
KOG4227		609	consensus WD40 repeat protein [General function pr	99.65
PF02239		369	Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO	99.65
COG2319		466	FOG: WD40 repeat [General function prediction only	99.65
PRK04922		433	tolB translocation protein TolB; Provisional	99.65
KOG4328		498	consensus WD40 protein [Function unknown]	99.64
PRK02889		427	tolB translocation protein TolB; Provisional	99.63
KOG1524		737	consensus WD40 repeat-containing protein CHE-2 [Ge	99.63
KOG0307		1049	consensus Vesicle coat complex COPII, subunit SEC3	99.63
PRK04922		433	tolB translocation protein TolB; Provisional	99.63
KOG0270		463	consensus WD40 repeat-containing protein [Function	99.61
KOG0302		440	consensus Ribosome Assembly protein [General funct	99.61
KOG0302		440	consensus Ribosome Assembly protein [General funct	99.61
COG4946		668	Uncharacterized protein related to the periplasmic	99.6
PRK01029		428	tolB translocation protein TolB; Provisional	99.6
KOG0321		720	consensus WD40 repeat-containing protein L2DTL [Fu	99.59
KOG0771		398	consensus Prolactin regulatory element-binding pro	99.59
KOG2139		445	consensus WD40 repeat protein [General function pr	99.56
PRK04792		448	tolB translocation protein TolB; Provisional	99.56
PRK04792		448	tolB translocation protein TolB; Provisional	99.55
PRK01029		428	tolB translocation protein TolB; Provisional	99.54
KOG0771		398	consensus Prolactin regulatory element-binding pro	99.53
KOG0322		323	consensus G-protein beta subunit-like protein GNB1	99.53
PRK00178		430	tolB translocation protein TolB; Provisional	99.52
KOG0644		1113	consensus Uncharacterized conserved protein, conta	99.52
PRK00178		430	tolB translocation protein TolB; Provisional	99.51
KOG0644		1113	consensus Uncharacterized conserved protein, conta	99.5
KOG1007		370	consensus WD repeat protein TSSC1, WD repeat super	99.5
PF08662		194	eIF2A: Eukaryotic translation initiation factor eI	99.5
TIGR02800		417	propeller_TolB tol-pal system beta propeller repea	99.49
TIGR02800		417	propeller_TolB tol-pal system beta propeller repea	99.49
KOG1587		555	consensus Cytoplasmic dynein intermediate chain [C	99.48
PF10282		345	Lactonase: Lactonase, 7-bladed beta-propeller; Int	99.47
TIGR02658		352	TTQ_MADH_Hv methylamine dehydrogenase heavy chain.	99.47
KOG2111		346	consensus Uncharacterized conserved protein, conta	99.47
KOG2394		636	consensus WD40 protein DMR-N9 [General function pr	99.46
COG2706		346	3-carboxymuconate cyclase [Carbohydrate transport	99.46
KOG0642		577	consensus Cell-cycle nuclear protein, contains WD-	99.46
KOG3881		412	consensus Uncharacterized conserved protein [Funct	99.45
KOG1272		545	consensus WD40-repeat-containing subunit of the 18	99.45
KOG0270		463	consensus WD40 repeat-containing protein [Function	99.45
KOG0303		472	consensus Actin-binding protein Coronin, contains	99.44
KOG0290		364	consensus Conserved WD40 repeat-containing protein	99.44
KOG2394		636	consensus WD40 protein DMR-N9 [General function pr	99.43
KOG1188		376	consensus WD40 repeat protein [General function pr	99.42
COG2706		346	3-carboxymuconate cyclase [Carbohydrate transport	99.42
PRK04043		419	tolB translocation protein TolB; Provisional	99.4
KOG1007		370	consensus WD repeat protein TSSC1, WD repeat super	99.4
PF10282		345	Lactonase: Lactonase, 7-bladed beta-propeller; Int	99.4
KOG0649		325	consensus WD40 repeat protein [General function pr	99.4
KOG1310		758	consensus WD40 repeat protein [General function pr	99.4
KOG0303		472	consensus Actin-binding protein Coronin, contains	99.39
KOG2110		391	consensus Uncharacterized conserved protein, conta	99.39
KOG4227		609	consensus WD40 repeat protein [General function pr	99.39
KOG1517		1387	consensus Guanine nucleotide binding protein MIP1	99.39
KOG1188		376	consensus WD40 repeat protein [General function pr	99.37
KOG2321		703	consensus WD40 repeat protein [General function pr	99.36
PRK04043		419	tolB translocation protein TolB; Provisional	99.36
KOG1587		555	consensus Cytoplasmic dynein intermediate chain [C	99.35
PLN03134		144	glycine-rich RNA-binding protein 4; Provisional	99.34
KOG0642		577	consensus Cell-cycle nuclear protein, contains WD-	99.34
KOG2321		703	consensus WD40 repeat protein [General function pr	99.33
KOG0322		323	consensus G-protein beta subunit-like protein GNB1	99.33
COG4946		668	Uncharacterized protein related to the periplasmic	99.33
KOG1517		1387	consensus Guanine nucleotide binding protein MIP1	99.33
KOG1523		361	consensus Actin-related protein Arp2/3 complex, su	99.32
KOG1523		361	consensus Actin-related protein Arp2/3 complex, su	99.31
KOG1272		545	consensus WD40-repeat-containing subunit of the 18	99.31
TIGR02658		352	TTQ_MADH_Hv methylamine dehydrogenase heavy chain.	99.31
KOG1240		1431	consensus Protein kinase containing WD40 repeats [	99.25
KOG2111		346	consensus Uncharacterized conserved protein, conta	99.24
KOG2041		1189	consensus WD40 repeat protein [General function pr	99.23
KOG1334		559	consensus WD40 repeat protein [General function pr	99.22
KOG0117		506	consensus Heterogeneous nuclear ribonucleoprotein	99.22
PF00930		353	DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin	99.2
KOG0131		203	consensus Splicing factor 3b, subunit 4 [RNA proce	99.18
KOG0121		153	consensus Nuclear cap-binding protein complex, sub	99.18
KOG0122		270	consensus Translation initiation factor 3, subunit	99.18
PF04762		928	IKI3: IKI3 family; InterPro: IPR006849 Members of	99.17
PF04762		928	IKI3: IKI3 family; InterPro: IPR006849 Members of	99.16
PF00930		353	DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin	99.13
PF00076		70	RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or	99.13
PF07433		305	DUF1513: Protein of unknown function (DUF1513); In	99.11
KOG1354		433	consensus Serine/threonine protein phosphatase 2A,	99.11
TIGR01661		352	ELAV_HUD_SF ELAV/HuD family splicing factor. These	99.1
KOG0126		219	consensus Predicted RNA-binding protein (RRM super	99.09
KOG1354		433	consensus Serine/threonine protein phosphatase 2A,	99.09
KOG0111		298	consensus Cyclophilin-type peptidyl-prolyl cis-tra	99.08
KOG1912		1062	consensus WD40 repeat protein [General function pr	99.08
KOG0107		195	consensus Alternative splicing factor SRp20/9G8 (R	99.06
TIGR01659		346	sex-lethal sex-lethal family splicing factor. This	99.05
KOG4207		256	consensus Predicted splicing factor, SR protein su	99.05
KOG1310		758	consensus WD40 repeat protein [General function pr	99.01
KOG2041		1189	consensus WD40 repeat protein [General function pr	99.01
KOG1334		559	consensus WD40 repeat protein [General function pr	99.01
TIGR01661		352	ELAV_HUD_SF ELAV/HuD family splicing factor. These	99.0
TIGR01645		612	half-pint poly-U binding splicing factor, half-pin	98.96
PF14259		70	RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or	98.96
KOG1240		1431	consensus Protein kinase containing WD40 repeats [	98.95
TIGR01645		612	half-pint poly-U binding splicing factor, half-pin	98.94
KOG1912		1062	consensus WD40 repeat protein [General function pr	98.93
TIGR01659		346	sex-lethal sex-lethal family splicing factor. This	98.92
KOG3881		412	consensus Uncharacterized conserved protein [Funct	98.91
KOG0649		325	consensus WD40 repeat protein [General function pr	98.9
COG0823		425	TolB Periplasmic component of the Tol biopolymer t	98.9
PLN03213		759	repressor of silencing 3; Provisional	98.9
COG0823		425	TolB Periplasmic component of the Tol biopolymer t	98.88
KOG0149		247	consensus Predicted RNA-binding protein SEB4 (RRM	98.87
PF15492		282	Nbas_N: Neuroblastoma-amplified sequence, N termin	98.87
PLN03120		260	nucleic acid binding protein; Provisional	98.86
TIGR01648		578	hnRNP-R-Q heterogeneous nuclear ribonucleoprotein	98.85
KOG0145		360	consensus RNA-binding protein ELAV/HU (RRM superfa	98.85
PF07433		305	DUF1513: Protein of unknown function (DUF1513); In	98.8
PLN02919		1057	haloacid dehalogenase-like hydrolase family protei	98.79
KOG0130		170	consensus RNA-binding protein RBM8/Tsunagi (RRM su	98.78
KOG0108		435	consensus mRNA cleavage and polyadenylation factor	98.77
KOG0974		967	consensus WD-repeat protein WDR6, WD repeat superf	98.76
KOG4547		541	consensus WD40 repeat-containing protein [General	98.76
KOG0113		335	consensus U1 small nuclear ribonucleoprotein (RRM	98.76
PLN03121		243	nucleic acid binding protein; Provisional	98.76
KOG0114		124	consensus Predicted RNA-binding protein (RRM super	98.76
KOG0148		321	consensus Apoptosis-promoting RNA-binding protein	98.73
KOG0974		967	consensus WD-repeat protein WDR6, WD repeat superf	98.72
KOG4547		541	consensus WD40 repeat-containing protein [General	98.71
KOG0145		360	consensus RNA-binding protein ELAV/HU (RRM superfa	98.71
smart00361		70	RRM_1 RNA recognition motif.	98.7
PF14583		386	Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C	98.7
TIGR01622		457	SF-CC1 splicing factor, CC1-like family. A homolog	98.69
smart00360		71	RRM RNA recognition motif.	98.68
TIGR01642		509	U2AF_lg U2 snRNP auxilliary factor, large subunit,	98.68
KOG0124		544	consensus Polypyrimidine tract-binding protein PUF	98.65
smart00362		72	RRM_2 RNA recognition motif.	98.63
PF08450		246	SGL: SMP-30/Gluconolaconase/LRE-like region; Inter	98.63
TIGR01628		562	PABP-1234 polyadenylate binding protein, human typ	98.62
KOG1920		1265	consensus IkappaB kinase complex, IKAP component [	98.61
KOG1409		404	consensus Uncharacterized conserved protein, conta	98.6
KOG0105		241	consensus Alternative splicing factor ASF/SF2 (RRM	98.59
PF06433		342	Me-amine-dh_H: Methylamine dehydrogenase heavy cha	98.59
PF14583		386	Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C	98.58
COG5170		460	CDC55 Serine/threonine protein phosphatase 2A, reg	98.58
TIGR01628		562	PABP-1234 polyadenylate binding protein, human typ	98.57
TIGR01622		457	SF-CC1 splicing factor, CC1-like family. A homolog	98.56
KOG4208		214	consensus Nucleolar RNA-binding protein NIFK [Gene	98.55
PF15492		282	Nbas_N: Neuroblastoma-amplified sequence, N termin	98.55
COG0724		306	RNA-binding proteins (RRM domain) [General functio	98.55
cd00590		74	RRM RRM (RNA recognition motif), also known as RBD	98.54
TIGR03300		377	assembly_YfgL outer membrane assembly lipoprotein	98.53
PRK02888		635	nitrous-oxide reductase; Validated	98.51
KOG0125		376	consensus Ataxin 2-binding protein (RRM superfamil	98.51
PF08450		246	SGL: SMP-30/Gluconolaconase/LRE-like region; Inter	98.5
KOG1064		2439	consensus RAVE (regulator of V-ATPase assembly) co	98.48
KOG1920		1265	consensus IkappaB kinase complex, IKAP component [	98.48
KOG0147		549	consensus Transcriptional coactivator CAPER (RRM s	98.48
PF04059		97	RRM_2: RNA recognition motif 2; InterPro: IPR00720	98.46
PLN02919		1057	haloacid dehalogenase-like hydrolase family protei	98.43
COG5170		460	CDC55 Serine/threonine protein phosphatase 2A, reg	98.42
KOG0309		1081	consensus Conserved WD40 repeat-containing protein	98.39
KOG1064		2439	consensus RAVE (regulator of V-ATPase assembly) co	98.38
PRK02888		635	nitrous-oxide reductase; Validated	98.38
KOG4532		344	consensus WD40-like repeat containing protein [Gen	98.38
KOG0146		371	consensus RNA-binding protein ETR-3 (RRM superfami	98.37
KOG0309		1081	consensus Conserved WD40 repeat-containing protein	98.36
KOG0144		510	consensus RNA-binding protein CUGBP1/BRUNO (RRM su	98.35
KOG0280		339	consensus Uncharacterized conserved protein [Amino	98.33
KOG0127		678	consensus Nucleolar protein fibrillarin NOP77 (RRM	98.31
PF02897		414	Peptidase_S9_N: Prolyl oligopeptidase, N-terminal	98.31
TIGR01649		481	hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor	98.3
KOG3617		1416	consensus WD40 and TPR repeat-containing protein [	98.29
KOG0148		321	consensus Apoptosis-promoting RNA-binding protein	98.29
KOG4532		344	consensus WD40-like repeat containing protein [Gen	98.27
PF06433		342	Me-amine-dh_H: Methylamine dehydrogenase heavy cha	98.26
KOG0127		678	consensus Nucleolar protein fibrillarin NOP77 (RRM	98.24
KOG3914		390	consensus WD repeat protein WDR4 [Function unknown	98.22
PF02897		414	Peptidase_S9_N: Prolyl oligopeptidase, N-terminal	98.21
KOG1832		1516	consensus HIV-1 Vpr-binding protein [Cell cycle co	98.21
TIGR01648		578	hnRNP-R-Q heterogeneous nuclear ribonucleoprotein	98.17
PF13893		56	RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or	98.15
PF11768		545	DUF3312: Protein of unknown function (DUF3312); In	98.14
KOG0144		510	consensus RNA-binding protein CUGBP1/BRUNO (RRM su	98.13
PF11768		545	DUF3312: Protein of unknown function (DUF3312); In	98.12
TIGR03300		377	assembly_YfgL outer membrane assembly lipoprotein	98.1
TIGR01649		481	hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor	98.09
KOG0117		506	consensus Heterogeneous nuclear ribonucleoprotein	98.09
KOG3617		1416	consensus WD40 and TPR repeat-containing protein [	98.07
KOG3914		390	consensus WD repeat protein WDR4 [Function unknown	98.05
PF00400		39	WD40: WD domain, G-beta repeat; InterPro: IPR01978	98.03
KOG0131		203	consensus Splicing factor 3b, subunit 4 [RNA proce	98.03
KOG0882		558	consensus Cyclophilin-related peptidyl-prolyl cis-	98.01
KOG0280		339	consensus Uncharacterized conserved protein [Amino	98.0
KOG2695		425	consensus WD40 repeat protein [General function pr	97.99
KOG1645		463	consensus RING-finger-containing E3 ubiquitin liga	97.99
KOG1832		1516	consensus HIV-1 Vpr-binding protein [Cell cycle co	97.98
PF13360		238	PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A	97.88
KOG4190		1034	consensus Uncharacterized conserved protein [Funct	97.86
COG3490		366	Uncharacterized protein conserved in bacteria [Fun	97.85
KOG1409		404	consensus Uncharacterized conserved protein, conta	97.84
KOG0110		725	consensus RNA-binding protein (RRM superfamily) [G	97.84
KOG2066		846	consensus Vacuolar assembly/sorting protein VPS41	97.83
KOG4190		1034	consensus Uncharacterized conserved protein [Funct	97.83
KOG0109		346	consensus RNA-binding protein LARK, contains RRM a	97.81
KOG2114		933	consensus Vacuolar assembly/sorting protein PEP5/V	97.79
KOG4206		221	consensus Spliceosomal protein snRNP-U1A/U2B [RNA	97.79
KOG0123		369	consensus Polyadenylate-binding protein (RRM super	97.78
KOG3621		726	consensus WD40 repeat-containing protein [General	97.78
KOG0533		243	consensus RRM motif-containing protein [RNA proces	97.77
PRK11138		394	outer membrane biogenesis protein BamB; Provisiona	97.77
TIGR01642		509	U2AF_lg U2 snRNP auxilliary factor, large subunit,	97.76
PF04053		443	Coatomer_WDAD: Coatomer WD associated region ; Int	97.74
PF13360		238	PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A	97.74
PF04053		443	Coatomer_WDAD: Coatomer WD associated region ; Int	97.74
KOG3621		726	consensus WD40 repeat-containing protein [General	97.73
KOG4649		354	consensus PQQ (pyrrolo-quinoline quinone) repeat p	97.71
KOG4212		608	consensus RNA-binding protein hnRNP-M [RNA process	97.7
PF00400		39	WD40: WD domain, G-beta repeat; InterPro: IPR01978	97.7
KOG1897		1096	consensus Damage-specific DNA binding complex, sub	97.65
PF06977		248	SdiA-regulated: SdiA-regulated; InterPro: IPR00972	97.63
PRK13616		591	lipoprotein LpqB; Provisional	97.58
KOG4714		319	consensus Nucleoporin [Nuclear structure]	97.58
KOG0123		369	consensus Polyadenylate-binding protein (RRM super	97.57
PF04841		410	Vps16_N: Vps16, N-terminal region; InterPro: IPR00	97.56
KOG2066		846	consensus Vacuolar assembly/sorting protein VPS41	97.56
KOG0110		725	consensus RNA-binding protein (RRM superfamily) [G	97.53
KOG0226		290	consensus RNA-binding proteins [General function p	97.51
KOG0146		371	consensus RNA-binding protein ETR-3 (RRM superfami	97.5
COG3490		366	Uncharacterized protein conserved in bacteria [Fun	97.48
KOG0124		544	consensus Polypyrimidine tract-binding protein PUF	97.48
KOG4661		940	consensus Hsp27-ERE-TATA-binding protein/Scaffold	97.48
COG3204		316	Uncharacterized protein conserved in bacteria [Fun	97.47
KOG1645		463	consensus RING-finger-containing E3 ubiquitin liga	97.47
PF04841		410	Vps16_N: Vps16, N-terminal region; InterPro: IPR00	97.46
KOG1897		1096	consensus Damage-specific DNA binding complex, sub	97.46
KOG1275		1118	consensus PAB-dependent poly(A) ribonuclease, subu	97.46
PRK10115		686	protease 2; Provisional	97.44
KOG1457		284	consensus RNA binding protein (contains RRM repeat	97.44
PRK13616		591	lipoprotein LpqB; Provisional	97.38
PRK10115		686	protease 2; Provisional	97.37
PF06977		248	SdiA-regulated: SdiA-regulated; InterPro: IPR00972	97.35
KOG4714		319	consensus Nucleoporin [Nuclear structure]	97.33
KOG0415		479	consensus Predicted peptidyl prolyl cis-trans isom	97.31
COG3391		381	Uncharacterized conserved protein [Function unknow	97.29
KOG1275		1118	consensus PAB-dependent poly(A) ribonuclease, subu	97.29
PRK11138		394	outer membrane biogenesis protein BamB; Provisiona	97.26
PF03178		321	CPSF_A: CPSF A subunit region; InterPro: IPR004871	97.24
COG3386		307	Gluconolactonase [Carbohydrate transport and metab	97.23
KOG0120		500	consensus Splicing factor U2AF, large subunit (RRM	97.2
KOG2695		425	consensus WD40 repeat protein [General function pr	97.17
KOG0132		894	consensus RNA polymerase II C-terminal domain-bind	97.12
KOG2114		933	consensus Vacuolar assembly/sorting protein PEP5/V	97.11
COG3391		381	Uncharacterized conserved protein [Function unknow	97.1
KOG4209		231	consensus Splicing factor RNPS1, SR protein superf	97.09
KOG4454		267	consensus RNA binding protein (RRM superfamily) [G	97.08
KOG4212		608	consensus RNA-binding protein hnRNP-M [RNA process	97.04
PF00780		275	CNH: CNH domain; InterPro: IPR001180 Based on sequ	97.03
PF05096		264	Glu_cyclase_2: Glutamine cyclotransferase; InterPr	97.0
KOG0882		558	consensus Cyclophilin-related peptidyl-prolyl cis-	96.83
COG3386		307	Gluconolactonase [Carbohydrate transport and metab	96.67
KOG4640		665	consensus Anaphase-promoting complex (APC), subuni	96.65
PF05096		264	Glu_cyclase_2: Glutamine cyclotransferase; InterPr	96.65
KOG4205		311	consensus RNA-binding protein musashi/mRNA cleavag	96.64
PF10647		253	Gmad1: Lipoprotein LpqB beta-propeller domain; Int	96.63
KOG1008		783	consensus Uncharacterized conserved protein, conta	96.59
KOG1548		382	consensus Transcription elongation factor TAT-SF1	96.56
KOG4660		549	consensus Protein Mei2, essential for commitment t	96.46
PF10647		253	Gmad1: Lipoprotein LpqB beta-propeller domain; Int	96.45
PF15390		671	DUF4613: Domain of unknown function (DUF4613)	96.42
PF05694		461	SBP56: 56kDa selenium binding protein (SBP56); Int	96.42
KOG4640		665	consensus Anaphase-promoting complex (APC), subuni	96.41
PF05694		461	SBP56: 56kDa selenium binding protein (SBP56); Int	96.35
KOG0109		346	consensus RNA-binding protein LARK, contains RRM a	96.27
KOG4205		311	consensus RNA-binding protein musashi/mRNA cleavag	96.26
PF00780		275	CNH: CNH domain; InterPro: IPR001180 Based on sequ	96.25
KOG2079		1206	consensus Vacuolar assembly/sorting protein VPS8 [	96.18
COG3204		316	Uncharacterized protein conserved in bacteria [Fun	96.17
smart00320		40	WD40 WD40 repeats. Note that these repeats are per	96.15
KOG2377		657	consensus Uncharacterized conserved protein [Funct	96.13
KOG1008		783	consensus Uncharacterized conserved protein, conta	96.1
KOG0106		216	consensus Alternative splicing factor SRp55/B52/SR	96.08
PF15390		671	DUF4613: Domain of unknown function (DUF4613)	96.05
PF08596		395	Lgl_C: Lethal giant larvae(Lgl) like, C-terminal;	96.0
KOG1995		351	consensus Conserved Zn-finger protein [General fun	95.93
KOG4211		510	consensus Splicing factor hnRNP-F and related RNA-	95.89
PF08553		794	VID27: VID27 cytoplasmic protein; InterPro: IPR013	95.83
KOG0116		419	consensus RasGAP SH3 binding protein rasputin, con	95.64
KOG2280		829	consensus Vacuolar assembly/sorting protein VPS16	95.62
PF03178		321	CPSF_A: CPSF A subunit region; InterPro: IPR004871	95.54
KOG1457		284	consensus RNA binding protein (contains RRM repeat	95.46
PF11608		90	Limkain-b1: Limkain b1; InterPro: IPR024582 This e	95.23
PF14783		111	BBS2_Mid: Ciliary BBSome complex subunit 2, middle	95.07
KOG4211		510	consensus Splicing factor hnRNP-F and related RNA-	95.03
KOG4307		944	consensus RNA binding protein RBM12/SWAN [General	94.95
cd00216		488	PQQ_DH Dehydrogenases with pyrrolo-quinoline quino	94.85
COG1770		682	PtrB Protease II [Amino acid transport and metabol	94.8
PF07995		331	GSDH: Glucose / Sorbosone dehydrogenase; InterPro:	94.79
COG5290		1243	IkappaB kinase complex, IKAP component [Transcript	94.76
PF14783		111	BBS2_Mid: Ciliary BBSome complex subunit 2, middle	94.68
PF12894		47	Apc4_WD40: Anaphase-promoting complex subunit 4 WD	94.68
COG5175		480	MOT2 Transcriptional repressor [Transcription]	94.68
PF14761		215	HPS3_N: Hermansky-Pudlak syndrome 3	94.67
smart00320		40	WD40 WD40 repeats. Note that these repeats are per	94.62
PF12894		47	Apc4_WD40: Anaphase-promoting complex subunit 4 WD	94.39
PF14870		302	PSII_BNR: Photosynthesis system II assembly factor	94.37
KOG0147		549	consensus Transcriptional coactivator CAPER (RRM s	94.34
cd00216		488	PQQ_DH Dehydrogenases with pyrrolo-quinoline quino	94.18
KOG4206		221	consensus Spliceosomal protein snRNP-U1A/U2B [RNA	94.12
KOG2395		644	consensus Protein involved in vacuole import and d	94.12
KOG2079		1206	consensus Vacuolar assembly/sorting protein VPS8 [	94.01
TIGR02604		367	Piru_Ver_Nterm putative membrane-bound dehydrogena	93.97
COG5290		1243	IkappaB kinase complex, IKAP component [Transcript	93.8
KOG4499		310	consensus Ca2+-binding protein Regucalcin/SMP30 [I	93.71
TIGR02604		367	Piru_Ver_Nterm putative membrane-bound dehydrogena	93.63
PF07569		219	Hira: TUP1-like enhancer of split; InterPro: IPR01	93.48
PF07995		331	GSDH: Glucose / Sorbosone dehydrogenase; InterPro:	93.42
PF08553		794	VID27: VID27 cytoplasmic protein; InterPro: IPR013	93.18
KOG4660		549	consensus Protein Mei2, essential for commitment t	93.13
KOG0153		377	consensus Predicted RNA-binding protein (RRM super	92.76
COG1506		620	DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept	92.71

>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

Probab=100.00  E-value=3.2e-106  Score=786.75  Aligned_cols=646  Identities=46%  Similarity=0.853  Sum_probs=590.3

Q ss_pred             CCCCCCCCcccc---ccccccccCCCCcEEEECCCCCCChhhHHHhHhc-------ccc-ccEEeecCCCCCceeeEEEE
Q 005315           36 DLGIISDDEDVY---EDDDQEVESGFGNIIVVDNLPVVPKEKFEKLEGV-------IKE-DGLWMPVDPETQKSLGYCFI  104 (702)
Q Consensus        36 ~~~~~~~~~~~~---~~~~~~~~~~~~~~~~v~~lp~~~~~~~~~l~~~-------~~~-~~~~~~~d~~~~~~~g~~fv  104 (702)
                      +|.+.-+|+++-   .+..|..+.+++++|+|+|+|+|+++++++|..+       +|+ +++++|.|+ .|.++||+|+
T Consensus        32 ~fvd~v~de~l~~Dll~k~p~~~eg~D~vVvv~g~PvV~~~rl~klk~vl~kvfsk~gk~vn~~~P~~e-~ggtkG~lf~  110 (698)
T KOG2314|consen   32 GFVDDVDDEDLVGDLLEKRPVTAEGFDSVVVVDGAPVVGPARLEKLKKVLTKVFSKAGKIVNMYYPIDE-EGGTKGYLFV  110 (698)
T ss_pred             ccccccchhhhhhHHHhhCcCccCCcceEEEECCCcccChhHHHHHHHHHHHHHHhhccccceeeccCc-cCCeeeEEEE
Confidence            455555555431   2666666679999999999999999999998873       455 799999998 4559999999


Q ss_pred             EeCCHHHHHHHHHHhCCCccCCeeEEEEEeccCcccccCCCCCCCCCCCCCCCCCccccccccCCCCCceEEEEeCCce-
Q 005315          105 EYNTPQEAELAKEKTNGYKLDRAHIFAVNMFDDFDKFMKVPDEWAPPEHKPYTPGENLQKWLTDEKARDQFVIRSGTDT-  183 (702)
Q Consensus       105 ~~~~~~~a~~a~~~~~~~~~~~~h~~~v~~~~d~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-  183 (702)
                      +|.+..+|+.|++.|||++||++|+|.|+.|.|+++|..++++|.+|..++|++.++|++||+|+++||||++..+... 
T Consensus       111 E~~~~~~A~~aVK~l~G~~ldknHtf~v~~f~d~eky~s~~dew~~pe~q~fk~~~~L~~WL~d~~~RDQf~v~~d~~~~  190 (698)
T KOG2314|consen  111 EYASMRDAKKAVKSLNGKRLDKNHTFFVRLFKDFEKYESISDEWREPEKQTFKDSSDLRSWLMDDKCRDQFVVQDDVKTT  190 (698)
T ss_pred             EecChhhHHHHHHhcccceecccceEEeehhhhHHHhcCCccccCCcccccccchHHHHHHHhCccccceEEEEecCcce
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999999998776 


Q ss_pred             -EEEecCCCCCCCcccccCCCcccceEEECCCCcEEEEEeCCceEEeecCcCcceeeeecCCCeeEEEecCCCCEEEEEc
Q 005315          184 -EVLWNDARHLKPEPVYKRSYWTESFVQWSPLGTYLATVHRQGAAVWGGANTFNRLMRYAHPQVKLIDFSPGEKYLVTYS  262 (702)
Q Consensus       184 -~~~w~~~~~~~~~~~~~~~~~~v~~v~~Spdg~~lat~~~~~i~iw~~~~~~~~~~~~~~~~v~~i~fSpdg~~l~t~s  262 (702)
                       .++||. ....+...-.+.+|+.+++.|||.|+||+|.+..||.+|++. ++.++.+|.|++|..+.|||+++||+|.+
T Consensus       191 ~svfwN~-~~n~p~~ie~RenWTetyv~wSP~GTYL~t~Hk~GI~lWGG~-~f~r~~RF~Hp~Vq~idfSP~EkYLVT~s  268 (698)
T KOG2314|consen  191 VSVFWNS-KFNEPSLIEERENWTETYVRWSPKGTYLVTFHKQGIALWGGE-SFDRIQRFYHPGVQFIDFSPNEKYLVTYS  268 (698)
T ss_pred             eEEEccc-cCCchhhhhhhhcceeeeEEecCCceEEEEEeccceeeecCc-cHHHHHhccCCCceeeecCCccceEEEec
Confidence             789998 455777788899999999999999999999999999999999 99999999999999999999999999999


Q ss_pred             CCCCCCC-cCCCccEEEEEEccCCcEEeeccCCCcccccCCCCCCCCcccceEEEcCCCCcEEEEecCCeEEEEecCCcc
Q 005315          263 SHEPSNP-RDANRVVINIFDVRTGKVMRDFKGSADEFAVGGTGGVAGVSWPVFRWGGGKDKYFAKLGKNMISVYETESFT  341 (702)
Q Consensus       263 ~d~~~~~-~~~~~~~i~vwd~~~g~~~~~~~~~~~~~~~~~~~~~~~~~w~~~~~s~~dg~~la~~~d~~i~v~d~~~~~  341 (702)
                      ..+...+ .+.....++|||+.+|...++|.......          ..||.++||. |++|+|+...+.|.||+.+++.
T Consensus       269 ~~p~~~~~~d~e~~~l~IWDI~tG~lkrsF~~~~~~~----------~~WP~frWS~-DdKy~Arm~~~sisIyEtpsf~  337 (698)
T KOG2314|consen  269 PEPIIVEEDDNEGQQLIIWDIATGLLKRSFPVIKSPY----------LKWPIFRWSH-DDKYFARMTGNSISIYETPSFM  337 (698)
T ss_pred             CCccccCcccCCCceEEEEEccccchhcceeccCCCc----------cccceEEecc-CCceeEEeccceEEEEecCcee
Confidence            8765543 23344689999999999999998754332          3499999999 9999999999999999999999


Q ss_pred             cccceeeccCCeeEEEeCCCCCeEEEEeecCCCCCCCcEEEEEecCCcceeeeeeecccccceeEEccCCCEEEEEEccc
Q 005315          342 LIDKKSLKVENVMDFSWSPTDPIISLFVPELGGGNQPARVSLVQIPSKEELRQKNLFSVSDCKMYWQSSGDYLAVKVDRY  421 (702)
Q Consensus       342 ~~~~~~~~~~~v~~~~~sp~~~~la~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~s~~g~~l~~~~~~~  421 (702)
                      ++..+.++.++|.+++|||.++.||+|+|+.  .+.++++.++++|+++.++.++++++.+|+++|+.+|.|||+.++++
T Consensus       338 lld~Kslki~gIr~FswsP~~~llAYwtpe~--~~~parvtL~evPs~~~iRt~nlfnVsDckLhWQk~gdyLcvkvdR~  415 (698)
T KOG2314|consen  338 LLDKKSLKISGIRDFSWSPTSNLLAYWTPET--NNIPARVTLMEVPSKREIRTKNLFNVSDCKLHWQKSGDYLCVKVDRH  415 (698)
T ss_pred             eecccccCCccccCcccCCCcceEEEEcccc--cCCcceEEEEecCccceeeeccceeeeccEEEeccCCcEEEEEEEee
Confidence            9999999999999999999999999999999  99999999999999999999999999999999999999999999999


Q ss_pred             cccc-ccccccEEEEEEecCCcceeEEEecCCCCceeEEEEeeCCcEEEEEEcCCCCCeEEEEEeecccCcCceEEEEEc
Q 005315          422 TKTK-KSTYTGFELFRIKERDIPIEVLELDNKNDKIIAFAWEPKGHRFAVIHGDSPRPDISFYSMRTAQHAGRVSKLTTL  500 (702)
Q Consensus       422 ~~~~-~~~~~~~~l~~l~~~~~~~~~~~l~~h~~~v~~~~~sp~g~~l~~~~~d~~~~~v~i~d~~~~~~~~~~~~~~~~  500 (702)
                      +|++ ++.++++.||+++++.+|+..+.+   ...|..++|.|.|+.|++.++...++++++|.+++..  .+..++..+
T Consensus       416 tK~~~~g~f~n~eIfrireKdIpve~vel---ke~vi~FaWEP~gdkF~vi~g~~~k~tvsfY~~e~~~--~~~~lVk~~  490 (698)
T KOG2314|consen  416 TKSKVKGQFSNLEIFRIREKDIPVEVVEL---KESVIAFAWEPHGDKFAVISGNTVKNTVSFYAVETNI--KKPSLVKEL  490 (698)
T ss_pred             ccccccceEeeEEEEEeeccCCCceeeec---chheeeeeeccCCCeEEEEEccccccceeEEEeecCC--Cchhhhhhh
Confidence            9986 899999999999999999999999   9999999999999999999998777899999998532  345677888


Q ss_pred             CCCceeEEEEccCCCEEEEEeccCCCceEEEEECC--CcceeeecccCceeeeEECCCCCEEEEEEee-cccccccEEEE
Q 005315          501 KGKQANALFWSPSGRFIVLAGLKGFNGQLEFYNVD--ELETMATAEHFMATDVEWDPTGRYVATAVTS-VHEMENGFNIW  577 (702)
Q Consensus       501 ~~~~v~~~~~spdg~~l~~~~~~~~dg~v~i~d~~--~~~~~~~~~~~~i~~~~~spdg~~l~t~s~~-~~~~d~~v~iw  577 (702)
                      ....++.+.|||.|+++++++..+..|.+.++|++  +.+.+....|...+.+.|+|.|||++++++. +|..|++++||
T Consensus       491 dk~~~N~vfwsPkG~fvvva~l~s~~g~l~F~D~~~a~~k~~~~~eh~~at~veWDPtGRYvvT~ss~wrhk~d~GYri~  570 (698)
T KOG2314|consen  491 DKKFANTVFWSPKGRFVVVAALVSRRGDLEFYDTDYADLKDTASPEHFAATEVEWDPTGRYVVTSSSSWRHKVDNGYRIF  570 (698)
T ss_pred             cccccceEEEcCCCcEEEEEEecccccceEEEecchhhhhhccCccccccccceECCCCCEEEEeeehhhhccccceEEE
Confidence            88889999999999999999887678999999998  6777778889999999999999999999998 88899999999


Q ss_pred             EeccceeeeeccccEeeEEEeeCCCCCCChhhHHHHHHHHHHHhHhhhhhhHHHHhhhhHHHHHHHHHHHHHHHHHHHHH
Q 005315          578 SFNGKLLYRTLKDHFFQFLWRPRPPSFLTPEKEEEIAKNLKKYSKKYEAEDQDVSMQLSEQEREKRRSLKNEWEKKISEW  657 (702)
Q Consensus       578 ~~~g~~l~~~~~~~i~~~~w~p~~~~l~s~~~d~~i~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  657 (702)
                      +++|+++.....+.+.++.|+|+++.++|....++||||||+|+++|+++|+++...++++..++||++|++|.+||++.
T Consensus       571 tfqGrll~~~~i~~f~qF~WRPRPps~LS~e~~KkIkKnLKky~a~FeeqD~~e~~~AsrElvekrRqlm~~f~~yR~~~  650 (698)
T KOG2314|consen  571 TFQGRLLKEDIIDRFKQFLWRPRPPSLLSEEKQKKIKKNLKKYSAQFEEQDRLEQSRASRELVEKRRQLMEQFTEYREKI  650 (698)
T ss_pred             EeecHHHHHHHHHHHHhhccCCCCCcccCHHHHHHHHHHHHHHHHHHhhhhhHhhhhhHHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHhcCCCCCcccc-eEEEeEEEEeEEeeEEEeeC
Q 005315          658 KRLHEEEKMERQMLRDGEASDEEEE-YEAKEVEVEEVLDVTEEVEE  702 (702)
Q Consensus       658 ~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~ee~~~~~ee~~~  702 (702)
                      .+++.+++.++..++++++.|+.++ .+..+|+++|.++++||+.+
T Consensus       651 ~~~~~eek~~r~~lr~~vdtd~~~~~~e~veEei~e~le~tee~~~  696 (698)
T KOG2314|consen  651 IEEMAEEKSERIKLRGGVDTDALDDEFETVEEEIEEFLEVTEEKVP  696 (698)
T ss_pred             HHHHHHhhcceeeecCCCCchhhhcchhhHHHHHHHHhhccccccc
Confidence            9999999999999999999876655 56677777888888887754

>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only]	Back alignment and domain information

>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton]	Back alignment and domain information

>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton]	Back alignment and domain information

>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0286 consensus G-protein beta subunit [General function prediction only]	Back alignment and domain information

>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics]	Back alignment and domain information

>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms]	Back alignment and domain information

>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only]	Back alignment and domain information

>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms]	Back alignment and domain information

>KOG0286 consensus G-protein beta subunit [General function prediction only]	Back alignment and domain information

>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics]	Back alignment and domain information

>KOG0645 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0293 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only]	Back alignment and domain information

>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification]	Back alignment and domain information

>KOG0295 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown]	Back alignment and domain information

>KOG0282 consensus mRNA splicing factor [Function unknown]	Back alignment and domain information

>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification]	Back alignment and domain information

>KOG1407 consensus WD40 repeat protein [Function unknown]	Back alignment and domain information

>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription]	Back alignment and domain information

>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto

Back alignment and domain information

>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification]	Back alignment and domain information

>KOG0266 consensus WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>PLN00181 protein SPA1-RELATED; Provisional	Back alignment and domain information

>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins	Back alignment and domain information

>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown]	Back alignment and domain information

>KOG0295 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification]	Back alignment and domain information

>KOG0293 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown]	Back alignment and domain information

>KOG2096 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription]	Back alignment and domain information

>KOG1539 consensus WD repeat protein [General function prediction only]	Back alignment and domain information

>KOG0645 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1407 consensus WD40 repeat protein [Function unknown]	Back alignment and domain information

>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription]	Back alignment and domain information

Back alignment and domain information

>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification]	Back alignment and domain information

>KOG1408 consensus WD40 repeat protein [Function unknown]	Back alignment and domain information

>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms]	Back alignment and domain information

>KOG0282 consensus mRNA splicing factor [Function unknown]	Back alignment and domain information

>KOG0266 consensus WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification]	Back alignment and domain information

>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription]	Back alignment and domain information

>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown]	Back alignment and domain information

>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism]	Back alignment and domain information

>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown]	Back alignment and domain information

>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms]	Back alignment and domain information

>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription]	Back alignment and domain information

>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>PLN00181 protein SPA1-RELATED; Provisional	Back alignment and domain information

>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0288 consensus WD40 repeat protein TipD [General function prediction only]	Back alignment and domain information

>KOG2055 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0283 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1539 consensus WD repeat protein [General function prediction only]	Back alignment and domain information

>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein	Back alignment and domain information

>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0641 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism]	Back alignment and domain information

>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG1273 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG2048 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0289 consensus mRNA splicing factor [General function prediction only]	Back alignment and domain information

>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification]	Back alignment and domain information

>PTZ00420 coronin; Provisional	Back alignment and domain information

>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown]	Back alignment and domain information

>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG2096 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription]	Back alignment and domain information

>KOG1273 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1408 consensus WD40 repeat protein [Function unknown]	Back alignment and domain information

>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only]	Back alignment and domain information

>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein	Back alignment and domain information

>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown]	Back alignment and domain information

>PTZ00421 coronin; Provisional	Back alignment and domain information

>KOG1274 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG0283 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0288 consensus WD40 repeat protein TipD [General function prediction only]	Back alignment and domain information

>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics]	Back alignment and domain information

>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification]	Back alignment and domain information

>KOG0641 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0289 consensus mRNA splicing factor [General function prediction only]	Back alignment and domain information

>KOG2055 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0646 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown]	Back alignment and domain information

>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PTZ00421 coronin; Provisional	Back alignment and domain information

>KOG0300 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>PTZ00420 coronin; Provisional	Back alignment and domain information

>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only]	Back alignment and domain information

>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics]	Back alignment and domain information

>KOG0294 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1274 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only]	Back alignment and domain information

>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG2048 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair]	Back alignment and domain information

>KOG0646 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair]	Back alignment and domain information

>KOG0294 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG0269 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only]	Back alignment and domain information

>KOG0300 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG1963 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism]	Back alignment and domain information

>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics]	Back alignment and domain information

>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only]	Back alignment and domain information

>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only]	Back alignment and domain information

>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only]	Back alignment and domain information

>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription]	Back alignment and domain information

>KOG0269 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown]	Back alignment and domain information

>KOG2139 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PRK03629 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only]	Back alignment and domain information

>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription]	Back alignment and domain information

>KOG4328 consensus WD40 protein [Function unknown]	Back alignment and domain information

>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton]	Back alignment and domain information

>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only]	Back alignment and domain information

>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics]	Back alignment and domain information

>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair]	Back alignment and domain information

>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism]	Back alignment and domain information

>PRK11028 6-phosphogluconolactonase; Provisional	Back alignment and domain information

>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown]	Back alignment and domain information

>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only]	Back alignment and domain information

>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PRK11028 6-phosphogluconolactonase; Provisional	Back alignment and domain information

>PRK05137 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG1963 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>COG2319 FOG: WD40 repeat [General function prediction only]	Back alignment and domain information

>PRK01742 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A	Back alignment and domain information

>PRK01742 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK05137 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK03629 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair]	Back alignment and domain information

>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown]	Back alignment and domain information

>PRK02889 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG4227 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A	Back alignment and domain information

>COG2319 FOG: WD40 repeat [General function prediction only]	Back alignment and domain information

>PRK04922 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG4328 consensus WD40 protein [Function unknown]	Back alignment and domain information

>PRK02889 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only]	Back alignment and domain information

>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK04922 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG0270 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0302 consensus Ribosome Assembly protein [General function prediction only]	Back alignment and domain information

>KOG0302 consensus Ribosome Assembly protein [General function prediction only]	Back alignment and domain information

>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown]	Back alignment and domain information

>PRK01029 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown]	Back alignment and domain information

>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG2139 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PRK04792 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK04792 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK01029 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only]	Back alignment and domain information

>PRK00178 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only]	Back alignment and domain information

>PRK00178 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only]	Back alignment and domain information

>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown]	Back alignment and domain information

>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins	Back alignment and domain information

>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB	Back alignment and domain information

>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB	Back alignment and domain information

>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton]	Back alignment and domain information

>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3	Back alignment and domain information

>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain	Back alignment and domain information

>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown]	Back alignment and domain information

>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only]	Back alignment and domain information

>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism]	Back alignment and domain information

>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG3881 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0270 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton]	Back alignment and domain information

>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown]	Back alignment and domain information

>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only]	Back alignment and domain information

>KOG1188 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK04043 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown]	Back alignment and domain information

>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3	Back alignment and domain information

>KOG0649 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1310 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton]	Back alignment and domain information

>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown]	Back alignment and domain information

>KOG4227 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG1188 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG2321 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PRK04043 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton]	Back alignment and domain information

>PLN03134 glycine-rich RNA-binding protein 4; Provisional	Back alignment and domain information

>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG2321 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only]	Back alignment and domain information

>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown]	Back alignment and domain information

>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton]	Back alignment and domain information

>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton]	Back alignment and domain information

>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain	Back alignment and domain information

>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms]	Back alignment and domain information

>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown]	Back alignment and domain information

>KOG2041 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1334 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification]	Back alignment and domain information

>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation []	Back alignment and domain information

>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation []	Back alignment and domain information

>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>PF00076 RRM_1: RNA recognition motif	Back alignment and domain information

>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function	Back alignment and domain information

>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms]	Back alignment and domain information

>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor	Back alignment and domain information

>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms]	Back alignment and domain information

>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1912 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>TIGR01659 sex-lethal sex-lethal family splicing factor	Back alignment and domain information

>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification]	Back alignment and domain information

>KOG1310 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG2041 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1334 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor	Back alignment and domain information

>TIGR01645 half-pint poly-U binding splicing factor, half-pint family	Back alignment and domain information

>PF14259 RRM_6: RNA recognition motif (a	Back alignment and domain information

>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms]	Back alignment and domain information

>TIGR01645 half-pint poly-U binding splicing factor, half-pint family	Back alignment and domain information

>KOG1912 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>TIGR01659 sex-lethal sex-lethal family splicing factor	Back alignment and domain information

>KOG3881 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0649 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion]	Back alignment and domain information

>PLN03213 repressor of silencing 3; Provisional	Back alignment and domain information

>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion]	Back alignment and domain information

>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only]	Back alignment and domain information

>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal	Back alignment and domain information

>PLN03120 nucleic acid binding protein; Provisional	Back alignment and domain information

>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family	Back alignment and domain information

>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function	Back alignment and domain information

>PLN02919 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification]	Back alignment and domain information

>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only]	Back alignment and domain information

>KOG4547 consensus WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>PLN03121 nucleic acid binding protein; Provisional	Back alignment and domain information

>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only]	Back alignment and domain information

>KOG4547 consensus WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>smart00361 RRM_1 RNA recognition motif	Back alignment and domain information

>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A	Back alignment and domain information

>TIGR01622 SF-CC1 splicing factor, CC1-like family	Back alignment and domain information

>smart00360 RRM RNA recognition motif	Back alignment and domain information

>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor	Back alignment and domain information

>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>smart00362 RRM_2 RNA recognition motif	Back alignment and domain information

>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species	Back alignment and domain information

>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family	Back alignment and domain information

>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription]	Back alignment and domain information

>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown]	Back alignment and domain information

>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1	Back alignment and domain information

>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A	Back alignment and domain information

>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms]	Back alignment and domain information

>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family	Back alignment and domain information

>TIGR01622 SF-CC1 splicing factor, CC1-like family	Back alignment and domain information

>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only]	Back alignment and domain information

>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal	Back alignment and domain information

>COG0724 RNA-binding proteins (RRM domain) [General function prediction only]	Back alignment and domain information

>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability	Back alignment and domain information

>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL	Back alignment and domain information

>PRK02888 nitrous-oxide reductase; Validated	Back alignment and domain information

>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species	Back alignment and domain information

>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only]	Back alignment and domain information

>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription]	Back alignment and domain information

>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription]	Back alignment and domain information

>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2	Back alignment and domain information

>PLN02919 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms]	Back alignment and domain information

>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only]	Back alignment and domain information

>PRK02888 nitrous-oxide reductase; Validated	Back alignment and domain information

>KOG4532 consensus WD40-like repeat containing protein [General function prediction only]	Back alignment and domain information

>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism]	Back alignment and domain information

>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family	Back alignment and domain information

>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG4532 consensus WD40-like repeat containing protein [General function prediction only]	Back alignment and domain information

>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1	Back alignment and domain information

>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG3914 consensus WD repeat protein WDR4 [Function unknown]	Back alignment and domain information

>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family	Back alignment and domain information

>PF13893 RRM_5: RNA recognition motif	Back alignment and domain information

>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats	Back alignment and domain information

>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats	Back alignment and domain information

>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL	Back alignment and domain information

>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family	Back alignment and domain information

>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG3914 consensus WD repeat protein WDR4 [Function unknown]	Back alignment and domain information

>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide	Back alignment and domain information

>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification]	Back alignment and domain information

>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism]	Back alignment and domain information

>KOG2695 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A	Back alignment and domain information

>KOG4190 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG3490 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown]	Back alignment and domain information

>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG4190 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only]	Back alignment and domain information

>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification]	Back alignment and domain information

>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG3621 consensus WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG0533 consensus RRM motif-containing protein [RNA processing and modification]	Back alignment and domain information

>PRK11138 outer membrane biogenesis protein BamB; Provisional	Back alignment and domain information

>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor	Back alignment and domain information

>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A	Back alignment and domain information

>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>KOG3621 consensus WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification]	Back alignment and domain information

>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide	Back alignment and domain information

>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair]	Back alignment and domain information

>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators []	Back alignment and domain information

>PRK13616 lipoprotein LpqB; Provisional	Back alignment and domain information

>KOG4714 consensus Nucleoporin [Nuclear structure]	Back alignment and domain information

>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex	Back alignment and domain information

>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG0226 consensus RNA-binding proteins [General function prediction only]	Back alignment and domain information

>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>COG3490 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription]	Back alignment and domain information

>COG3204 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex	Back alignment and domain information

>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair]	Back alignment and domain information

>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair]	Back alignment and domain information

>PRK10115 protease 2; Provisional	Back alignment and domain information

>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only]	Back alignment and domain information

>PRK13616 lipoprotein LpqB; Provisional	Back alignment and domain information

>PRK10115 protease 2; Provisional	Back alignment and domain information

>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators []	Back alignment and domain information

>KOG4714 consensus Nucleoporin [Nuclear structure]	Back alignment and domain information

>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG3391 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair]	Back alignment and domain information

>PRK11138 outer membrane biogenesis protein BamB; Provisional	Back alignment and domain information

>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit	Back alignment and domain information

>COG3386 Gluconolactonase [Carbohydrate transport and metabolism]	Back alignment and domain information

>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>KOG2695 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription]	Back alignment and domain information

>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG3391 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification]	Back alignment and domain information

>KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification]	Back alignment and domain information

>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase	Back alignment and domain information

>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2	Back alignment and domain information

>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG3386 Gluconolactonase [Carbohydrate transport and metabolism]	Back alignment and domain information

>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2	Back alignment and domain information

>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification]	Back alignment and domain information

>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation	Back alignment and domain information

>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown]	Back alignment and domain information

>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription]	Back alignment and domain information

>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation	Back alignment and domain information

>PF15390 DUF4613: Domain of unknown function (DUF4613)	Back alignment and domain information

>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea	Back alignment and domain information

>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea	Back alignment and domain information

>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only]	Back alignment and domain information

>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification]	Back alignment and domain information

>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase	Back alignment and domain information

>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG3204 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>smart00320 WD40 WD40 repeats	Back alignment and domain information

>KOG2377 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown]	Back alignment and domain information

>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>PF15390 DUF4613: Domain of unknown function (DUF4613)	Back alignment and domain information

>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals	Back alignment and domain information

>KOG1995 consensus Conserved Zn-finger protein [General function prediction only]	Back alignment and domain information

>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification]	Back alignment and domain information

>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins	Back alignment and domain information

>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms]	Back alignment and domain information

>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit	Back alignment and domain information

>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only]	Back alignment and domain information

>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes	Back alignment and domain information

>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region	Back alignment and domain information

>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification]	Back alignment and domain information

>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only]	Back alignment and domain information

>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases	Back alignment and domain information

>COG1770 PtrB Protease II [Amino acid transport and metabolism]	Back alignment and domain information

>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases	Back alignment and domain information

>COG5290 IkappaB kinase complex, IKAP component [Transcription]	Back alignment and domain information

>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region	Back alignment and domain information

>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain	Back alignment and domain information

>COG5175 MOT2 Transcriptional repressor [Transcription]	Back alignment and domain information

>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3	Back alignment and domain information

>smart00320 WD40 WD40 repeats	Back alignment and domain information

>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain	Back alignment and domain information

>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A	Back alignment and domain information

>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription]	Back alignment and domain information

>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases	Back alignment and domain information

>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification]	Back alignment and domain information

>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain	Back alignment and domain information

>COG5290 IkappaB kinase complex, IKAP component [Transcription]	Back alignment and domain information

>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms]	Back alignment and domain information

>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain	Back alignment and domain information

>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin	Back alignment and domain information

>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases	Back alignment and domain information

>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins	Back alignment and domain information

>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		702
2nlw_A		105	Solution Structure Of The Rrm Domain Of Human Eukar		3e-12
2krb_A		81	Solution Structure Of Eif3b-Rrm Bound To Eif3j Pept		3e-07

>pdb|2NLW|A Chain A, Solution Structure Of The Rrm Domain Of Human Eukaryotic Initiation Factor 3b Length = 105

Back alignment and structure

Iteration: 1

Score = 70.1 bits (170), Expect = 3e-12, Method: Compositional matrix adjust. Identities = 40/94 (42%), Positives = 55/94 (58%), Gaps = 10/94 (10%) Query: 57 GFGNIIVVDNLPVVPKEKFEKLEGVI--------KEDGLWMPVDPETQKSLGYCFIEYNT 108 G ++IVVDN+P V ++ EKL+ VI K + P E K+ GY F+EY + Sbjct: 13 GIDSVIVVDNVPQVGPDRLEKLKNVIHKIFSKFGKITNDFYP--EEDGKTKGYIFLEYAS 70 Query: 109 PQEAELAKEKTNGYKLDRAHIFAVNMFDDFDKFM 142 P A A + +GYKLD+ H F VN+F DFDK+M Sbjct: 71 PAHAVDAVKNADGYKLDKQHTFRVNLFTDFDKYM 104

PyMOL of 2nlw

>pdb|2KRB|A Chain A, Solution Structure Of Eif3b-Rrm Bound To Eif3j Peptide Length = 81

Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		702
1nr0_A		611	Actin interacting protein 1; beta propeller, WD40	100.0
1nr0_A		611	Actin interacting protein 1; beta propeller, WD40	100.0
2ymu_A		577	WD-40 repeat protein; unknown function, two domain	100.0
2ymu_A		577	WD-40 repeat protein; unknown function, two domain	100.0
1vyh_C		410	Platelet-activating factor acetylhydrolase IB alph	100.0
3ow8_A		321	WD repeat-containing protein 61; structural genomi	100.0
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	100.0
1got_B		340	GT-beta; complex (GTP-binding/transducer), G prote	100.0
2oaj_A		902	Protein SNI1; WD40 repeat, beta propeller, endocyt	100.0
1r5m_A		425	SIR4-interacting protein SIF2; transcription corep	100.0
1pgu_A		615	Actin interacting protein 1; WD repeat, seven-blad	100.0
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	100.0
3iz6_a		380	40S ribosomal protein RACK1 (RACK1); eukaryotic ri	100.0
2pbi_B		354	Guanine nucleotide-binding protein subunit beta 5;	100.0
3fm0_A		345	Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r	100.0
4g56_B		357	MGC81050 protein; protein arginine methyltransfera	100.0
1gxr_A		337	ESG1, transducin-like enhancer protein 1; transcri	100.0
2oaj_A		902	Protein SNI1; WD40 repeat, beta propeller, endocyt	100.0
2ynn_A		304	Coatomer subunit beta'; protein transport, peptide	100.0
2pm9_A		416	Protein WEB1, protein transport protein SEC31; bet	100.0
3frx_A		319	Guanine nucleotide-binding protein subunit beta- l	100.0
2xzm_R		343	RACK1; ribosome, translation; 3.93A {Tetrahymena t	100.0
1erj_A		393	Transcriptional repressor TUP1; beta-propeller, tr	100.0
3mkq_A		814	Coatomer beta'-subunit; beta-propeller, alpha-sole	100.0
4gqb_B		344	Methylosome protein 50; TIM barrel, beta-propeller	100.0
4ery_A		312	WD repeat-containing protein 5; WD40, WIN motif, b	100.0
1pgu_A		615	Actin interacting protein 1; WD repeat, seven-blad	100.0
3mkq_A		814	Coatomer beta'-subunit; beta-propeller, alpha-sole	100.0
2hes_X		330	YDR267CP; beta-propeller, WD40 repeat, biosyntheti	100.0
1vyh_C		410	Platelet-activating factor acetylhydrolase IB alph	100.0
3vl1_A		420	26S proteasome regulatory subunit RPN14; beta-prop	100.0
3zwl_B		369	Eukaryotic translation initiation factor 3 subuni;	100.0
2ynn_A		304	Coatomer subunit beta'; protein transport, peptide	100.0
1gxr_A		337	ESG1, transducin-like enhancer protein 1; transcri	100.0
1got_B		340	GT-beta; complex (GTP-binding/transducer), G prote	100.0
1r5m_A		425	SIR4-interacting protein SIF2; transcription corep	100.0
3ow8_A		321	WD repeat-containing protein 61; structural genomi	100.0
4g56_B		357	MGC81050 protein; protein arginine methyltransfera	100.0
4aow_A		340	Guanine nucleotide-binding protein subunit beta-2;	100.0
2pbi_B		354	Guanine nucleotide-binding protein subunit beta 5;	99.98
3dm0_A		694	Maltose-binding periplasmic protein fused with RAC	99.98
1k8k_C		372	P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-	99.98
1sq9_A		397	Antiviral protein SKI8; WD repeat, beta-transducin	99.97
3fm0_A		345	Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r	99.97
3iz6_a		380	40S ribosomal protein RACK1 (RACK1); eukaryotic ri	99.97
4gqb_B		344	Methylosome protein 50; TIM barrel, beta-propeller	99.97
3frx_A		319	Guanine nucleotide-binding protein subunit beta- l	99.97
3ei3_B		383	DNA damage-binding protein 2; UV-damage, DDB, nucl	99.97
3k26_A		366	Polycomb protein EED; WD40, structural genomics, N	99.97
4h5i_A		365	Guanine nucleotide-exchange factor SEC12; copii ve	99.97
2pm9_A		416	Protein WEB1, protein transport protein SEC31; bet	99.97
4e54_B		435	DNA damage-binding protein 2; beta barrel, double	99.97
2xzm_R		343	RACK1; ribosome, translation; 3.93A {Tetrahymena t	99.97
2j04_B		524	YDR362CP, TAU91; beta propeller, type 2 promoters,	99.97
1erj_A		393	Transcriptional repressor TUP1; beta-propeller, tr	99.97
3vl1_A		420	26S proteasome regulatory subunit RPN14; beta-prop	99.97
3dwl_C		377	Actin-related protein 2/3 complex subunit 1; prope	99.97
3i2n_A		357	WD repeat-containing protein 92; WD40 repeats, str	99.97
4ery_A		312	WD repeat-containing protein 5; WD40, WIN motif, b	99.97
4a11_B		408	DNA excision repair protein ERCC-8; DNA binding pr	99.97
4gga_A		420	P55CDC, cell division cycle protein 20 homolog; ce	99.97
3zwl_B		369	Eukaryotic translation initiation factor 3 subuni;	99.97
3v7d_B		464	Cell division control protein 4; WD 40 domain, pho	99.97
2hes_X		330	YDR267CP; beta-propeller, WD40 repeat, biosyntheti	99.97
3odt_A		313	Protein DOA1; ubiquitin, nuclear protein; HET: MSE	99.97
2ovr_B		445	FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40	99.97
3gre_A		437	Serine/threonine-protein kinase VPS15; seven-blade	99.97
4aez_A		401	CDC20, WD repeat-containing protein SLP1; cell cyc	99.97
3dw8_B		447	Serine/threonine-protein phosphatase 2A 55 kDa RE	99.97
1k8k_C		372	P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-	99.97
4ggc_A		318	P55CDC, cell division cycle protein 20 homolog; ce	99.96
3vu4_A		355	KMHSV2; beta-propeller fold, protein transport; 2.	99.96
2j04_A		588	TAU60, YPL007P, hypothetical protein YPL007C; beta	99.96
2pm7_B		297	Protein transport protein SEC13, protein transport	99.96
3dm0_A		694	Maltose-binding periplasmic protein fused with RAC	99.96
3f3f_A		351	Nucleoporin SEH1; structural protein, protein comp	99.96
3bg1_A		316	Protein SEC13 homolog; NPC, transport, WD repeat,	99.96
2pm7_B		297	Protein transport protein SEC13, protein transport	99.96
1yfq_A		342	Cell cycle arrest protein BUB3; WD repeat WD40 rep	99.96
3i2n_A		357	WD repeat-containing protein 92; WD40 repeats, str	99.96
4aow_A		340	Guanine nucleotide-binding protein subunit beta-2;	99.96
3k26_A		366	Polycomb protein EED; WD40, structural genomics, N	99.96
3dwl_C		377	Actin-related protein 2/3 complex subunit 1; prope	99.96
4aez_A		401	CDC20, WD repeat-containing protein SLP1; cell cyc	99.96
1sq9_A		397	Antiviral protein SKI8; WD repeat, beta-transducin	99.96
3gre_A		437	Serine/threonine-protein kinase VPS15; seven-blade	99.96
3ei3_B		383	DNA damage-binding protein 2; UV-damage, DDB, nucl	99.96
3dw8_B		447	Serine/threonine-protein phosphatase 2A 55 kDa RE	99.95
4h5i_A		365	Guanine nucleotide-exchange factor SEC12; copii ve	99.95
3bg1_A		316	Protein SEC13 homolog; NPC, transport, WD repeat,	99.95
3mmy_A		368	MRNA export factor; mRNA export, nuclear protein;	99.95
3jrp_A		379	Fusion protein of protein transport protein SEC13	99.95
3v7d_B		464	Cell division control protein 4; WD 40 domain, pho	99.95
4gga_A		420	P55CDC, cell division cycle protein 20 homolog; ce	99.95
2j04_A		588	TAU60, YPL007P, hypothetical protein YPL007C; beta	99.95
3jrp_A		379	Fusion protein of protein transport protein SEC13	99.95
2vdu_B		450	TRNA (guanine-N(7)-)-methyltransferase- associated	99.95
4e54_B		435	DNA damage-binding protein 2; beta barrel, double	99.95
2j04_B		524	YDR362CP, TAU91; beta propeller, type 2 promoters,	99.95
2ovr_B		445	FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40	99.95
1k32_A		1045	Tricorn protease; protein degradation, substrate g	99.94
3bws_A		433	Protein LP49; two-domain, immunoglobulin-like, 7-b	99.94
2aq5_A		402	Coronin-1A; WD40 repeat, 7-bladed beta-propeller,	99.94
2xyi_A		430	Probable histone-binding protein CAF1; transcripti	99.94
1l0q_A		391	Surface layer protein; SLP, S-layer, 7-bladed beta	99.94
4a11_B		408	DNA excision repair protein ERCC-8; DNA binding pr	99.94
1p22_A		435	F-BOX/WD-repeat protein 1A; ubiquitination, degrad	99.94
3odt_A		313	Protein DOA1; ubiquitin, nuclear protein; HET: MSE	99.94
3mmy_A		368	MRNA export factor; mRNA export, nuclear protein;	99.94
4ggc_A		318	P55CDC, cell division cycle protein 20 homolog; ce	99.94
2hqs_A		415	Protein TOLB; TOLB, PAL, TOL, transport protein-li	99.94
2aq5_A		402	Coronin-1A; WD40 repeat, 7-bladed beta-propeller,	99.94
1yfq_A		342	Cell cycle arrest protein BUB3; WD repeat WD40 rep	99.94
3jro_A		753	Fusion protein of protein transport protein SEC13	99.93
2vdu_B		450	TRNA (guanine-N(7)-)-methyltransferase- associated	99.93
1l0q_A		391	Surface layer protein; SLP, S-layer, 7-bladed beta	99.93
4gq1_A		393	NUP37; propeller, transport protein; 2.40A {Schizo	99.93
2ecf_A		741	Dipeptidyl peptidase IV; prolyl oligopeptidase fam	99.93
3jro_A		753	Fusion protein of protein transport protein SEC13	99.92
1k32_A		1045	Tricorn protease; protein degradation, substrate g	99.92
2hqs_A		415	Protein TOLB; TOLB, PAL, TOL, transport protein-li	99.92
3bws_A		433	Protein LP49; two-domain, immunoglobulin-like, 7-b	99.92
3lrv_A		343	PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu	99.92
2ecf_A		741	Dipeptidyl peptidase IV; prolyl oligopeptidase fam	99.92
1xfd_A		723	DIP, dipeptidyl aminopeptidase-like protein 6, dip	99.92
1nir_A		543	Nitrite reductase; hemoprotein, denitrification, d	99.92
2xyi_A		430	Probable histone-binding protein CAF1; transcripti	99.92
1nir_A		543	Nitrite reductase; hemoprotein, denitrification, d	99.91
2z3z_A		706	Dipeptidyl aminopeptidase IV; peptidase family S9,	99.91
3vu4_A		355	KMHSV2; beta-propeller fold, protein transport; 2.	99.91
3f3f_A		351	Nucleoporin SEH1; structural protein, protein comp	99.91
2w18_A		356	PALB2, fancn, partner and localizer of BRCA2; fanc	99.9
1p22_A		435	F-BOX/WD-repeat protein 1A; ubiquitination, degrad	99.9
2z3z_A		706	Dipeptidyl aminopeptidase IV; peptidase family S9,	99.9
3u4y_A		331	Uncharacterized protein; structural genomics, PSI-	99.89
3lrv_A		343	PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu	99.89
1xfd_A		723	DIP, dipeptidyl aminopeptidase-like protein 6, dip	99.89
4gq1_A		393	NUP37; propeller, transport protein; 2.40A {Schizo	99.88
2w18_A		356	PALB2, fancn, partner and localizer of BRCA2; fanc	99.88
3pe7_A		388	Oligogalacturonate lyase; seven-bladed beta-propel	99.88
2ojh_A		297	Uncharacterized protein ATU1656/AGR_C_3050; TOLB,	99.87
1z68_A		719	Fibroblast activation protein, alpha subunit; sepr	99.87
3vgz_A		353	Uncharacterized protein YNCE; beta-propeller, prot	99.87
1pby_B		337	Quinohemoprotein amine dehydrogenase 40 kDa subuni	99.87
1z68_A		719	Fibroblast activation protein, alpha subunit; sepr	99.86
4a5s_A		740	Dipeptidyl peptidase 4 soluble form; hydrolase, ty	99.86
3u4y_A		331	Uncharacterized protein; structural genomics, PSI-	99.86
1ri6_A		343	Putative isomerase YBHE; 7-bladed propeller, enzym	99.86
1ri6_A		343	Putative isomerase YBHE; 7-bladed propeller, enzym	99.85
2ojh_A		297	Uncharacterized protein ATU1656/AGR_C_3050; TOLB,	99.85
3c5m_A		396	Oligogalacturonate lyase; blade-shaped beta-propel	99.84
3vgz_A		353	Uncharacterized protein YNCE; beta-propeller, prot	99.83
1jmx_B		349	Amine dehydrogenase; oxidoreductase; HET: TRQ HEC;	99.83
4a5s_A		740	Dipeptidyl peptidase 4 soluble form; hydrolase, ty	99.82
3o4h_A		582	Acylamino-acid-releasing enzyme; alpha/beta hydrol	99.82
1pby_B		337	Quinohemoprotein amine dehydrogenase 40 kDa subuni	99.81
3hfq_A		347	Uncharacterized protein LP_2219; Q88V64_lacpl, NES	99.81
3o4h_A		582	Acylamino-acid-releasing enzyme; alpha/beta hydrol	99.8
3pe7_A		388	Oligogalacturonate lyase; seven-bladed beta-propel	99.79
3scy_A		361	Hypothetical bacterial 6-phosphogluconolactonase;	99.78
3hfq_A		347	Uncharacterized protein LP_2219; Q88V64_lacpl, NES	99.77
1jof_A		365	Carboxy-CIS,CIS-muconate cyclase; beta-propeller,	99.77
3c5m_A		396	Oligogalacturonate lyase; blade-shaped beta-propel	99.77
3scy_A		361	Hypothetical bacterial 6-phosphogluconolactonase;	99.76
1jmx_B		349	Amine dehydrogenase; oxidoreductase; HET: TRQ HEC;	99.75
1jof_A		365	Carboxy-CIS,CIS-muconate cyclase; beta-propeller,	99.74
2oiz_A		361	Aromatic amine dehydrogenase, large subunit; oxido	99.72
1qks_A		567	Cytochrome CD1 nitrite reductase; enzyme, oxidored	99.71
2oit_A		434	Nucleoporin 214KDA; NH2 terminal domain of NUP214/	99.71
2oiz_A		361	Aromatic amine dehydrogenase, large subunit; oxido	99.69
1qks_A		567	Cytochrome CD1 nitrite reductase; enzyme, oxidored	99.66
2oit_A		434	Nucleoporin 214KDA; NH2 terminal domain of NUP214/	99.65
3azo_A		662	Aminopeptidase; POP family, hydrolase; 2.00A {Stre	99.64
2gop_A		347	Trilobed protease; beta propeller, open velcro, hy	99.64
2gop_A		347	Trilobed protease; beta propeller, open velcro, hy	99.64
3azo_A		662	Aminopeptidase; POP family, hydrolase; 2.00A {Stre	99.63
2nlw_A		105	Eukaryotic translation initiation factor 3 subunit	99.6
2xdw_A		710	Prolyl endopeptidase; alpha/beta-hydrolase, amnesi	99.57
4fxv_A		99	ELAV-like protein 1; RNA recognition motif, putati	99.57
2xdw_A		710	Prolyl endopeptidase; alpha/beta-hydrolase, amnesi	99.56
3ns6_A		100	Eukaryotic translation initiation factor 3 subuni;	99.56
2bkl_A		695	Prolyl endopeptidase; mechanistic study, celiac sp	99.56
2dg1_A		333	DRP35, lactonase; beta propeller, hydrolase; 1.72A	99.54
2mad_H		373	Methylamine dehydrogenase (heavy subunit); oxidore	99.54
3sjl_D		386	Methylamine dehydrogenase heavy chain; MAUG, C-hem	99.53
3fvz_A		329	Peptidyl-glycine alpha-amidating monooxygenase; be	99.53
2bkl_A		695	Prolyl endopeptidase; mechanistic study, celiac sp	99.5
2lkz_A		95	RNA-binding protein 5; RRM; NMR {Homo sapiens}	99.5
3dsm_A		328	Uncharacterized protein bacuni_02894; seven_blated	99.49
3s8s_A		110	Histone-lysine N-methyltransferase SETD1A; chromat	99.49
2lxi_A		91	RNA-binding protein 10; NMR {Homo sapiens}	99.48
3c75_H		426	MADH, methylamine dehydrogenase heavy chain; coppe	99.47
1yr2_A		741	Prolyl oligopeptidase; prolyl endopeptidase, mecha	99.47
2krb_A		81	Eukaryotic translation initiation factor 3 subunit	99.47
1q7f_A		286	NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL	99.47
3sjl_D		386	Methylamine dehydrogenase heavy chain; MAUG, C-hem	99.46
3e5z_A		296	Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco	99.45
1q7f_A		286	NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL	99.45
2mad_H		373	Methylamine dehydrogenase (heavy subunit); oxidore	99.44
3p5t_L		90	Cleavage and polyadenylation specificity factor S;	99.44
2dg1_A		333	DRP35, lactonase; beta propeller, hydrolase; 1.72A	99.43
1yr2_A		741	Prolyl oligopeptidase; prolyl endopeptidase, mecha	99.42
2wbr_A		89	GW182, gawky, LD47780P; DNA-binding protein, RRM,	99.41
3fvz_A		329	Peptidyl-glycine alpha-amidating monooxygenase; be	99.4
2la6_A		99	RNA-binding protein FUS; structural genomics, nort	99.4
3bs9_A		87	Nucleolysin TIA-1 isoform P40; RNA recognition mot	99.4
3md1_A		83	Nuclear and cytoplasmic polyadenylated RNA-bindin	99.4
3c75_H		426	MADH, methylamine dehydrogenase heavy chain; coppe	99.39
2j8a_A		136	Histone-lysine N-methyltransferase, H3 lysine-4 sp	99.39
3dsm_A		328	Uncharacterized protein bacuni_02894; seven_blated	99.39
3mdf_A		85	Peptidyl-prolyl CIS-trans isomerase E; RRM domain,	99.38
2x1f_A		96	MRNA 3'-END-processing protein RNA15; transcriptio	99.38
4f25_A		115	Polyadenylate-binding protein 1; RRM fold, transla	99.38
3e5z_A		296	Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco	99.38
3n9u_C		156	Cleavage and polyadenylation specificity factor S;	99.37
1whw_A		99	Hypothetical protein riken cDNA 1200009A02; RNA re	99.36
2dnz_A		95	Probable RNA-binding protein 23; RNA recognition m	99.36
2cpe_A		113	RNA-binding protein EWS; RNA recognition motif, RR	99.36
2cq0_A		103	Eukaryotic translation initiation factor 3 subunit	99.36
1x5t_A		96	Splicing factor 3B subunit 4; structure genomics,	99.36
2cqc_A		95	Arginine/serine-rich splicing factor 10; RNA recog	99.35
1s79_A		103	Lupus LA protein; RRM, alpha/beta, RNA binding pro	99.35
1p27_B		106	RNA-binding protein 8A; nuclear protein, mRNA spli	99.35
2ek1_A		95	RNA-binding protein 12; RNA recognition motif, dim	99.34
2jrs_A		108	RNA-binding protein 39; RNA binding motif of RBM39	99.34
2cqb_A		102	Peptidyl-prolyl CIS-trans isomerase E; RNA recogni	99.34
2div_A		99	TRNA selenocysteine associated protein; structural	99.34
2e5h_A		94	Zinc finger CCHC-type and RNA-binding motif- conta	99.33
2cqp_A		98	RNA-binding protein 12; RNA recognition motif, RRM	99.33
1x5s_A		102	Cold-inducible RNA-binding protein; structure geno	99.33
3no2_A		276	Uncharacterized protein; six-bladed beta-propeller	99.33
2fy1_A		116	RNA-binding motif protein, Y chromosome, family 1	99.33
1x5u_A		105	Splicing factor 3B subunit 4 (spliceosome associat	99.33
2dgs_A		99	DAZ-associated protein 1; RRM domain, structural g	99.33
2cpz_A		115	CUG triplet repeat RNA-binding protein 1; RRM doma	99.33
1oo0_B		110	CG8781-PA, drosophila Y14; RNA recognition motif,	99.33
1wez_A		102	HnRNP H', FTP-3, heterogeneous nuclear ribonucleop	99.33
2dnm_A		103	SRP46 splicing factor; RRM domain, RBD, structural	99.33
2mss_A		75	Protein (musashi1); RNA-binding domain, RNA bindin	99.33
2do4_A		100	Squamous cell carcinoma antigen recognized by T- c	99.32
3s7r_A		87	Heterogeneous nuclear ribonucleoprotein A/B; ferre	99.32
2dgo_A		115	Cytotoxic granule-associated RNA binding protein 1	99.32
2ywk_A		95	Putative RNA-binding protein 11; RRM-domain, struc	99.31
2dgp_A		106	Bruno-like 4, RNA binding protein; RRM domain, str	99.31
1rwi_B		270	Serine/threonine-protein kinase PKND; beta propell	99.31
3ulh_A		107	THO complex subunit 4; nuclear protein, RNA bindin	99.31
1x4e_A		85	RNA binding motif, single-stranded interacting pro	99.31
3ucg_A		89	Polyadenylate-binding protein 2; ferredoxin-like,	99.31
2z2n_A		299	Virginiamycin B lyase; seven-bladed beta-propeller	99.31
4a8x_A		88	RNA-binding protein with serine-rich domain 1; tra	99.31
1p1t_A		104	Cleavage stimulation factor, 64 kDa subunit; RNA r	99.31
1uaw_A		77	Mouse-musashi-1; RNP-type structure, RNA binding p	99.31
2cpf_A		98	RNA binding motif protein 19; RNA recognition moti	99.3
2dnn_A		109	RNA-binding protein 12; RRM domain, RBD, structura	99.3
2dnh_A		105	Bruno-like 5, RNA binding protein; RRM domain, RBD	99.3
1x4h_A		111	RNA-binding protein 28; structural genomics, RRM d	99.3
2dng_A		103	Eukaryotic translation initiation factor 4H; RRM d	99.29
2dgw_A		91	Probable RNA-binding protein 19; RRM domain, struc	99.29
2hgl_A		136	HNRPF protein, heterogeneous nuclear ribonucleopro	99.29
2fc8_A		102	NCL protein; structure genomics, RRM_1 domain, str	99.29
2kxn_B		129	Transformer-2 protein homolog beta; SR protein, RR	99.29
2m2b_A		131	RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio	99.28
1rwi_B		270	Serine/threonine-protein kinase PKND; beta propell	99.28
2cph_A		107	RNA binding motif protein 19; RNA recognition moti	99.28
2khc_A		118	Testis-specific RNP-type RNA binding protein; RRM,	99.28
2db1_A		118	Heterogeneous nuclear ribonucleoprotein F; RRM dom	99.27
2ki2_A		90	SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA	99.27
2dhg_A		104	TRNA selenocysteine associated protein (SECP43); R	99.27
2cq4_A		114	RNA binding motif protein 23; RRM domain, structur	99.27
2fc9_A		101	NCL protein; structure genomics, RRM_1 domain, str	99.27
2d9p_A		103	Polyadenylate-binding protein 3; RRM domain, struc	99.27
1u6f_A		139	Tcubp1, RNA-binding protein UBP1; trypanosome, mRN	99.26
2kt5_A		124	RNA and export factor-binding protein 2; chaperone	99.26
2do0_A		114	HnRNP M, heterogeneous nuclear ribonucleoprotein M	99.26
2dgx_A		96	KIAA0430 protein; RRM domain, structural genomics,	99.26
3ex7_B		126	RNA-binding protein 8A; protein-RNA complex, mRNA	99.26
1h2v_Z		156	20 kDa nuclear CAP binding protein; CAP-binding-co	99.26
1xip_A		388	Nucleoporin NUP159; beta-propeller, transport prot	99.26
2z2n_A		299	Virginiamycin B lyase; seven-bladed beta-propeller	99.25
2dha_A		123	FLJ20171 protein; RRM domain, structural genomics,	99.25
1wi8_A		104	EIF-4B, eukaryotic translation initiation factor 4	99.25
2cpi_A		111	CCR4-NOT transcription complex subunit 4; RNA reco	99.25
1pjx_A		314	Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries	99.25
1iqt_A		75	AUF1, heterogeneous nuclear ribonucleoprotein D0;	99.25
2ku7_A		140	MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio	99.25
2dgv_A		92	HnRNP M, heterogeneous nuclear ribonucleoprotein M	99.25
1wg5_A		104	Heterogeneous nuclear ribonucleoprotein H; structu	99.24
2cpy_A		114	RNA-binding protein 12; RRM domain, structural gen	99.24
2j76_E		100	EIF-4B, EIF4B, eukaryotic translation initiation f	99.23
2lmi_A		107	GRSF-1, G-rich sequence factor 1; G-rich RNA seque	99.23
2dh8_A		105	DAZ-associated protein 1; RRM domain, structural g	99.23
2rs2_A		109	Musashi-1, RNA-binding protein musashi homolog 1;	99.22
1rk8_A		165	CG8781-PA, CG8781-PA protein; mRNA processing, RRM	99.22
1fwx_A		595	Nitrous oxide reductase; beta-propeller domain, cu	99.22
3r27_A		100	HnRNP L, heterogeneous nuclear ribonucleoprotein L	99.22
1sjq_A		105	Polypyrimidine tract-binding protein 1; babbab mot	99.22
2cqd_A		116	RNA-binding region containing protein 1; RNA recog	99.22
2hgm_A		126	HNRPF protein, heterogeneous nuclear ribonucleopro	99.22
3iuj_A		693	Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas	99.22
1x4b_A		116	Heterogeneous nuclear ribonucleoproteins A2/B1; st	99.21
3q2s_C		229	Cleavage and polyadenylation specificity factor S;	99.21
2jwn_A		124	Embryonic polyadenylate-binding protein 2-B; epabp	99.21
2kn4_A		158	Immunoglobulin G-binding protein G, splicing FACT	99.21
2err_A		109	Ataxin-2-binding protein 1; protein-RNA complex, R	99.21
1x5o_A		114	RNA binding motif, single-stranded interacting pro	99.2
1wel_A		124	RNA-binding protein 12; structural genomics, NPPSF	99.2
2cqi_A		103	Nucleolysin TIAR; RNA recognition motif, RRM, RNA	99.2
3iuj_A		693	Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas	99.2
2dis_A		109	Unnamed protein product; structural genomics, RRM	99.2
2cqg_A		103	TDP-43, TAR DNA-binding protein-43; RNA recognitio	99.2
2lea_A		135	Serine/arginine-rich splicing factor 2; SR protein	99.2
1mda_H		368	Methylamine dehydrogenase (heavy subunit); electro	99.19
2a3j_A		127	U1 small nuclear ribonucleoprotein A; computationa	99.19
2cq3_A		103	RNA-binding protein 9; RRM domain, structural geno	99.18
1fj7_A		101	Nucleolin RBD1, protein C23; RNP, RRM, RNA binding	99.18
2ece_A		462	462AA long hypothetical selenium-binding protein;	99.17
2hgn_A		139	Heterogeneous nuclear ribonucleoprotein F; RNA rec	99.17
2jvr_A		111	Nucleolar protein 3; RNA recognition motif, nucleu	99.17
2xs2_A		102	Deleted in azoospermia-like; RNA binding protein-R	99.16
1fjc_A		96	Nucleolin RBD2, protein C23; RNP, RRM, RNA binding	99.16
1mda_H		368	Methylamine dehydrogenase (heavy subunit); electro	99.16
3no2_A		276	Uncharacterized protein; six-bladed beta-propeller	99.16
1pjx_A		314	Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries	99.16
2cpx_A		115	Hypothetical protein FLJ11016; RRM domain, structu	99.15
2f3j_A		177	RNA and export factor binding protein 2; RRM domai	99.14
2e5j_A		97	Methenyltetrahydrofolate synthetase domain contain	99.14
3g4e_A		297	Regucalcin; six bladed beta-propeller, gluconolcat	99.14
1x4a_A		109	Splicing factor, arginine/serine-rich 1 (splicing	99.14
2dnl_A		114	Cytoplasmic polyadenylation element binding protei	99.14
2ad9_A		119	Polypyrimidine tract-binding protein 1; RBD, RRM,	99.14
3lqv_A		115	PRE-mRNA branch site protein P14; cysless mutant,	99.13
2lcw_A		116	RNA-binding protein FUS; RRM, nucleic acid binding	98.74
3g4e_A		297	Regucalcin; six bladed beta-propeller, gluconolcat	99.13
2cq1_A		101	PTB-like protein L; RRM domain, structural genomic	99.12
2qc5_A		300	Streptogramin B lactonase; beta propeller, lyase;	99.12
4f02_A		213	Polyadenylate-binding protein 1; mRNA, eukaryotic	99.11
1x4f_A		112	Matrin 3; structural genomics, RRM domain, NPPSFA,	99.11
2qc5_A		300	Streptogramin B lactonase; beta propeller, lyase;	99.11
1wex_A		104	Hypothetical protein (riken cDNA 2810036L13); stru	99.1
2hvz_A		101	Splicing factor, arginine/serine-rich 7; RRM, RNA	99.1
1whx_A		111	Hypothetical protein riken cDNA 1200009A02; RNA re	99.09
1wg1_A		88	KIAA1579 protein, homolog EXC-7; RBD, structural g	99.09
1nu4_A		97	U1A RNA binding domain; RNA recognition motif, U1	99.09
1x4c_A		108	Splicing factor, arginine/serine-rich 1; structura	99.09
1fxl_A		167	Paraneoplastic encephalomyelitis antigen HUD; prot	99.08
2pe8_A		105	Splicing factor 45; RRM, protein binding; 2.00A {H	99.08
2cq2_A		114	Hypothetical protein LOC91801; RRM domain, structu	99.08
1x4d_A		102	Matrin 3; structural genomics, RRM domain, NPPSFA,	99.07
3dr2_A		305	Exported gluconolactonase; gluconolactonase SMP-30	99.06
3hrp_A		409	Uncharacterized protein; NP_812590.1, structural g	99.06
1b7f_A		168	Protein (SXL-lethal protein), RNA (5'-R(PGPUP*UP	99.05
3pgw_S		437	U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM	99.04
1x4g_A		109	Nucleolysin TIAR; structural genomics, RRM domain,	99.04
2jvo_A		108	Nucleolar protein 3; nucleus, phosphorylation, rib	99.04
2ece_A		462	462AA long hypothetical selenium-binding protein;	99.04
2g4b_A		172	Splicing factor U2AF 65 kDa subunit; protein-RNA c	99.04
3egn_A		143	RNA-binding protein 40; RNA recognition motif (RRM	99.04
1why_A		97	Hypothetical protein riken cDNA 1810017N16; RNA re	99.04
2dnq_A		90	RNA-binding protein 4B; RRM domain,RBD, structural	99.03
2hzc_A		87	Splicing factor U2AF 65 kDa subunit; RNA splicing,	99.03
3md3_A		166	Nuclear and cytoplasmic polyadenylated RNA-bindin	99.03
2cpj_A		99	Non-POU domain-containing octamer-binding protein;	99.03
2la4_A		101	Nuclear and cytoplasmic polyadenylated RNA-bindin	99.03
3dr2_A		305	Exported gluconolactonase; gluconolactonase SMP-30	99.02
1fxl_A		167	Paraneoplastic encephalomyelitis antigen HUD; prot	98.99
3beg_B		115	Splicing factor, arginine/serine-rich 1; kinase, S	98.99
2qfj_A		216	FBP-interacting repressor; protein-DNA complex; HE	98.99
2ghs_A		326	AGR_C_1268P; regucalcin, structural genomics, join	98.98
2voo_A		193	Lupus LA protein; RNA-binding protein, RNA recogni	98.98
3zzy_A		130	Polypyrimidine tract-binding protein 1; protein bi	98.98
1sjr_A		164	Polypyrimidine tract-binding protein 1; extended b	98.98
2i2y_A		150	Fusion protein consists of immunoglobin G- binding	98.98
1b7f_A		168	Protein (SXL-lethal protein), RNA (5'-R(PGPUP*UP	98.97
2xnq_A		97	Nuclear polyadenylated RNA-binding protein 3; tran	98.97
2cpd_A		99	Apobec-1 stimulating protein; RNA recognition moti	98.97
2ytc_A		85	PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s	98.97
1l3k_A		196	Heterogeneous nuclear ribonucleoprotein A1; nuclea	98.97
1xip_A		388	Nucleoporin NUP159; beta-propeller, transport prot	98.97
2diu_A		96	KIAA0430 protein; structural genomics, RRM domain,	98.97
2qfj_A		216	FBP-interacting repressor; protein-DNA complex; HE	98.96
2dnp_A		90	RNA-binding protein 14; RRM domain, RBD, structura	98.96
2yh0_A		198	Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli	98.96
2cqh_A		93	IGF-II mRNA-binding protein 2 isoform A; RNA recog	98.95
3d2w_A		89	TAR DNA-binding protein 43; DP-43 proteinopathy, T	98.95
2dgu_A		103	Heterogeneous nuclear ribonucleoprotein Q; RRM dom	98.95
1wf1_A		110	RNA-binding protein RALY; structural genomics, RRM	98.95
2cjk_A		167	Nuclear polyadenylated RNA-binding protein 4; HRP1	98.95
3hrp_A		409	Uncharacterized protein; NP_812590.1, structural g	98.95
4f02_A		213	Polyadenylate-binding protein 1; mRNA, eukaryotic	98.94
2e44_A		96	Insulin-like growth factor 2 mRNA binding protein	98.94
2e5i_A		124	Heterogeneous nuclear ribonucleoprotein L-like; RR	98.94
3nmr_A		175	Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl	98.94
2dgt_A		92	RNA-binding protein 30; RRM domain, structural gen	98.93
2kvi_A		96	Nuclear polyadenylated RNA-binding protein 3; RNA-	98.92
3md3_A		166	Nuclear and cytoplasmic polyadenylated RNA-bindin	98.92
3nmr_A		175	Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl	98.92
2e5g_A		94	U6 snRNA-specific terminal uridylyltransferase 1;	98.91
1jmt_A		104	Splicing factor U2AF 35 kDa subunit; RRM, RNA spli	98.91
1l3k_A		196	Heterogeneous nuclear ribonucleoprotein A1; nuclea	98.9
2qe8_A		343	Uncharacterized protein; structural genomics, join	98.89
2cjk_A		167	Nuclear polyadenylated RNA-binding protein 4; HRP1	98.89
2qe8_A		343	Uncharacterized protein; structural genomics, join	98.89
3v4m_A		105	Splicing factor U2AF 65 kDa subunit; canonical RNA	98.88
1fwx_A		595	Nitrous oxide reductase; beta-propeller domain, cu	98.88
1x5p_A		97	Negative elongation factor E; structure genomics,	98.88
3tyt_A		205	Heterogeneous nuclear ribonucleoprotein L; ferredo	98.85
2ghs_A		326	AGR_C_1268P; regucalcin, structural genomics, join	98.84
1fje_B		175	Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin	98.83
2bz2_A		121	Negative elongation factor E; NELF E, RNA recognit	98.83
3ue2_A		118	Poly(U)-binding-splicing factor PUF60; RNA recogni	98.82
2iwa_A		266	Glutamine cyclotransferase; pyroglutamate, acyltra	98.81
3smz_A		284	Protein raver-1, ribonucleoprotein PTB-binding 1;	98.77
3smz_A		284	Protein raver-1, ribonucleoprotein PTB-binding 1;	98.77
2dit_A		112	HIV TAT specific factor 1 variant; structural geno	98.75
1fje_B		175	Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin	98.75
3tyt_A		205	Heterogeneous nuclear ribonucleoprotein L; ferredo	98.74
1kb0_A		677	Quinohemoprotein alcohol dehydrogenase; beta-prope	98.73
3pgw_A		282	U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c	98.73
3sde_A		261	Paraspeckle component 1; RRM, anti parallel right	98.72
1wf0_A		88	TDP-43, TAR DNA-binding protein-43; structural gen	98.71
2ghp_A		292	U4/U6 snRNA-associated splicing factor PRP24; RNA	98.69
3tht_A		345	Alkylated DNA repair protein ALKB homolog 8; struc	98.69
1yiq_A		689	Quinohemoprotein alcohol dehydrogenase; electron t	98.67
3nol_A		262	Glutamine cyclotransferase; beta-propeller, glutam	98.67
3q7m_A		376	Lipoprotein YFGL, BAMB; beta-propeller, BAM comple	98.64
2iwa_A		266	Glutamine cyclotransferase; pyroglutamate, acyltra	98.62
1npe_A		267	Nidogen, entactin; glycoprotein, basement membrane	98.62
2ghp_A		292	U4/U6 snRNA-associated splicing factor PRP24; RNA	98.61
2g4b_A		172	Splicing factor U2AF 65 kDa subunit; protein-RNA c	98.6
3u1l_A		240	PRE-mRNA-splicing factor CWC2; CSMP, zinc finger;	98.6
2xe4_A		751	Oligopeptidase B; hydrolase-inhibitor complex, hyd	98.6
2yh0_A		198	Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli	98.6
1kb0_A		677	Quinohemoprotein alcohol dehydrogenase; beta-prope	98.59
1npe_A		267	Nidogen, entactin; glycoprotein, basement membrane	98.57
2adc_A		229	Polypyrimidine tract-binding protein 1; RBD, RRM,	98.56
3mbr_X		243	Glutamine cyclotransferase; beta-propeller; 1.44A	98.55
3pgw_A		282	U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c	98.54
1qm9_A		198	Polypyrimidine tract-binding protein; ribonucleopr	98.53
3hxj_A		330	Pyrrolo-quinoline quinone; all beta protein. incom	98.5
3sde_A		261	Paraspeckle component 1; RRM, anti parallel right	98.5
4a2l_A		795	BT_4663, two-component system sensor histidine kin	98.47
3nol_A		262	Glutamine cyclotransferase; beta-propeller, glutam	98.47
3nok_A		268	Glutaminyl cyclase; beta-propeller, cyclotransfera	98.45
3s6e_A		114	RNA-binding protein 39; ferredoxin-like, structura	98.43
1yiq_A		689	Quinohemoprotein alcohol dehydrogenase; electron t	98.42
1qm9_A		198	Polypyrimidine tract-binding protein; ribonucleopr	98.42
3hxj_A		330	Pyrrolo-quinoline quinone; all beta protein. incom	98.39
4a2l_A		795	BT_4663, two-component system sensor histidine kin	98.39
2adc_A		229	Polypyrimidine tract-binding protein 1; RBD, RRM,	98.38
2d9o_A		100	DNAJ (HSP40) homolog, subfamily C, member 17; RRM	98.34
2xe4_A		751	Oligopeptidase B; hydrolase-inhibitor complex, hyd	98.32
2p4o_A		306	Hypothetical protein; putative lactonase, structur	98.3
3mbr_X		243	Glutamine cyclotransferase; beta-propeller; 1.44A	98.28
3nok_A		268	Glutaminyl cyclase; beta-propeller, cyclotransfera	98.28
2hz6_A		369	Endoplasmic reticulum to nucleus signalling 1 isof	98.17
2p4o_A		306	Hypothetical protein; putative lactonase, structur	98.15
1owx_A		121	Lupus LA protein, SS-B, LA; RRM, transcription; NM	98.08
3q7m_A		376	Lipoprotein YFGL, BAMB; beta-propeller, BAM comple	98.07
1kv9_A		668	Type II quinohemoprotein alcohol dehydrogenase; el	98.07
3v9f_A		781	Two-component system sensor histidine kinase/RESP	98.05
2hz6_A		369	Endoplasmic reticulum to nucleus signalling 1 isof	98.03
3v9f_A		781	Two-component system sensor histidine kinase/RESP	98.02
3qqz_A		255	Putative uncharacterized protein YJIK; MCSG, PSI-2	97.99
3v65_B		386	Low-density lipoprotein receptor-related protein;	97.96
3v65_B		386	Low-density lipoprotein receptor-related protein;	97.95
2ad6_A		571	Methanol dehydrogenase subunit 1; PQQ configuratio	97.93
1k3i_A		656	Galactose oxidase precursor; blade beta propeller,	97.92
3v64_C		349	Agrin; beta propeller, laminin-G, signaling, prote	97.9
3qqz_A		255	Putative uncharacterized protein YJIK; MCSG, PSI-2	97.89
3s94_A		619	LRP-6, low-density lipoprotein receptor-related pr	97.89
3dxb_A		222	Thioredoxin N-terminally fused to PUF60(UHM); spli	97.89
3tc9_A		430	Hypothetical hydrolase; 6-bladed beta-propeller, i	97.87
1w6s_A		599	Methanol dehydrogenase subunit 1; anisotropic, ele	97.84
3v64_C		349	Agrin; beta propeller, laminin-G, signaling, prote	97.83
2fp8_A		322	Strictosidine synthase; six bladed beta propeller	97.83
1k3i_A		656	Galactose oxidase precursor; blade beta propeller,	97.81
1kv9_A		668	Type II quinohemoprotein alcohol dehydrogenase; el	97.79
1ijq_A		316	LDL receptor, low-density lipoprotein receptor; be	97.74
4hw6_A		433	Hypothetical protein, IPT/TIG domain protein; puta	97.72
2dnr_A		91	Synaptojanin-1; RRM domain, RBD, structural genomi	97.7
2fp8_A		322	Strictosidine synthase; six bladed beta propeller	97.66
3s25_A		302	Hypothetical 7-bladed beta-propeller-like protein;	97.62
4a0p_A		628	LRP6, LRP-6, low-density lipoprotein receptor-rela	97.62
1ijq_A		316	LDL receptor, low-density lipoprotein receptor; be	97.62
3s25_A		302	Hypothetical 7-bladed beta-propeller-like protein;	97.57
4hw6_A		433	Hypothetical protein, IPT/TIG domain protein; puta	97.54
1ufw_A		95	Synaptojanin 2; RNP domain, structural genomics, r	97.54
1flg_A		582	Protein (quinoprotein ethanol dehydrogenase); supe	97.52
3p5b_L		400	Low density lipoprotein receptor variant; B-propel	97.5
3tc9_A		430	Hypothetical hydrolase; 6-bladed beta-propeller, i	97.47
3s94_A		619	LRP-6, low-density lipoprotein receptor-related pr	97.31
2ad6_A		571	Methanol dehydrogenase subunit 1; PQQ configuratio	97.3
2xzh_A		365	Clathrin heavy chain 1; endocytosis, endocytosis i	97.27
2ism_A		352	Putative oxidoreductase; BL41XU spring-8, bladed b	97.25
3m0c_C		791	LDL receptor, low-density lipoprotein receptor; pr	97.2
1w6s_A		599	Methanol dehydrogenase subunit 1; anisotropic, ele	97.18
3a9g_A		354	Putative uncharacterized protein; PQQ dependent de	97.18
3p5b_L		400	Low density lipoprotein receptor variant; B-propel	97.16
3sov_A		318	LRP-6, low-density lipoprotein receptor-related pr	97.16
3amr_A		355	3-phytase; beta-propeller, phytate, MYO-inositol h	97.15

>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A	Back alignment and structure

Probab=100.00  E-value=1.2e-41  Score=381.42  Aligned_cols=402  Identities=13%  Similarity=0.173  Sum_probs=304.8

Q ss_pred             ccccccccCCCCCceEEEEeCCceEEEecCCCCCCCcccccCCCcccceEEECCCCcEEEEEeCCc-eEEeecCcCcc--
Q 005315          160 ENLQKWLTDEKARDQFVIRSGTDTEVLWNDARHLKPEPVYKRSYWTESFVQWSPLGTYLATVHRQG-AAVWGGANTFN--  236 (702)
Q Consensus       160 ~~~~~~~~~~~~~~~~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~v~~v~~Spdg~~lat~~~~~-i~iw~~~~~~~--  236 (702)
                      .......++|+|+. ++... ++.+.+|+. ..+.....+.+|...|++++|||+|++||+++.++ |+|||.. +..  
T Consensus        19 g~~~~~~~spdg~~-l~~~~-~~~v~l~~~-~~~~~~~~~~~h~~~v~~~~~spdg~~lasg~~d~~v~lWd~~-~~~~~   94 (611)
T 1nr0_A           19 GTAVVLGNTPAGDK-IQYCN-GTSVYTVPV-GSLTDTEIYTEHSHQTTVAKTSPSGYYCASGDVHGNVRIWDTT-QTTHI   94 (611)
T ss_dssp             TCCCCCEECTTSSE-EEEEE-TTEEEEEET-TCSSCCEEECCCSSCEEEEEECTTSSEEEEEETTSEEEEEESS-STTCC
T ss_pred             CceeEEeeCCCCCE-EEeCC-CCEEEEecC-CCcccCeEecCCCCceEEEEECCCCcEEEEEeCCCCEEEeECC-CCcce
Confidence            34445556788873 33333 557789998 45677788899999999999999999999999999 8899986 332  


Q ss_pred             eeeee--cCCCeeEEEecCCCCEEEEEcCCCCCCCcCCCccEEEEEEccCCcEEeeccCCCcccccCCCCCCCCcccceE
Q 005315          237 RLMRY--AHPQVKLIDFSPGEKYLVTYSSHEPSNPRDANRVVINIFDVRTGKVMRDFKGSADEFAVGGTGGVAGVSWPVF  314 (702)
Q Consensus       237 ~~~~~--~~~~v~~i~fSpdg~~l~t~s~d~~~~~~~~~~~~i~vwd~~~g~~~~~~~~~~~~~~~~~~~~~~~~~w~~~  314 (702)
                      ....+  +...|.+++|||+|++|++++.+..      ..+.|++||  ++..+..+.+|...+.             ++
T Consensus        95 ~~~~~~~~~~~v~~v~fs~dg~~l~~~~~~~~------~~~~v~~wd--~~~~~~~l~gh~~~v~-------------~v  153 (611)
T 1nr0_A           95 LKTTIPVFSGPVKDISWDSESKRIAAVGEGRE------RFGHVFLFD--TGTSNGNLTGQARAMN-------------SV  153 (611)
T ss_dssp             EEEEEECSSSCEEEEEECTTSCEEEEEECCSS------CSEEEEETT--TCCBCBCCCCCSSCEE-------------EE
T ss_pred             eeEeecccCCceEEEEECCCCCEEEEEECCCC------ceeEEEEee--CCCCcceecCCCCCce-------------EE
Confidence            22333  3345999999999999999886511      115788887  6777888888887764             79


Q ss_pred             EEcCCCCc-EEEEec-CCeEEEEecCCcccccceeeccCCeeEEEeCCCCCeEEEEeecCCCCCCCcEEEEEecCCccee
Q 005315          315 RWGGGKDK-YFAKLG-KNMISVYETESFTLIDKKSLKVENVMDFSWSPTDPIISLFVPELGGGNQPARVSLVQIPSKEEL  392 (702)
Q Consensus       315 ~~s~~dg~-~la~~~-d~~i~v~d~~~~~~~~~~~~~~~~v~~~~~sp~~~~la~~~~~~~~~~~~~~i~~~~~~~~~~~  392 (702)
                      +|+| ++. .|++++ |++|++|+..+++.+.....|...|.+++|+|+|++|++     ++.|+.+++|  +..+.+.+
T Consensus       154 ~f~p-~~~~~l~s~s~D~~v~lwd~~~~~~~~~l~~H~~~V~~v~fspdg~~las-----~s~D~~i~lw--d~~~g~~~  225 (611)
T 1nr0_A          154 DFKP-SRPFRIISGSDDNTVAIFEGPPFKFKSTFGEHTKFVHSVRYNPDGSLFAS-----TGGDGTIVLY--NGVDGTKT  225 (611)
T ss_dssp             EECS-SSSCEEEEEETTSCEEEEETTTBEEEEEECCCSSCEEEEEECTTSSEEEE-----EETTSCEEEE--ETTTCCEE
T ss_pred             EECC-CCCeEEEEEeCCCeEEEEECCCCeEeeeeccccCceEEEEECCCCCEEEE-----EECCCcEEEE--ECCCCcEe
Confidence            9999 987 588888 999999999988777666678888999999999999999     7788876665  44444433


Q ss_pred             eeee-------ecccccceeEEccCCCEEEEEEcccccccccccccEEEEEEecCCc-----------------------
Q 005315          393 RQKN-------LFSVSDCKMYWQSSGDYLAVKVDRYTKTKKSTYTGFELFRIKERDI-----------------------  442 (702)
Q Consensus       393 ~~~~-------~~~~~~~~~~~s~~g~~l~~~~~~~~~~~~~~~~~~~l~~l~~~~~-----------------------  442 (702)
                      ....       .+......+.|+|+|++|++++.+++         +++|++.....                       
T Consensus       226 ~~~~~~~~~~~~h~~~V~~v~~spdg~~l~s~s~D~~---------v~lWd~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  296 (611)
T 1nr0_A          226 GVFEDDSLKNVAHSGSVFGLTWSPDGTKIASASADKT---------IKIWNVATLKVEKTIPVGTRIEDQQLGIIWTKQA  296 (611)
T ss_dssp             EECBCTTSSSCSSSSCEEEEEECTTSSEEEEEETTSE---------EEEEETTTTEEEEEEECCSSGGGCEEEEEECSSC
T ss_pred             eeeccccccccccCCCEEEEEECCCCCEEEEEeCCCe---------EEEEeCCCCceeeeecCCCCccceeEEEEEcCCE
Confidence            3221       24455667899999999999999887         45554432110                       


Q ss_pred             -----------------ceeEEEecCCCCceeEEEEeeCCcEEEEEEcCCCCCeEEEEEeecccCc--------CceEE-
Q 005315          443 -----------------PIEVLELDNKNDKIIAFAWEPKGHRFAVIHGDSPRPDISFYSMRTAQHA--------GRVSK-  496 (702)
Q Consensus       443 -----------------~~~~~~l~~h~~~v~~~~~sp~g~~l~~~~~d~~~~~v~i~d~~~~~~~--------~~~~~-  496 (702)
                                       ......+.+|...|.+++|+|+|++|++++.|+   .|++||+.++...        ..+.. 
T Consensus       297 l~s~s~d~~i~~~~~~~~~~~~~~~gh~~~v~~l~~spdg~~l~s~s~D~---~v~~Wd~~~~~~~~~~~~~h~~~v~~~  373 (611)
T 1nr0_A          297 LVSISANGFINFVNPELGSIDQVRYGHNKAITALSSSADGKTLFSADAEG---HINSWDISTGISNRVFPDVHATMITGI  373 (611)
T ss_dssp             EEEEETTCCEEEEETTTTEEEEEECCCSSCEEEEEECTTSSEEEEEETTS---CEEEEETTTCCEEECSSCSCSSCEEEE
T ss_pred             EEEEeCCCcEEEEeCCCCCcceEEcCCCCCEEEEEEeCCCCEEEEEeCCC---cEEEEECCCCceeeecccCCcceEEEE
Confidence                             001234568999999999999999999999999   9999998643210        00000 


Q ss_pred             --------------------------------------------------------------------EEEc-CCCceeE
Q 005315          497 --------------------------------------------------------------------LTTL-KGKQANA  507 (702)
Q Consensus       497 --------------------------------------------------------------------~~~~-~~~~v~~  507 (702)
                                                                                          +..+ ....+.+
T Consensus       374 ~~s~~~~l~s~s~d~~v~~w~~~~~~~~~~~~~~~~~~~~~~~~~~s~dg~~~~~~~~~~v~~~~~~~~~~~~~~~~v~~  453 (611)
T 1nr0_A          374 KTTSKGDLFTVSWDDHLKVVPAGGSGVDSSKAVANKLSSQPLGLAVSADGDIAVAACYKHIAIYSHGKLTEVPISYNSSC  453 (611)
T ss_dssp             EECTTSCEEEEETTTEEEEECSSSSSSCTTSCCEEECSSCEEEEEECTTSSCEEEEESSEEEEEETTEEEEEECSSCEEE
T ss_pred             EECCCCcEEEEEcCCceEEeecCCccccccceeeeecCCCCcEEEEeCCCcEEEEEeCceEEEEeCCceeeeecCCCceE
Confidence                                                                                0000 0124678


Q ss_pred             EEEccCCCEEEEEeccCCCceEEEEECCCcce--ee-ecccCceeeeEECCCCCEEEEEEeecccccccEEEEEecc--c
Q 005315          508 LFWSPSGRFIVLAGLKGFNGQLEFYNVDELET--MA-TAEHFMATDVEWDPTGRYVATAVTSVHEMENGFNIWSFNG--K  582 (702)
Q Consensus       508 ~~~spdg~~l~~~~~~~~dg~v~i~d~~~~~~--~~-~~~~~~i~~~~~spdg~~l~t~s~~~~~~d~~v~iw~~~g--~  582 (702)
                      ++|||+|++|++++.   |+.|++||+.+...  +. ..|...|++++|||||++|++++.     |+.+++|++..  .
T Consensus       454 va~spdg~~lasgs~---D~~v~lwd~~~~~~~~~~~~~h~~~v~~v~fspdg~~las~s~-----d~~v~~w~~~~~~~  525 (611)
T 1nr0_A          454 VALSNDKQFVAVGGQ---DSKVHVYKLSGASVSEVKTIVHPAEITSVAFSNNGAFLVATDQ-----SRKVIPYSVANNFE  525 (611)
T ss_dssp             EEECTTSCEEEEEET---TSEEEEEEEETTEEEEEEEEECSSCEEEEEECTTSSEEEEEET-----TSCEEEEEGGGTTE
T ss_pred             EEEeCCCCEEEEeCC---CCeEEEEEccCCceeeeeccCCCCceEEEEECCCCCEEEEEcC-----CCCEEEEEcCCCCc
Confidence            999999999999998   99999999986543  12 356788999999999999999999     99999999874  3


Q ss_pred             eeee----eccccEeeEEEeeCCCCCCChhhHHHHH
Q 005315          583 LLYR----TLKDHFFQFLWRPRPPSFLTPEKEEEIA  614 (702)
Q Consensus       583 ~l~~----~~~~~i~~~~w~p~~~~l~s~~~d~~i~  614 (702)
                      .+..    .|...|++++|+|++++|++++.|+.|+
T Consensus       526 ~~~~~~~~~H~~~V~~v~fspdg~~lasgs~D~~v~  561 (611)
T 1nr0_A          526 LAHTNSWTFHTAKVACVSWSPDNVRLATGSLDNSVI  561 (611)
T ss_dssp             ESCCCCCCCCSSCEEEEEECTTSSEEEEEETTSCEE
T ss_pred             eeeeeeeeecccceeEEEECCCCCEEEEEECCCcEE
Confidence            3322    2778999999999999999999998876

PyMOL of 1nr0

>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A	Back alignment and structure

>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme}	Back alignment and structure

>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme}	Back alignment and structure

>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1	Back alignment and structure

>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens}	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A*	Back alignment and structure

>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B*	Back alignment and structure

>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae}	Back alignment and structure

>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A*	Back alignment and structure

>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum}	Back alignment and structure

>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus}	Back alignment and structure

>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens}	Back alignment and structure

>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis}	Back alignment and structure

>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A	Back alignment and structure

>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A	Back alignment and structure

>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae}	Back alignment and structure

>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R*	Back alignment and structure

>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R	Back alignment and structure

>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1	Back alignment and structure

>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A	Back alignment and structure

>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens}	Back alignment and structure

>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ...	Back alignment and structure

>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A	Back alignment and structure

>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A	Back alignment and structure

>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae}	Back alignment and structure

>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1	Back alignment and structure

>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A	Back alignment and structure

>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae}	Back alignment and structure

>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A	Back alignment and structure

>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A	Back alignment and structure

>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B*	Back alignment and structure

>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae}	Back alignment and structure

>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens}	Back alignment and structure

>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis}	Back alignment and structure

>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a	Back alignment and structure

>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus}	Back alignment and structure

>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli}	Back alignment and structure

>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C	Back alignment and structure

>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X	Back alignment and structure

>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens}	Back alignment and structure

>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum}	Back alignment and structure

>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens}	Back alignment and structure

>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R*	Back alignment and structure

>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B*	Back alignment and structure

>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A	Back alignment and structure

>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A	Back alignment and structure

>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae}	Back alignment and structure

>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B*	Back alignment and structure

>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R	Back alignment and structure

>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae}	Back alignment and structure

>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1	Back alignment and structure

>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A	Back alignment and structure

>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe}	Back alignment and structure

>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens}	Back alignment and structure

>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ...	Back alignment and structure

>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens}	Back alignment and structure

>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A	Back alignment and structure

>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae}	Back alignment and structure

>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B*	Back alignment and structure

>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae}	Back alignment and structure

>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae}	Back alignment and structure

>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B*	Back alignment and structure

>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae}	Back alignment and structure

>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe}	Back alignment and structure

>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens}	Back alignment and structure

>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C	Back alignment and structure

>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens}	Back alignment and structure

>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A	Back alignment and structure

>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae}	Back alignment and structure

>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A	Back alignment and structure

>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli}	Back alignment and structure

>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A	Back alignment and structure

>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A	Back alignment and structure

>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A	Back alignment and structure

>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A	Back alignment and structure

>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens}	Back alignment and structure

>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a	Back alignment and structure

>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A	Back alignment and structure

>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe}	Back alignment and structure

>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe}	Back alignment and structure

>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X	Back alignment and structure

>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae}	Back alignment and structure

>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B*	Back alignment and structure

>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens}	Back alignment and structure

>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A	Back alignment and structure

>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A	Back alignment and structure

>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens}	Back alignment and structure

>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B*	Back alignment and structure

>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A	Back alignment and structure

>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae}	Back alignment and structure

>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B*	Back alignment and structure

>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae}	Back alignment and structure

>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B*	Back alignment and structure

>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A*	Back alignment and structure

>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans}	Back alignment and structure

>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A	Back alignment and structure

>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B	Back alignment and structure

>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3	Back alignment and structure

>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens}	Back alignment and structure

>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1	Back alignment and structure

>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae}	Back alignment and structure

>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens}	Back alignment and structure

>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens}	Back alignment and structure

>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A	Back alignment and structure

>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A	Back alignment and structure

>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A	Back alignment and structure

>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae}	Back alignment and structure

>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3	Back alignment and structure

>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A	Back alignment and structure

>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia}	Back alignment and structure

>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae}	Back alignment and structure

>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A*	Back alignment and structure

>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A	Back alignment and structure

>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans}	Back alignment and structure

>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia}	Back alignment and structure

>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24	Back alignment and structure

>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A*	Back alignment and structure

>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B	Back alignment and structure

>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A*	Back alignment and structure

>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A*	Back alignment and structure

>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A	Back alignment and structure

>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A	Back alignment and structure

>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A	Back alignment and structure

>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1	Back alignment and structure

>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A*	Back alignment and structure

>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans}	Back alignment and structure

>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24	Back alignment and structure

>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A	Back alignment and structure

>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A	Back alignment and structure

>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp}	Back alignment and structure

>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str}	Back alignment and structure

>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens}	Back alignment and structure

>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A*	Back alignment and structure

>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B*	Back alignment and structure

>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens}	Back alignment and structure

>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ...	Back alignment and structure

>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans}	Back alignment and structure

>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1	Back alignment and structure

>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1	Back alignment and structure

>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str}	Back alignment and structure

>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633}	Back alignment and structure

>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A*	Back alignment and structure

>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B*	Back alignment and structure

>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ...	Back alignment and structure

>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A	Back alignment and structure

>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B*	Back alignment and structure

>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum}	Back alignment and structure

>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A	Back alignment and structure

>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp}	Back alignment and structure

>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A	Back alignment and structure

>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum}	Back alignment and structure

>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1	Back alignment and structure

>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633}	Back alignment and structure

>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A	Back alignment and structure

>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B*	Back alignment and structure

>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1	Back alignment and structure

>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ...	Back alignment and structure

>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A*	Back alignment and structure

>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A	Back alignment and structure

>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ...	Back alignment and structure

>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A*	Back alignment and structure

>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A	Back alignment and structure

>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A	Back alignment and structure

>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus}	Back alignment and structure

>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus}	Back alignment and structure

>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A	Back alignment and structure

>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens}	Back alignment and structure

>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A*	Back alignment and structure

>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens}	Back alignment and structure

>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A*	Back alignment and structure

>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A	Back alignment and structure

>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus}	Back alignment and structure

>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A	Back alignment and structure

>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H*	Back alignment and structure

>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ...	Back alignment and structure

>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A*	Back alignment and structure

>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus}	Back alignment and structure

>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens}	Back alignment and structure

>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis}	Back alignment and structure

>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens}	Back alignment and structure

>2lxi_A RNA-binding protein 10; NMR {Homo sapiens}	Back alignment and structure

>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus}	Back alignment and structure

>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum}	Back alignment and structure

>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens}	Back alignment and structure

>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1	Back alignment and structure

>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ...	Back alignment and structure

>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans}	Back alignment and structure

>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1	Back alignment and structure

>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H*	Back alignment and structure

>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C	Back alignment and structure

>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A	Back alignment and structure

>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum}	Back alignment and structure

>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster}	Back alignment and structure

>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A*	Back alignment and structure

>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens}	Back alignment and structure

>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens}	Back alignment and structure

>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0	Back alignment and structure

>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus}	Back alignment and structure

>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae}	Back alignment and structure

>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis}	Back alignment and structure

>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A*	Back alignment and structure

>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B	Back alignment and structure

>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A	Back alignment and structure

>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans}	Back alignment and structure

>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens}	Back alignment and structure

>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A	Back alignment and structure

>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens}	Back alignment and structure

>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae}	Back alignment and structure

>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens}	Back alignment and structure

>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A	Back alignment and structure

>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D*	Back alignment and structure

>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A	Back alignment and structure

>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A	Back alignment and structure

>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A	Back alignment and structure

>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens}	Back alignment and structure

>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A	Back alignment and structure

>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A	Back alignment and structure

>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A	Back alignment and structure

>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A	Back alignment and structure

>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A*	Back alignment and structure

>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens}	Back alignment and structure

>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A	Back alignment and structure

>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A	Back alignment and structure

>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A	Back alignment and structure

>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens}	Back alignment and structure

>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A	Back alignment and structure

>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster}	Back alignment and structure

>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}	Back alignment and structure

>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori}	Back alignment and structure

>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1	Back alignment and structure

>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus}	Back alignment and structure

>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D*	Back alignment and structure

>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X	Back alignment and structure

>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C*	Back alignment and structure

>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A*	Back alignment and structure

>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ...	Back alignment and structure

>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A	Back alignment and structure

>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens}	Back alignment and structure

>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A	Back alignment and structure

>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens}	Back alignment and structure

>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens}	Back alignment and structure

>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus}	Back alignment and structure

>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A	Back alignment and structure

>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A	Back alignment and structure

>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens}	Back alignment and structure

>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A	Back alignment and structure

>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A*	Back alignment and structure

>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C	Back alignment and structure

>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis}	Back alignment and structure

>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP}	Back alignment and structure

>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A*	Back alignment and structure

>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A	Back alignment and structure

>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1	Back alignment and structure

>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens}	Back alignment and structure

>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1	Back alignment and structure

>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii}	Back alignment and structure

>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A	Back alignment and structure

>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A	Back alignment and structure

>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A	Back alignment and structure

>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1	Back alignment and structure

>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1	Back alignment and structure

>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae}	Back alignment and structure

>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ...	Back alignment and structure

>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus}	Back alignment and structure

>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B	Back alignment and structure

>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B	Back alignment and structure

>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens}	Back alignment and structure

>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B	Back alignment and structure

>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii}	Back alignment and structure

>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A*	Back alignment and structure

>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii}	Back alignment and structure

>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens}	Back alignment and structure

>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A	Back alignment and structure

>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ...	Back alignment and structure

>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A	Back alignment and structure

>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A	Back alignment and structure

>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV}	Back alignment and structure

>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482}	Back alignment and structure

>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(PGPUPUPGPUPUPUPUPUPUPUPU)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A	Back alignment and structure

>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A*	Back alignment and structure

>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A	Back alignment and structure

>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii}	Back alignment and structure

>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A	Back alignment and structure

>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens}	Back alignment and structure

>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A	Back alignment and structure

>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae}	Back alignment and structure

>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV}	Back alignment and structure

>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A	Back alignment and structure

>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A	Back alignment and structure

>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A	Back alignment and structure

>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1	Back alignment and structure

>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A	Back alignment and structure

>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A	Back alignment and structure

>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A	Back alignment and structure

>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A	Back alignment and structure

>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(PGPUPUPGPUPUPUPUPUPUPUPU)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A	Back alignment and structure

>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A	Back alignment and structure

>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A	Back alignment and structure

>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C*	Back alignment and structure

>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A	Back alignment and structure

>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A	Back alignment and structure

>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus}	Back alignment and structure

>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A	Back alignment and structure

>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A	Back alignment and structure

>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C	Back alignment and structure

>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482}	Back alignment and structure

>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A*	Back alignment and structure

>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A	Back alignment and structure

>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae}	Back alignment and structure

>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A	Back alignment and structure

>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3	Back alignment and structure

>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A	Back alignment and structure

>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413}	Back alignment and structure

>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C	Back alignment and structure

>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413}	Back alignment and structure

>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A	Back alignment and structure

>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A	Back alignment and structure

>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A	Back alignment and structure

>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1	Back alignment and structure

>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A	Back alignment and structure

>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A	Back alignment and structure

>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A*	Back alignment and structure

>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E	Back alignment and structure

>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E	Back alignment and structure

>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A	Back alignment and structure

>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A	Back alignment and structure

>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1	Back alignment and structure

>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A	Back alignment and structure

>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B	Back alignment and structure

>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A	Back alignment and structure

>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A*	Back alignment and structure

>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida}	Back alignment and structure

>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A	Back alignment and structure

>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A	Back alignment and structure

>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A*	Back alignment and structure

>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1	Back alignment and structure

>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A	Back alignment and structure

>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A	Back alignment and structure

>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A	Back alignment and structure

>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major}	Back alignment and structure

>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A	Back alignment and structure

>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1	Back alignment and structure

>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1	Back alignment and structure

>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A	Back alignment and structure

>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris}	Back alignment and structure

>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A	Back alignment and structure

>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1	Back alignment and structure

>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis}	Back alignment and structure

>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B	Back alignment and structure

>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A*	Back alignment and structure

>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A	Back alignment and structure

>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus}	Back alignment and structure

>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A	Back alignment and structure

>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida}	Back alignment and structure

>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1	Back alignment and structure

>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis}	Back alignment and structure

>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A*	Back alignment and structure

>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A	Back alignment and structure

>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major}	Back alignment and structure

>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3	Back alignment and structure

>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris}	Back alignment and structure

>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus}	Back alignment and structure

>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens}	Back alignment and structure

>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3	Back alignment and structure

>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A	Back alignment and structure

>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1	Back alignment and structure

>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens}	Back alignment and structure

>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli}	Back alignment and structure

>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus}	Back alignment and structure

>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus}	Back alignment and structure

>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A*	Back alignment and structure

>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A	Back alignment and structure

>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus}	Back alignment and structure

>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli}	Back alignment and structure

>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A*	Back alignment and structure

>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157}	Back alignment and structure

>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron}	Back alignment and structure

>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A*	Back alignment and structure

>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus}	Back alignment and structure

>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A*	Back alignment and structure

>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A	Back alignment and structure

>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1	Back alignment and structure

>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1	Back alignment and structure

>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus}	Back alignment and structure

>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A*	Back alignment and structure

>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale}	Back alignment and structure

>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A*	Back alignment and structure

>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1	Back alignment and structure

>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale}	Back alignment and structure

>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus}	Back alignment and structure

>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1	Back alignment and structure

>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L	Back alignment and structure

>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A*	Back alignment and structure

>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A*	Back alignment and structure

>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus}	Back alignment and structure

>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens}	Back alignment and structure

>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A*	Back alignment and structure

>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A*	Back alignment and structure

>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L	Back alignment and structure

>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B	Back alignment and structure

>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		702
d1vyhc1		317	b.69.4.1 (C:92-408) Platelet-activating factor ace	8e-06
d1mdah_		368	b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {	3e-05
d2u2fa_		85	d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit	3e-04
d1cvja1		80	d.58.7.1 (A:11-90) Poly(A)-binding protein {Human	3e-04
d1tbga_		340	b.69.4.1 (A:) beta1-subunit of the signal-transduc	3e-04
d1tbga_		340	b.69.4.1 (A:) beta1-subunit of the signal-transduc	7e-04
d2cpfa1		85	d.58.7.1 (A:362-446) Probable RNA-binding protein	4e-04
d2cpha1		94	d.58.7.1 (A:454-547) Probable RNA-binding protein	5e-04
d2bbkh_		355	b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {	0.001
d2disa1		96	d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {	0.001
d1b7fa2		85	d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil	0.001
d1fxla2		85	d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho	0.001
d2cqca1		83	d.58.7.1 (A:109-191) Arginine/serine-rich splicing	0.001
d2f9da1		114	d.58.7.1 (A:12-125) Pre-mRNA branch site protein p	0.002
d1sa0e_		138	a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus	0.002
d1hd0a_		75	d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot	0.003
d1h2vz_		93	d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro	0.003
d1erja_		388	b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea	0.003
d1nu4a_		91	d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo	0.003
d1k8kc_		371	b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1	0.004

>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317	Back information, alignment and structure


class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Platelet-activating factor acetylhydrolase IB subunit alpha
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 45.9 bits (107), Expect = 8e-06
 Identities = 50/330 (15%), Positives = 87/330 (26%), Gaps = 54/330 (16%)

Query: 246 VKLIDFSPGEKYLVTYSSHEPSNPRDANRVVINIFDVRTGKVMRDFKGSADEFAVGGTGG 305
           V  + F P    +V+ S        DA    I ++D  TG   R  KG         T  
Sbjct: 20  VTRVIFHPVFSVMVSAS-------EDAT---IKVWDYETGDFERTLKGH--------TDS 61

Query: 306 VAGVSWPVFRWGGGKDKYFAKLGKNMISVYETESFTLIDKKSLKVENVMDFSWSPTDPII 365
           V  +S+                    I +++ + F  I        NV   S  P    I
Sbjct: 62  VQDISFDHSGKLLASCSAD-----MTIKLWDFQGFECIRTMHGHDHNVSSVSIMPNGDHI 116

Query: 366 SLFVPELGGGNQPARVSLVQIPSKEELRQKNLFSVSDCKMYWQSSGDYLAV--------K 417
                     ++   + + ++ +   ++           +     G  +A          
Sbjct: 117 VSA-------SRDKTIKMWEVQTGYCVKTFTGHREWVRMVRPNQDGTLIASCSNDQTVRV 169

Query: 418 VDRYTKTKKSTYTGFELFRIKERDIPIEVLELDNKNDKIIAFAWEPKGHRFAVIHGDSPR 477
               TK  K+               P       ++            G        D   
Sbjct: 170 WVVATKECKAELREHRHVVECISWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDK-- 227

Query: 478 PDISFYSMRTAQHAGRVSKLTTLKGKQA--NALFWSPSGRFIVLAGLKGFNGQLEFYNVD 535
             I  + + T         L TL G       + +   G+FI+       +  L  ++  
Sbjct: 228 -TIKMWDVSTGMC------LMTLVGHDNWVRGVLFHSGGKFILSCA---DDKTLRVWDYK 277

Query: 536 ELETMATAEHFMA--TDVEWDPTGRYVATA 563
               M T        T +++  T  YV T 
Sbjct: 278 NKRCMKTLNAHEHFVTSLDFHKTAPYVVTG 307

PyMOL of d1vyhc1

>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368	Back information, alignment and structure

>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85	Back information, alignment and structure

>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80	Back information, alignment and structure

>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340	Back information, alignment and structure

>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340	Back information, alignment and structure

>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85	Back information, alignment and structure

>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94	Back information, alignment and structure

>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355	Back information, alignment and structure

>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96	Back information, alignment and structure

>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85	Back information, alignment and structure

>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85	Back information, alignment and structure

>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83	Back information, alignment and structure

>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114	Back information, alignment and structure

>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75	Back information, alignment and structure

>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93	Back information, alignment and structure

>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388	Back information, alignment and structure

>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91	Back information, alignment and structure

>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		702
d1gxra_		337	Groucho/tle1, C-terminal domain {Human (Homo sapie	100.0
d1erja_		388	Tup1, C-terminal domain {Baker's yeast (Saccharomy	100.0
d1vyhc1		317	Platelet-activating factor acetylhydrolase IB subu	100.0
d1nr0a1		311	Actin interacting protein 1 {Nematode (Caenorhabdi	100.0
d1gxra_		337	Groucho/tle1, C-terminal domain {Human (Homo sapie	99.98
d1nr0a1		311	Actin interacting protein 1 {Nematode (Caenorhabdi	99.97
d1tbga_		340	beta1-subunit of the signal-transducing G protein	99.97
d1k8kc_		371	Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur	99.97
d1nr0a2		299	Actin interacting protein 1 {Nematode (Caenorhabdi	99.97
d1nr0a2		299	Actin interacting protein 1 {Nematode (Caenorhabdi	99.97
d1vyhc1		317	Platelet-activating factor acetylhydrolase IB subu	99.96
d1nexb2		355	Cdc4 propeller domain {Baker's yeast (Saccharomyce	99.96
d1k8kc_		371	Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur	99.96
d2ovrb2		342	F-box/WD repeat-containing protein 7, FBXW7 {Human	99.95
d1erja_		388	Tup1, C-terminal domain {Baker's yeast (Saccharomy	99.95
d1k32a3		360	Tricorn protease domain 2 {Archaeon Thermoplasma a	99.95
d1tbga_		340	beta1-subunit of the signal-transducing G protein	99.95
d1pgua1		325	Actin interacting protein 1 {Baker's yeast (Saccha	99.95
d1nexb2		355	Cdc4 propeller domain {Baker's yeast (Saccharomyce	99.93
d1yfqa_		342	Cell cycle arrest protein BUB3 {Baker's yeast (Sac	99.93
d2ovrb2		342	F-box/WD repeat-containing protein 7, FBXW7 {Human	99.93
d1k32a3		360	Tricorn protease domain 2 {Archaeon Thermoplasma a	99.92
d1pgua2		287	Actin interacting protein 1 {Baker's yeast (Saccha	99.92
d1pgua1		325	Actin interacting protein 1 {Baker's yeast (Saccha	99.92
d1hzua2		426	C-terminal (heme d1) domain of cytochrome cd1-nitr	99.91
d1qksa2		432	C-terminal (heme d1) domain of cytochrome cd1-nitr	99.91
d1hzua2		426	C-terminal (heme d1) domain of cytochrome cd1-nitr	99.9
d1p22a2		293	F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom	99.9
d1sq9a_		393	Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac	99.89
d1sq9a_		393	Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac	99.89
d1yfqa_		342	Cell cycle arrest protein BUB3 {Baker's yeast (Sac	99.89
d1l0qa2		301	Surface layer protein {Archaeon Methanosarcina maz	99.88
d1p22a2		293	F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom	99.87
d1qksa2		432	C-terminal (heme d1) domain of cytochrome cd1-nitr	99.87
d1pgua2		287	Actin interacting protein 1 {Baker's yeast (Saccha	99.86
d1l0qa2		301	Surface layer protein {Archaeon Methanosarcina maz	99.84
d1pbyb_		337	Quinohemoprotein amine dehydrogenase B chain {Para	99.84
d1jmxb_		346	Quinohemoprotein amine dehydrogenase B chain {Pseu	99.84
d2madh_		373	Methylamine dehydrogenase, H-chain {Gram negative	99.77
d1jmxb_		346	Quinohemoprotein amine dehydrogenase B chain {Pseu	99.77
d1pbyb_		337	Quinohemoprotein amine dehydrogenase B chain {Para	99.75
d1ri6a_		333	Putative isomerase YbhE {Escherichia coli [TaxId:	99.74
d1ri6a_		333	Putative isomerase YbhE {Escherichia coli [TaxId:	99.72
d2bbkh_		355	Methylamine dehydrogenase, H-chain {Paracoccus den	99.71
d2madh_		373	Methylamine dehydrogenase, H-chain {Gram negative	99.69
d2bbkh_		355	Methylamine dehydrogenase, H-chain {Paracoccus den	99.69
d2bgra1		470	Dipeptidyl peptidase IV/CD26, N-terminal domain {P	99.67
d2bgra1		470	Dipeptidyl peptidase IV/CD26, N-terminal domain {P	99.67
d1b7fa1		82	Sex-lethal protein {Drosophila melanogaster [TaxId	99.54
d1cvja1		80	Poly(A)-binding protein {Human (Homo sapiens) [Tax	99.54
d1h2vz_		93	CBP20, 20KDa nuclear cap-binding protein {Human (H	99.53
d2cq0a1		90	Eukaryotic translation initiation factor 3 subunit	99.53
d2cqca1		83	Arginine/serine-rich splicing factor 10 {Human (Ho	99.53
d1fxla2		85	Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9	99.53
d1rk8a_		88	RNA-binding protein 8 {Fruit fly (Drosophila melan	99.53
d1b7fa2		85	Sex-lethal protein {Drosophila melanogaster [TaxId	99.51
d1mdah_		368	Methylamine dehydrogenase, H-chain {Paracoccus den	99.51
d2cqba1		89	Peptidyl-prolyl cis-trans isomerase E, N-terminal	99.51
d1uawa_		77	Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]}	99.51
d1x5ua1		93	Splicing factor 3B subunit 4 {Human (Homo sapiens)	99.5
d1fxla1		82	Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9	99.5
d1qnia2		441	Nitrous oxide reductase, N-terminal domain {Pseudo	99.49
d1xfda1		465	Dipeptidyl aminopeptidase-like protein 6, DPP6, N-	99.49
d2u2fa_		85	Splicing factor U2AF 65 KDa subunit {Human (Homo s	99.49
d1whwa_		99	Probable RNA-binding protein 19, Rbm19 {Mouse (Mus	99.48
d2hqsa1		269	TolB, C-terminal domain {Escherichia coli [TaxId:	99.48
d1no8a_		78	Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1	99.48
d2cpza1		102	CUG triplet repeat RNA-binding protein 1 {Human (H	99.47
d1l3ka1		84	Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human	99.47
d2ghpa1		81	U4/U6 snRNA-associated-splicing factor PRP24 {Bake	99.46
d2hqsa1		269	TolB, C-terminal domain {Escherichia coli [TaxId:	99.46
d2cq4a1		101	RNA binding protein 23 {Human (Homo sapiens) [TaxI	99.45
d2cpha1		94	Probable RNA-binding protein 19, Rbm19 {Mouse (Mus	99.45
d1hd0a_		75	Heterogeneous nuclear ribonucleoprotein d0 {Human	99.45
d2cqga1		90	TAR DNA-binding protein 43, TDP-43 {Human (Homo sa	99.45
d1x5ta1		83	Splicing factor 3B subunit 4 {Human (Homo sapiens)	99.45
d1p1ta_		104	Cleavage stimulation factor, 64 kda subunit {Human	99.43
d2cpfa1		85	Probable RNA-binding protein 19, Rbm19 {Mouse (Mus	99.42
d1x5sa1		90	Cold-inducible RNA-binding protein {Human (Homo sa	99.42
d2cpia1		89	E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc	99.4
d1mdah_		368	Methylamine dehydrogenase, H-chain {Paracoccus den	99.4
d1u6fa1		139	RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId	99.4
d1x4ea1		72	RNA-binding motif, single-stranded-interacting pro	99.4
d2cqda1		103	RNA-binding region containing protein 1 {Human (Ho	99.39
d1x0fa1		75	Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s	99.39
d2cpea1		101	RNA-binding protein EWS {Human (Homo sapiens) [Tax	99.39
d1l3ka2		79	Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human	99.39
d1x4ba1		103	Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu	99.38
d1xfda1		465	Dipeptidyl aminopeptidase-like protein 6, DPP6, N-	99.38
d1qnia2		441	Nitrous oxide reductase, N-terminal domain {Pseudo	99.37
d2msta_		75	Neural RNA-binding protein Musashi-1 {Mouse (Mus m	99.37
d1zh5a2		85	Lupus LA protein {Human (Homo sapiens) [TaxId: 960	99.35
d2cqia1		90	Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960	99.34
d2cqpa1		86	RNA-binding protein 12 {Mouse (Mus musculus) [TaxI	99.34
d1x5oa1		101	RNA-binding motif, single-stranded-interacting pro	99.32
d2cq3a1		93	RNA-binding protein 9 {Human (Homo sapiens) [TaxId	99.32
d2f9da1		114	Pre-mRNA branch site protein p14 {Human (Homo sapi	99.32
d1cvja2		89	Poly(A)-binding protein {Human (Homo sapiens) [Tax	99.32
d2ghpa3		86	U4/U6 snRNA-associated-splicing factor PRP24 {Bake	99.31
d2ghpa2		75	U4/U6 snRNA-associated-splicing factor PRP24 {Bake	99.3
d1x4ha1		98	RNA-binding protein 28 {Mouse (Mus musculus) [TaxI	99.3
d2cpxa1		102	RNA-binding protein 41, RBM41 {Human (Homo sapiens	99.29
d1weza_		102	Heterogeneous nuclear ribonucleoprotein H' {Human	99.26
d1fjeb1		91	Nucleolin {Golden hamster (Mesocricetus auratus) [	99.25
d1fjca_		96	Nucleolin {Golden hamster (Mesocricetus auratus) [	99.25
d1wg1a_		88	Probable RNA-binding protein KIAA1579 {Human (Homo	99.23
d2cpya1		103	RNA-binding protein 12 {Human (Homo sapiens) [TaxI	99.23
d1x4aa1		95	Splicing factor, arginine/serine-rich 1, SFRS1 {Hu	99.22
d2disa1		96	Hypothetical protein FLJ20273 {Human (Homo sapiens	99.21
d1x4ga1		96	Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960	99.2
d1wg5a_		104	Heterogeneous nuclear ribonucleoprotein H' {Human	99.2
d1jofa_		365	3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu	99.2
d2cpja1		86	Non-POU domain-containing octamer-binding protein,	99.19
d2cqha1		80	IGF-II mRNA-binding protein 2 isoform A {Human (Ho	99.19
d2b0ga1		83	Splicesomal U1A protein {Drosophila melanogaster [	99.19
d1wi8a_		104	Eukaryotic translation initiation factor 4B {Human	99.18
d1wi6a1		75	Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M	99.17
d2adca2		88	Polypyrimidine tract-binding protein {Human (Homo	99.16
d1whxa_		111	Probable RNA-binding protein 19, Rbm19 {Mouse (Mus	99.15
d1wela1		112	RNA-binding protein 12 {Human (Homo sapiens) [TaxI	99.14
d3begb1		87	Splicing factor, arginine/serine-rich 1, SFRS1 {Hu	99.14
d2adca1		109	Polypyrimidine tract-binding protein {Human (Homo	99.14
d2bz2a1		79	Negative elongation factor E, NELF-E {Human (Homo	99.13
d2cpda1		86	APOBEC1 stimulating protein {Human (Homo sapiens)	99.12
d1jofa_		365	3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu	99.11
d1u2fa_		90	Splicing factor U2AF 65 KDa subunit {Human (Homo s	99.1
d1wf2a_		98	Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu	99.09
d1nu4a_		91	Splicesomal U1A protein {Human (Homo sapiens) [Tax	99.07
d2adba1		108	Polypyrimidine tract-binding protein {Human (Homo	99.0
d1wf0a_		88	TAR DNA-binding protein 43, TDP-43 {Human (Homo sa	98.98
d1wg4a_		98	Splicing factor, arginine/serine-rich 9 (SFRS9) {M	98.98
d1k32a2		281	Tricorn protease N-terminal domain {Archaeon Therm	98.97
d1whya_		97	Putative RNA-binding protein 15B, Rbm15b {Mouse (M	98.96
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_		104	U2	98.95
d1x4fa1		99	Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}	98.91
d1u1qa_		183	Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human	98.89
d1k32a2		281	Tricorn protease N-terminal domain {Archaeon Therm	98.89
d1weya_		104	Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090	98.85
d2p4oa1		302	Hypothetical protein All0351 homologue {Nostoc pun	98.83
d2cq1a1		88	Polypyrimidine tract-binding protein 2, PTBP2 {Hum	98.81
d1wexa_		104	Heterogeneous nuclear ribonucleoprotein L-like {Mo	98.78
d2cq2a1		101	Alkylation repair AlkB homolog 8, ALKBH8 {Human (H	98.77
d2p4oa1		302	Hypothetical protein All0351 homologue {Nostoc pun	98.73
d1x4da1		89	Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}	98.72
d1q7fa_		279	Brain tumor cg10719-pa {Fruit fly (Drosophila mela	98.72
d1rwia_		260	Serine/threonine-protein kinase PknD {Mycobacteriu	98.7
d1pjxa_		314	Diisopropylfluorophosphatase (phosphotriesterase,	98.66
d1wwha1		81	Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090	98.66
d2dita1		99	HIV Tat-specific factor 1 {Human (Homo sapiens) [T	98.64
d1pjxa_		314	Diisopropylfluorophosphatase (phosphotriesterase,	98.63
d1owxa_		113	Lupus LA protein {Human (Homo sapiens) [TaxId: 960	98.6
d1u1qa_		183	Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human	98.57
d1rwia_		260	Serine/threonine-protein kinase PknD {Mycobacteriu	98.46
d1q7fa_		279	Brain tumor cg10719-pa {Fruit fly (Drosophila mela	98.46
d1o0pa_		104	Splicing factor U2AF 65 KDa subunit {Human (Homo s	98.44
d2dg1a1		319	Lactonase Drp35 {Staphylococcus aureus [TaxId: 128	98.43
d2dg1a1		319	Lactonase Drp35 {Staphylococcus aureus [TaxId: 128	98.27
d1fwxa2		459	Nitrous oxide reductase, N-terminal domain {Paraco	98.13
d1qfma1		430	Prolyl oligopeptidase, N-terminal domain {Pig (Sus	98.1
d2ghsa1		295	Regucalcin {Agrobacterium tumefaciens [TaxId: 358]	98.08
d2ghsa1		295	Regucalcin {Agrobacterium tumefaciens [TaxId: 358]	97.86
d1qfma1		430	Prolyl oligopeptidase, N-terminal domain {Pig (Sus	97.6
d1utca2		327	Clathrin heavy-chain terminal domain {Rat (Rattus	97.41
d1fwxa2		459	Nitrous oxide reductase, N-terminal domain {Paraco	97.27
d1k3ia3		387	Galactose oxidase, central domain {Fungi (Fusarium	96.91
d1xipa_		381	Nucleoporin NUP159 {Baker's yeast (Saccharomyces c	96.28
d1k3ia3		387	Galactose oxidase, central domain {Fungi (Fusarium	96.01
d2ad6a1		571	Methanol dehydrogenase, heavy chain {Methylophilus	95.88
d1v04a_		340	Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory	95.76
d1w6sa_		596	Methanol dehydrogenase, heavy chain {Methylobacter	95.41
d1ijqa1		266	Low density lipoprotein (LDL) receptor {Human (Hom	95.17
d1npea_		263	Nidogen {Mouse (Mus musculus) [TaxId: 10090]}	94.94
d1h6la_		353	Thermostable phytase (3-phytase) {Bacillus amyloli	94.77
d1kv9a2		560	Quinoprotein alcohol dehydrogenase, N-terminal dom	94.68
d1utca2		327	Clathrin heavy-chain terminal domain {Rat (Rattus	94.17
d1npea_		263	Nidogen {Mouse (Mus musculus) [TaxId: 10090]}	94.04
d1ijqa1		266	Low density lipoprotein (LDL) receptor {Human (Hom	92.41
d1crua_		450	Soluble quinoprotein glucose dehydrogenase {Acinet	91.61
d1v04a_		340	Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory	91.38
d1uw4a_		91	RNA processing protein UPF3x, RRM domain {Human (H	91.05
d1crua_		450	Soluble quinoprotein glucose dehydrogenase {Acinet	88.85
d1zgka1		288	Kelch-like ECH-associated protein 1, KEAP1 {Human	88.19
d1kb0a2		573	Quinoprotein alcohol dehydrogenase, N-terminal dom	86.99
d1xipa_		381	Nucleoporin NUP159 {Baker's yeast (Saccharomyces c	86.67
d2ad6a1		571	Methanol dehydrogenase, heavy chain {Methylophilus	86.35
d1h6la_		353	Thermostable phytase (3-phytase) {Bacillus amyloli	83.06
d1flga_		582	Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax	82.51
d1flga_		582	Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax	81.76

>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Groucho/tle1, C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=3.8e-33  Score=286.15  Aligned_cols=276  Identities=13%  Similarity=0.156  Sum_probs=220.0

Q ss_pred             CCCcccceEEECCCCcEEEEEeCCceEEeecCcCcc---eeee---ecCC-CeeEEEecCCCCEEEEEcCCCCCCCcCCC
Q 005315          201 RSYWTESFVQWSPLGTYLATVHRQGAAVWGGANTFN---RLMR---YAHP-QVKLIDFSPGEKYLVTYSSHEPSNPRDAN  273 (702)
Q Consensus       201 ~~~~~v~~v~~Spdg~~lat~~~~~i~iw~~~~~~~---~~~~---~~~~-~v~~i~fSpdg~~l~t~s~d~~~~~~~~~  273 (702)
                      .|...|+|++|||+|++||+|+.+.|+|||+. ...   .+..   ..|. .|.+++|+|+|++|++++.|         
T Consensus        49 ~H~~~V~~v~fs~~g~~latg~dg~V~iWd~~-~~~~~~~~~~~~~~~h~~~I~~v~~s~dg~~l~s~~~d---------  118 (337)
T d1gxra_          49 NHGEVVCAVTISNPTRHVYTGGKGCVKVWDIS-HPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEA---------  118 (337)
T ss_dssp             CCSSCCCEEEECSSSSEEEEECBSEEEEEETT-STTCCSCSEEEECSCTTSBEEEEEECTTSSEEEEEESS---------
T ss_pred             CCCCcEEEEEECCCCCEEEEEECCEEEEEEcc-CCcccceeEEeeecCCCCcEEEEEEcCCCCEEEEeecc---------
Confidence            68899999999999999999985448999987 332   1121   2344 49999999999999999999         


Q ss_pred             ccEEEEEEccCC--cEEeeccCCCcccccCCCCCCCCcccceEEEcCCCCcEEEEec-CCeEEEEecCCcccccceeecc
Q 005315          274 RVVINIFDVRTG--KVMRDFKGSADEFAVGGTGGVAGVSWPVFRWGGGKDKYFAKLG-KNMISVYETESFTLIDKKSLKV  350 (702)
Q Consensus       274 ~~~i~vwd~~~g--~~~~~~~~~~~~~~~~~~~~~~~~~w~~~~~s~~dg~~la~~~-d~~i~v~d~~~~~~~~~~~~~~  350 (702)
                       +.|++||+...  +....+..|...+.             .+.|+| ++.++++++ ++.|.+|++.+++.......+.
T Consensus       119 -g~i~iwd~~~~~~~~~~~~~~~~~~v~-------------~~~~~~-~~~~l~s~~~d~~i~~~~~~~~~~~~~~~~~~  183 (337)
T d1gxra_         119 -STLSIWDLAAPTPRIKAELTSSAPACY-------------ALAISP-DSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHT  183 (337)
T ss_dssp             -SEEEEEECCCC--EEEEEEECSSSCEE-------------EEEECT-TSSEEEEEETTSCEEEEETTTTEEEEEECCCS
T ss_pred             -ccccccccccccccccccccccccccc-------------cccccc-cccccccccccccccccccccccccccccccc
Confidence             99999998644  45666666665542             688999 999999988 9999999999888776666677


Q ss_pred             CCeeEEEeCCCCCeEEEEeecCCCCCCCcEEEEEecCCcceeeeeeecccccceeEEccCCCEEEEEEcccccccccccc
Q 005315          351 ENVMDFSWSPTDPIISLFVPELGGGNQPARVSLVQIPSKEELRQKNLFSVSDCKMYWQSSGDYLAVKVDRYTKTKKSTYT  430 (702)
Q Consensus       351 ~~v~~~~~sp~~~~la~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~s~~g~~l~~~~~~~~~~~~~~~~  430 (702)
                      ..|.+++|+|++..+++     ++.++.++  +|++.+.+.+                                      
T Consensus       184 ~~v~~l~~s~~~~~~~~-----~~~d~~v~--i~d~~~~~~~--------------------------------------  218 (337)
T d1gxra_         184 DGASCIDISNDGTKLWT-----GGLDNTVR--SWDLREGRQL--------------------------------------  218 (337)
T ss_dssp             SCEEEEEECTTSSEEEE-----EETTSEEE--EEETTTTEEE--------------------------------------
T ss_pred             ccccccccccccccccc-----cccccccc--ccccccceee--------------------------------------
Confidence            78999999999998888     54555443  3333221110                                      


Q ss_pred             cEEEEEEecCCcceeEEEecCCCCceeEEEEeeCCcEEEEEEcCCCCCeEEEEEeecccCcCceEEEEEcCCCceeEEEE
Q 005315          431 GFELFRIKERDIPIEVLELDNKNDKIIAFAWEPKGHRFAVIHGDSPRPDISFYSMRTAQHAGRVSKLTTLKGKQANALFW  510 (702)
Q Consensus       431 ~~~l~~l~~~~~~~~~~~l~~h~~~v~~~~~sp~g~~l~~~~~d~~~~~v~i~d~~~~~~~~~~~~~~~~~~~~v~~~~~  510 (702)
                                       ....|...|.+++|+|++++|++++.++   .+++|+++++..     .....+...+++++|
T Consensus       219 -----------------~~~~~~~~i~~l~~~~~~~~l~~~~~d~---~i~i~d~~~~~~-----~~~~~~~~~i~~v~~  273 (337)
T d1gxra_         219 -----------------QQHDFTSQIFSLGYCPTGEWLAVGMESS---NVEVLHVNKPDK-----YQLHLHESCVLSLKF  273 (337)
T ss_dssp             -----------------EEEECSSCEEEEEECTTSSEEEEEETTS---CEEEEETTSSCE-----EEECCCSSCEEEEEE
T ss_pred             -----------------cccccccceEEEEEcccccccceecccc---cccccccccccc-----ccccccccccceEEE
Confidence                             0113478899999999999999999999   999999975541     222233457999999


Q ss_pred             ccCCCEEEEEeccCCCceEEEEECCCcceeee-cccCceeeeEECCCCCEEEEEEeecccccccEEEEEe
Q 005315          511 SPSGRFIVLAGLKGFNGQLEFYNVDELETMAT-AEHFMATDVEWDPTGRYVATAVTSVHEMENGFNIWSF  579 (702)
Q Consensus       511 spdg~~l~~~~~~~~dg~v~i~d~~~~~~~~~-~~~~~i~~~~~spdg~~l~t~s~~~~~~d~~v~iw~~  579 (702)
                      +|+|++|++++.   ||.|++||+.+++.+.. .|...|++++|+|+|++|++++.     |+.|+||++
T Consensus       274 s~~g~~l~s~s~---Dg~i~iwd~~~~~~~~~~~~~~~v~~~~~s~d~~~l~t~s~-----D~~I~vWdl  335 (337)
T d1gxra_         274 AYCGKWFVSTGK---DNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSG-----DKKATVYEV  335 (337)
T ss_dssp             CTTSSEEEEEET---TSEEEEEETTTCCEEEEEECSSCEEEEEECTTSCEEEEEET-----TSCEEEEEE
T ss_pred             CCCCCEEEEEeC---CCeEEEEECCCCCEEEEccCCCCEEEEEEeCCCCEEEEEeC-----CCeEEEEEE
Confidence            999999999998   99999999998887765 56688999999999999999999     999999996

PyMOL of d1gxra_

>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]}	Back information, alignment and structure

>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]}	Back information, alignment and structure

>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]}	Back information, alignment and structure

>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]}	Back information, alignment and structure

>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]}	Back information, alignment and structure

>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]}	Back information, alignment and structure

>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]}	Back information, alignment and structure

>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]}	Back information, alignment and structure

>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]}	Back information, alignment and structure

>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]}	Back information, alignment and structure

>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]}	Back information, alignment and structure

>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]}	Back information, alignment and structure

>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]}	Back information, alignment and structure

>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]}	Back information, alignment and structure

>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]}	Back information, alignment and structure

>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]}	Back information, alignment and structure

>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]}	Back information, alignment and structure

>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]}	Back information, alignment and structure

>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]}	Back information, alignment and structure

>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]}	Back information, alignment and structure

>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]}	Back information, alignment and structure

>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}	Back information, alignment and structure

>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]}	Back information, alignment and structure

>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]}	Back information, alignment and structure

>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]}	Back information, alignment and structure

>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]}	Back information, alignment and structure

>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]}	Back information, alignment and structure

>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]}	Back information, alignment and structure

>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]}	Back information, alignment and structure

>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]}	Back information, alignment and structure

>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]}	Back information, alignment and structure

>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]}	Back information, alignment and structure

>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure