Citrus Sinensis ID: 005374
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 699 | ||||||
| 359491697 | 685 | PREDICTED: uncharacterized protein LOC10 | 0.977 | 0.997 | 0.650 | 0.0 | |
| 297733956 | 698 | unnamed protein product [Vitis vinifera] | 0.971 | 0.972 | 0.651 | 0.0 | |
| 255547351 | 682 | heat shock protein binding protein, puta | 0.969 | 0.994 | 0.651 | 0.0 | |
| 224127416 | 695 | predicted protein [Populus trichocarpa] | 0.981 | 0.987 | 0.649 | 0.0 | |
| 449440808 | 704 | PREDICTED: uncharacterized protein LOC10 | 0.977 | 0.970 | 0.585 | 0.0 | |
| 22329659 | 700 | DNAJ heat shock N-terminal domain-contai | 0.975 | 0.974 | 0.550 | 0.0 | |
| 79318136 | 705 | DNAJ heat shock N-terminal domain-contai | 0.964 | 0.956 | 0.551 | 0.0 | |
| 334182674 | 715 | DNAJ heat shock N-terminal domain-contai | 0.975 | 0.953 | 0.539 | 0.0 | |
| 297844826 | 703 | DNAJ heat shock N-terminal domain-contai | 0.962 | 0.957 | 0.552 | 0.0 | |
| 356519070 | 683 | PREDICTED: uncharacterized protein LOC10 | 0.955 | 0.978 | 0.537 | 0.0 |
| >gi|359491697|ref|XP_002281830.2| PREDICTED: uncharacterized protein LOC100244920 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 947 bits (2448), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 453/696 (65%), Positives = 547/696 (78%), Gaps = 13/696 (1%)
Query: 6 MISKVKAYWAPLILFGLGLFYQLVVLPRSFPPSHYDALGIKPYSSVEQVKEAYEKFSSKW 65
M S +KAY PL+L +F QL V+P SFP +HYD LGIK YS+VE+V EAYEKFSSKW
Sbjct: 1 MASTLKAYSIPLVLLAAAIFLQLFVIPNSFPLNHYDVLGIKRYSTVEEVAEAYEKFSSKW 60
Query: 66 NSGEEIPSTADFLKIQYAYELLTDPLWKRNYDVYGIDEQLHILEKVREQYGEESYSRIDL 125
NSG E+P T DFLKI+YA+ELLTDPLWKR+YD++GIDEQ+ + E V++Q+ S+S I+L
Sbjct: 61 NSGTEVPETIDFLKIRYAFELLTDPLWKRDYDIFGIDEQIDVFENVKKQFSGVSFSGINL 120
Query: 126 PLLDA--TDHSVHAFNVVTSEDFPSIFHDSKPWLIQVYSDGSYLCGQFSGAWKTIAALLE 183
PLL A +D H FNV+TS DF S+ ++P LIQ+YS GS C QFS WK IA LE
Sbjct: 121 PLLSAASSDPGDHVFNVITSNDFHSVLEKTEPLLIQIYSLGSNSCRQFSNDWKRIATFLE 180
Query: 184 GIANTGMVELGDIRLATHLAERKPIGQIFFRRGLPSLVAFPPGCKSSDCMTRFEGELSVD 243
G+ANTGMVELGD RLA +LAE+KP GQ FFR GLPSLVAFP GC++SDC+ R+EGELSVD
Sbjct: 181 GVANTGMVELGDARLAAYLAEKKPTGQPFFRNGLPSLVAFPSGCRTSDCLVRYEGELSVD 240
Query: 244 AVTDWFATAILKLPRIFYYTKESMGKNFLAKTGPHKVKVIFFSKTGERASPFVRQISRNY 303
AVTDWFATAIL LPRI YY+KES+G+ FLAK+ P KVKVI FS+TG+RA+PF+RQ ++NY
Sbjct: 241 AVTDWFATAILTLPRISYYSKESLGQAFLAKSSPWKVKVIVFSRTGQRATPFLRQAAKNY 300
Query: 304 WAYASFAFVLWREEESSIWWNTFEVESAPAIVFLKDPGVKPVVYYGSFNNSRLSEVMEQN 363
WA+ASFAFVLW+EE+SS+WWNTFEVESAPAIVFLKDPGVKPVV++G FNNS +MEQN
Sbjct: 301 WAHASFAFVLWQEEDSSVWWNTFEVESAPAIVFLKDPGVKPVVHHGFFNNSWFVNIMEQN 360
Query: 364 KLQGLYFCGTCVSELPQLRSVTSMELGCDARGYSRAGSDTTIWYCVILAGRLSPELNKMR 423
K Q ELPQLRS+TSMELGCDARGYSRAG DT WYCVILAGRLS ELNKMR
Sbjct: 361 KQQ----------ELPQLRSITSMELGCDARGYSRAGYDTMTWYCVILAGRLSLELNKMR 410
Query: 424 ETIRRVQETLLSDDESNAADTDQSLAPAAVAFRNKRLTFAWLDGEAQDRYCSFYLFSETS 483
ET+RRVQ+ L S E N AD Q P+A+A ++KRLTF WLDGEAQ +YC FY+ SE S
Sbjct: 411 ETMRRVQQILSSAAELNGADKQQPSEPSAIALKDKRLTFTWLDGEAQKQYCFFYIHSEDS 470
Query: 484 FETCGARRDMSDVPRLFIVRYKRNTTEDEAKIERKPRNIWDAMQEQEVDPASQLVVRYNG 543
++TCG RRD++DVP+LFIVRYKRN T D+ K+ER+P+ IW+ QE++VDPASQLV RYNG
Sbjct: 471 YDTCGPRRDVADVPQLFIVRYKRNATVDDLKVERRPKGIWNPFQEEDVDPASQLVARYNG 530
Query: 544 SDEIPQIAKWVSEIIQDGDSKDLPFYRAKTPELVPEDSEPLLTRSAQSLFSKSIGMKQRI 603
S EIP+I KW+S+II+DGDS+DLP +R KTP+LVPED +P+ ++ AQS+ S S G+K RI
Sbjct: 531 SGEIPEIIKWISQIIKDGDSRDLPLFRTKTPQLVPEDGDPIWSKGAQSILSTSKGLKYRI 590
Query: 604 RNIMGQCYDYLGDPRIGPALLLAALMSFGTIWLMRGQQRAHPSQSGQPGPSANEDENRPA 663
++I+ D LGDPRIGP LLL +LMSF +IWL R Q H S+ QP +N DE+R
Sbjct: 591 KSIISGMNDRLGDPRIGPMLLLGSLMSFASIWLKRSQA-THQSRLDQPSQPSNMDEDRKT 649
Query: 664 RRKRAKQGSNEGRPPSITDEEPKDAYQMPLLDSDSD 699
RR R S++ RP SITD EPKDAYQ PL DSDSD
Sbjct: 650 RRNRKTTVSSQDRPTSITDMEPKDAYQAPLSDSDSD 685
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|297733956|emb|CBI15203.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255547351|ref|XP_002514733.1| heat shock protein binding protein, putative [Ricinus communis] gi|223546337|gb|EEF47839.1| heat shock protein binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224127416|ref|XP_002329272.1| predicted protein [Populus trichocarpa] gi|222870726|gb|EEF07857.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449440808|ref|XP_004138176.1| PREDICTED: uncharacterized protein LOC101203381 [Cucumis sativus] gi|449477213|ref|XP_004154962.1| PREDICTED: uncharacterized protein LOC101225277 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|22329659|ref|NP_173305.2| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis thaliana] gi|17979007|gb|AAL47463.1| At1g18700/F6A14_19 [Arabidopsis thaliana] gi|23506111|gb|AAN28915.1| At1g18700/F6A14_19 [Arabidopsis thaliana] gi|332191626|gb|AEE29747.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|79318136|ref|NP_001031065.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis thaliana] gi|332191627|gb|AEE29748.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|334182674|ref|NP_001185029.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis thaliana] gi|332191629|gb|AEE29750.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297844826|ref|XP_002890294.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297336136|gb|EFH66553.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|356519070|ref|XP_003528197.1| PREDICTED: uncharacterized protein LOC100820244 [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 699 | ||||||
| WB|WBGene00001026 | 813 | dnj-8 [Caenorhabditis elegans | 0.389 | 0.334 | 0.259 | 6.9e-12 | |
| UNIPROTKB|E7EP04 | 275 | DNAJC10 "DnaJ homolog subfamil | 0.303 | 0.770 | 0.243 | 3.5e-11 | |
| UNIPROTKB|Q3B7W8 | 332 | DNAJC10 "DNAJC10 protein" [Hom | 0.303 | 0.638 | 0.243 | 9.7e-11 | |
| UNIPROTKB|F1N151 | 793 | DNAJC10 "Uncharacterized prote | 0.331 | 0.292 | 0.228 | 1.7e-10 | |
| MGI|MGI:1914111 | 793 | Dnajc10 "DnaJ (Hsp40) homolog, | 0.304 | 0.268 | 0.25 | 2.2e-09 | |
| RGD|1307813 | 793 | Dnajc10 "DnaJ (Hsp40) homolog, | 0.294 | 0.259 | 0.255 | 2.8e-09 | |
| RGD|1359395 | 771 | Dnajc16 "DnaJ (Hsp40) homolog, | 0.268 | 0.243 | 0.291 | 4.2e-09 | |
| UNIPROTKB|E1BRA6 | 798 | DNAJC10 "Uncharacterized prote | 0.291 | 0.255 | 0.226 | 5.7e-09 | |
| UNIPROTKB|Q8IXB1 | 793 | DNAJC10 "DnaJ homolog subfamil | 0.303 | 0.267 | 0.243 | 7.6e-09 | |
| UNIPROTKB|F1SUU5 | 782 | DNAJC16 "Uncharacterized prote | 0.268 | 0.240 | 0.287 | 9.1e-09 |
| WB|WBGene00001026 dnj-8 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
Score = 197 (74.4 bits), Expect = 6.9e-12, P = 6.9e-12
Identities = 81/312 (25%), Positives = 140/312 (44%)
Query: 17 LILFGLGLFYQLVVLPRSFPPSHYDALGIKPYSSVEQVKEAYEKFSSKWNSGEEIPSTAD 76
++L +G + LV S Y LGI +S +++K AY+ + +W+ + A
Sbjct: 1 MLLLRIGSLFLLVSSALSQKEDPYKVLGISRRASAKEIKSAYKSLAREWHPDKRKDEAAS 60
Query: 77 --FLKIQYAYELLTDPLWKRNYDVYG-IDEQLHI---LEKVREQYGEESYSRIDLPLLDA 130
F++I AYE+L+DPL K YD +G D+ E+ R YG +
Sbjct: 61 GRFMEIAEAYEVLSDPLRKERYDRFGTFDDVKQFEDNAERARSFYGFGGFGGFGF----- 115
Query: 131 TDHSVHAFNVVTS-EDFP-SIFHDS--KPWLIQVYSDGSYLCGQFSGAWKTIAALLEGIA 186
D SV + S + + I +S KP+++ +YS+ +C +F WK + A LE +
Sbjct: 116 -DESVFEYKYRMSYQQYQFKILEESNTKPYIVYIYSNYCQMCYRFHPQWKRVIADLEPLG 174
Query: 187 NTGMVELGDIRLATHLAERKPIGQIFFRRGLPSLVAFPPGCKSSDCMTRFEGELSVDAVT 246
G+ + R +L E+ I + P+LVA G R + S ++
Sbjct: 175 Y-GIATVNGNR-EQNLMEKMRISHV------PALVAIVEG---RIIPMRIDSSFSDRSIV 223
Query: 247 DWFATAILKLPRIFYYTKESMG---KNFLAK-TGPHKVKVIFFSKTGERASPFVRQI--S 300
FA ++ P ++ TK + G F+ + +K+ V+ F G A+P +R + +
Sbjct: 224 A-FAQKVI--PS-YFMTKINSGVMLSRFVDQWKSSNKISVVIF---GAAANPRIRYLLAA 276
Query: 301 RNYWAYASFAFV 312
Y +A FA+V
Sbjct: 277 MKYSQFARFAYV 288
|
|
| UNIPROTKB|E7EP04 DNAJC10 "DnaJ homolog subfamily C member 10" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3B7W8 DNAJC10 "DNAJC10 protein" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N151 DNAJC10 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1914111 Dnajc10 "DnaJ (Hsp40) homolog, subfamily C, member 10" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1307813 Dnajc10 "DnaJ (Hsp40) homolog, subfamily C, member 10" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| RGD|1359395 Dnajc16 "DnaJ (Hsp40) homolog, subfamily C, member 16" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BRA6 DNAJC10 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8IXB1 DNAJC10 "DnaJ homolog subfamily C member 10" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SUU5 DNAJC16 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 699 | |||
| pfam00226 | 63 | pfam00226, DnaJ, DnaJ domain | 2e-08 | |
| smart00271 | 60 | smart00271, DnaJ, DnaJ molecular chaperone homolog | 9e-07 | |
| COG0484 | 371 | COG0484, DnaJ, DnaJ-class molecular chaperone with | 2e-06 | |
| cd06257 | 55 | cd06257, DnaJ, DnaJ domain or J-domain | 4e-06 | |
| PRK14284 | 391 | PRK14284, PRK14284, chaperone protein DnaJ; Provis | 3e-05 | |
| cd02961 | 101 | cd02961, PDI_a_family, Protein Disulfide Isomerase | 4e-05 | |
| PRK14287 | 371 | PRK14287, PRK14287, chaperone protein DnaJ; Provis | 5e-05 | |
| PRK14282 | 369 | PRK14282, PRK14282, chaperone protein DnaJ; Provis | 1e-04 | |
| PRK14280 | 376 | PRK14280, PRK14280, chaperone protein DnaJ; Provis | 2e-04 | |
| PRK14276 | 380 | PRK14276, PRK14276, chaperone protein DnaJ; Provis | 2e-04 | |
| PRK14290 | 365 | PRK14290, PRK14290, chaperone protein DnaJ; Provis | 4e-04 | |
| PRK14277 | 386 | PRK14277, PRK14277, chaperone protein DnaJ; Provis | 5e-04 | |
| PRK14286 | 372 | PRK14286, PRK14286, chaperone protein DnaJ; Provis | 7e-04 | |
| cd02963 | 111 | cd02963, TRX_DnaJ, TRX domain, DnaJ domain contain | 0.001 | |
| cd03003 | 101 | cd03003, PDI_a_ERdj5_N, PDIa family, N-terminal ER | 0.001 | |
| TIGR02349 | 354 | TIGR02349, DnaJ_bact, chaperone protein DnaJ | 0.001 | |
| PRK14291 | 382 | PRK14291, PRK14291, chaperone protein DnaJ; Provis | 0.001 | |
| PRK14298 | 377 | PRK14298, PRK14298, chaperone protein DnaJ; Provis | 0.002 | |
| TIGR03835 | 871 | TIGR03835, termin_org_DnaJ, terminal organelle ass | 0.002 | |
| PRK14299 | 291 | PRK14299, PRK14299, chaperone protein DnaJ; Provis | 0.003 | |
| PRK14297 | 380 | PRK14297, PRK14297, chaperone protein DnaJ; Provis | 0.003 | |
| PRK14278 | 378 | PRK14278, PRK14278, chaperone protein DnaJ; Provis | 0.003 | |
| PRK14292 | 371 | PRK14292, PRK14292, chaperone protein DnaJ; Provis | 0.004 | |
| COG5407 | 610 | COG5407, SEC63, Preprotein translocase subunit Sec | 0.004 |
| >gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain | Back alignment and domain information |
|---|
Score = 50.6 bits (122), Expect = 2e-08
Identities = 22/63 (34%), Positives = 37/63 (58%), Gaps = 5/63 (7%)
Query: 39 HYDALGIKPYSSVEQVKEAYEKFSSKW----NSGEEIPSTADFLKIQYAYELLTDPLWKR 94
+Y+ LG+ +S E++K+AY K + K+ N G+ + F +I AYE+L+DP +
Sbjct: 2 YYEILGVPRDASDEEIKKAYRKLALKYHPDKNPGDPA-AEEKFKEINEAYEVLSDPEKRA 60
Query: 95 NYD 97
YD
Sbjct: 61 IYD 63
|
DnaJ domains (J-domains) are associated with hsp70 heat-shock system and it is thought that this domain mediates the interaction. DnaJ-domain is therefore part of a chaperone (protein folding) system. The T-antigens, although not in Prosite are confirmed as DnaJ containing domains from literature. Length = 63 |
| >gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain | Back alignment and domain information |
|---|
| >gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239259 cd02961, PDI_a_family, Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants | Back alignment and domain information |
|---|
| >gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239261 cd02963, TRX_DnaJ, TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain | Back alignment and domain information |
|---|
| >gnl|CDD|239301 cd03003, PDI_a_ERdj5_N, PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains | Back alignment and domain information |
|---|
| >gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ | Back alignment and domain information |
|---|
| >gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 699 | |||
| KOG0190 | 493 | consensus Protein disulfide isomerase (prolyl 4-hy | 100.0 | |
| KOG4277 | 468 | consensus Uncharacterized conserved protein, conta | 99.97 | |
| TIGR01130 | 462 | ER_PDI_fam protein disulfide isomerases, eukaryoti | 99.96 | |
| PTZ00102 | 477 | disulphide isomerase; Provisional | 99.94 | |
| KOG0713 | 336 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.89 | |
| KOG0912 | 375 | consensus Thiol-disulfide isomerase and thioredoxi | 99.83 | |
| cd03006 | 113 | PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamil | 99.83 | |
| COG0484 | 371 | DnaJ DnaJ-class molecular chaperone with C-termina | 99.8 | |
| KOG0191 | 383 | consensus Thioredoxin/protein disulfide isomerase | 99.8 | |
| cd03003 | 101 | PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam | 99.79 | |
| cd03007 | 116 | PDI_a_ERp29_N PDIa family, endoplasmic reticulum p | 99.79 | |
| PF01216 | 383 | Calsequestrin: Calsequestrin; InterPro: IPR001393 | 99.79 | |
| cd02996 | 108 | PDI_a_ERp44 PDIa family, endoplasmic reticulum pro | 99.76 | |
| cd03004 | 104 | PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam | 99.76 | |
| KOG0712 | 337 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.74 | |
| PF00085 | 103 | Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio | 99.72 | |
| cd03002 | 109 | PDI_a_MPD1_like PDI family, MPD1-like subfamily; c | 99.71 | |
| cd02994 | 101 | PDI_a_TMX PDIa family, TMX subfamily; composed of | 99.7 | |
| cd03001 | 103 | PDI_a_P5 PDIa family, P5 subfamily; composed of eu | 99.67 | |
| cd02993 | 109 | PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfat | 99.67 | |
| cd03065 | 120 | PDI_b_Calsequestrin_N PDIb family, Calsequestrin s | 99.67 | |
| KOG0190 | 493 | consensus Protein disulfide isomerase (prolyl 4-hy | 99.66 | |
| cd03005 | 102 | PDI_a_ERp46 PDIa family, endoplasmic reticulum pro | 99.65 | |
| cd02995 | 104 | PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain | 99.65 | |
| PRK14288 | 369 | chaperone protein DnaJ; Provisional | 99.64 | |
| cd02963 | 111 | TRX_DnaJ TRX domain, DnaJ domain containing protei | 99.64 | |
| PTZ00443 | 224 | Thioredoxin domain-containing protein; Provisional | 99.64 | |
| PRK14296 | 372 | chaperone protein DnaJ; Provisional | 99.63 | |
| KOG1731 | 606 | consensus FAD-dependent sulfhydryl oxidase/quiesci | 99.62 | |
| TIGR01126 | 102 | pdi_dom protein disulfide-isomerase domain. This m | 99.59 | |
| cd02997 | 104 | PDI_a_PDIR PDIa family, PDIR subfamily; composed o | 99.59 | |
| PTZ00037 | 421 | DnaJ_C chaperone protein; Provisional | 99.59 | |
| cd02956 | 96 | ybbN ybbN protein family; ybbN is a hypothetical p | 99.59 | |
| KOG0910 | 150 | consensus Thioredoxin-like protein [Posttranslatio | 99.59 | |
| cd02998 | 105 | PDI_a_ERp38 PDIa family, endoplasmic reticulum pro | 99.59 | |
| cd02999 | 100 | PDI_a_ERp44_like PDIa family, endoplasmic reticulu | 99.58 | |
| PRK14279 | 392 | chaperone protein DnaJ; Provisional | 99.58 | |
| PRK14286 | 372 | chaperone protein DnaJ; Provisional | 99.58 | |
| KOG0717 | 508 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.57 | |
| PRK14287 | 371 | chaperone protein DnaJ; Provisional | 99.57 | |
| TIGR02187 | 215 | GlrX_arch Glutaredoxin-like domain protein. This f | 99.56 | |
| cd02992 | 114 | PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidas | 99.56 | |
| PRK14298 | 377 | chaperone protein DnaJ; Provisional | 99.56 | |
| PRK14276 | 380 | chaperone protein DnaJ; Provisional | 99.56 | |
| TIGR00424 | 463 | APS_reduc 5'-adenylylsulfate reductase, thioredoxi | 99.56 | |
| PRK14283 | 378 | chaperone protein DnaJ; Provisional | 99.56 | |
| PRK14282 | 369 | chaperone protein DnaJ; Provisional | 99.55 | |
| PRK09381 | 109 | trxA thioredoxin; Provisional | 99.55 | |
| COG3118 | 304 | Thioredoxin domain-containing protein [Posttransla | 99.55 | |
| PRK14285 | 365 | chaperone protein DnaJ; Provisional | 99.55 | |
| PRK14278 | 378 | chaperone protein DnaJ; Provisional | 99.55 | |
| PRK14299 | 291 | chaperone protein DnaJ; Provisional | 99.54 | |
| PRK14280 | 376 | chaperone protein DnaJ; Provisional | 99.54 | |
| KOG0716 | 279 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.54 | |
| PRK14291 | 382 | chaperone protein DnaJ; Provisional | 99.54 | |
| PRK14297 | 380 | chaperone protein DnaJ; Provisional | 99.54 | |
| PRK14294 | 366 | chaperone protein DnaJ; Provisional | 99.54 | |
| KOG0721 | 230 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.53 | |
| PRK14277 | 386 | chaperone protein DnaJ; Provisional | 99.53 | |
| cd02961 | 101 | PDI_a_family Protein Disulfide Isomerase (PDIa) fa | 99.53 | |
| PRK14301 | 373 | chaperone protein DnaJ; Provisional | 99.53 | |
| cd03000 | 104 | PDI_a_TMX3 PDIa family, TMX3 subfamily; composed o | 99.53 | |
| PLN02309 | 457 | 5'-adenylylsulfate reductase | 99.52 | |
| PRK14284 | 391 | chaperone protein DnaJ; Provisional | 99.52 | |
| PF00226 | 64 | DnaJ: DnaJ domain; InterPro: IPR001623 The prokary | 99.52 | |
| PRK14281 | 397 | chaperone protein DnaJ; Provisional | 99.51 | |
| PRK14295 | 389 | chaperone protein DnaJ; Provisional | 99.51 | |
| PHA02278 | 103 | thioredoxin-like protein | 99.5 | |
| PRK10767 | 371 | chaperone protein DnaJ; Provisional | 99.5 | |
| PRK14290 | 365 | chaperone protein DnaJ; Provisional | 99.48 | |
| PRK14300 | 372 | chaperone protein DnaJ; Provisional | 99.48 | |
| PRK10996 | 139 | thioredoxin 2; Provisional | 99.48 | |
| TIGR02349 | 354 | DnaJ_bact chaperone protein DnaJ. This model repre | 99.47 | |
| KOG0718 | 546 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.47 | |
| PRK14292 | 371 | chaperone protein DnaJ; Provisional | 99.47 | |
| PRK14293 | 374 | chaperone protein DnaJ; Provisional | 99.47 | |
| PTZ00341 | 1136 | Ring-infected erythrocyte surface antigen; Provisi | 99.46 | |
| cd02962 | 152 | TMX2 TMX2 family; composed of proteins similar to | 99.46 | |
| KOG0715 | 288 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.45 | |
| PF13848 | 184 | Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_ | 99.45 | |
| cd02985 | 103 | TRX_CDSP32 TRX family, chloroplastic drought-induc | 99.45 | |
| PRK14289 | 386 | chaperone protein DnaJ; Provisional | 99.45 | |
| KOG0691 | 296 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.43 | |
| TIGR01068 | 101 | thioredoxin thioredoxin. Several proteins, such as | 99.43 | |
| PRK10266 | 306 | curved DNA-binding protein CbpA; Provisional | 99.43 | |
| KOG0719 | 264 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.42 | |
| cd02957 | 113 | Phd_like Phosducin (Phd)-like family; composed of | 99.42 | |
| cd02965 | 111 | HyaE HyaE family; HyaE is also called HupG and Hox | 99.42 | |
| PTZ00102 | 477 | disulphide isomerase; Provisional | 99.41 | |
| cd02948 | 102 | TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fus | 99.41 | |
| KOG0191 | 383 | consensus Thioredoxin/protein disulfide isomerase | 99.4 | |
| cd02954 | 114 | DIM1 Dim1 family; Dim1 is also referred to as U5 s | 99.39 | |
| smart00271 | 60 | DnaJ DnaJ molecular chaperone homology domain. | 99.38 | |
| KOG0722 | 329 | consensus Molecular chaperone (DnaJ superfamily) [ | 99.38 | |
| cd06257 | 55 | DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho | 99.37 | |
| PHA03102 | 153 | Small T antigen; Reviewed | 99.36 | |
| cd02953 | 104 | DsbDgamma DsbD gamma family; DsbD gamma is the C-t | 99.35 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 99.35 | |
| cd02989 | 113 | Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior | 99.33 | |
| cd02950 | 142 | TxlA TRX-like protein A (TxlA) family; TxlA was or | 99.3 | |
| TIGR01130 | 462 | ER_PDI_fam protein disulfide isomerases, eukaryoti | 99.3 | |
| TIGR03835 | 871 | termin_org_DnaJ terminal organelle assembly protei | 99.29 | |
| cd02947 | 93 | TRX_family TRX family; composed of two groups: Gro | 99.28 | |
| cd02984 | 97 | TRX_PICOT TRX domain, PICOT (for PKC-interacting c | 99.26 | |
| PTZ00051 | 98 | thioredoxin; Provisional | 99.24 | |
| cd02949 | 97 | TRX_NTR TRX domain, novel NADPH thioredoxin reduct | 99.23 | |
| COG2214 | 237 | CbpA DnaJ-class molecular chaperone [Posttranslati | 99.2 | |
| KOG0907 | 106 | consensus Thioredoxin [Posttranslational modificat | 99.2 | |
| PLN00410 | 142 | U5 snRNP protein, DIM1 family; Provisional | 99.17 | |
| cd02975 | 113 | PfPDO_like_N Pyrococcus furiosus protein disulfide | 99.17 | |
| cd02987 | 175 | Phd_like_Phd Phosducin (Phd)-like family, Phd subf | 99.14 | |
| TIGR01295 | 122 | PedC_BrcD bacteriocin transport accessory protein, | 99.14 | |
| cd02982 | 103 | PDI_b'_family Protein Disulfide Isomerase (PDIb') | 99.13 | |
| PRK01356 | 166 | hscB co-chaperone HscB; Provisional | 99.09 | |
| PRK05014 | 171 | hscB co-chaperone HscB; Provisional | 99.07 | |
| cd02986 | 114 | DLP Dim1 family, Dim1-like protein (DLP) subfamily | 99.05 | |
| TIGR00411 | 82 | redox_disulf_1 small redox-active disulfide protei | 99.04 | |
| cd02983 | 130 | P5_C P5 family, C-terminal redox inactive TRX-like | 99.03 | |
| cd02988 | 192 | Phd_like_VIAF Phosducin (Phd)-like family, Viral i | 99.02 | |
| COG5407 | 610 | SEC63 Preprotein translocase subunit Sec63 [Intrac | 99.01 | |
| PRK03578 | 176 | hscB co-chaperone HscB; Provisional | 99.01 | |
| PRK00294 | 173 | hscB co-chaperone HscB; Provisional | 98.98 | |
| PTZ00100 | 116 | DnaJ chaperone protein; Provisional | 98.96 | |
| KOG0908 | 288 | consensus Thioredoxin-like protein [Posttranslatio | 98.96 | |
| cd02951 | 125 | SoxW SoxW family; SoxW is a bacterial periplasmic | 98.96 | |
| KOG0720 | 490 | consensus Molecular chaperone (DnaJ superfamily) [ | 98.94 | |
| KOG0714 | 306 | consensus Molecular chaperone (DnaJ superfamily) [ | 98.92 | |
| PF13848 | 184 | Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_ | 98.9 | |
| PTZ00062 | 204 | glutaredoxin; Provisional | 98.84 | |
| cd02952 | 119 | TRP14_like Human TRX-related protein 14 (TRP14)-li | 98.82 | |
| PHA02624 | 647 | large T antigen; Provisional | 98.82 | |
| PRK09430 | 267 | djlA Dna-J like membrane chaperone protein; Provis | 98.78 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 98.76 | |
| TIGR02187 | 215 | GlrX_arch Glutaredoxin-like domain protein. This f | 98.71 | |
| PHA02125 | 75 | thioredoxin-like protein | 98.68 | |
| KOG0913 | 248 | consensus Thiol-disulfide isomerase and thioredoxi | 98.66 | |
| TIGR00412 | 76 | redox_disulf_2 small redox-active disulfide protei | 98.62 | |
| cd02959 | 117 | ERp19 Endoplasmic reticulum protein 19 (ERp19) fam | 98.62 | |
| PRK00293 | 571 | dipZ thiol:disulfide interchange protein precursor | 98.58 | |
| PF13098 | 112 | Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_ | 98.55 | |
| KOG1150 | 250 | consensus Predicted molecular chaperone (DnaJ supe | 98.54 | |
| PRK01773 | 173 | hscB co-chaperone HscB; Provisional | 98.53 | |
| PRK03147 | 173 | thiol-disulfide oxidoreductase; Provisional | 98.45 | |
| cd02973 | 67 | TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- | 98.39 | |
| TIGR02740 | 271 | TraF-like TraF-like protein. This protein is relat | 98.38 | |
| TIGR00714 | 157 | hscB Fe-S protein assembly co-chaperone HscB. This | 98.34 | |
| cd03011 | 123 | TlpA_like_ScsD_MtbDsbE TlpA-like family, suppresso | 98.28 | |
| KOG0914 | 265 | consensus Thioredoxin-like protein [Posttranslatio | 98.26 | |
| cd02955 | 124 | SSP411 TRX domain, SSP411 protein family; members | 98.25 | |
| TIGR02738 | 153 | TrbB type-F conjugative transfer system pilin asse | 98.22 | |
| cd03009 | 131 | TryX_like_TryX_NRX Tryparedoxin (TryX)-like family | 98.19 | |
| PRK14018 | 521 | trifunctional thioredoxin/methionine sulfoxide red | 98.19 | |
| COG5269 | 379 | ZUO1 Ribosome-associated chaperone zuotin [Transla | 98.17 | |
| PRK11509 | 132 | hydrogenase-1 operon protein HyaE; Provisional | 98.16 | |
| cd02966 | 116 | TlpA_like_family TlpA-like family; composed of Tlp | 98.15 | |
| cd03026 | 89 | AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid | 98.15 | |
| cd03007 | 116 | PDI_a_ERp29_N PDIa family, endoplasmic reticulum p | 98.15 | |
| cd02967 | 114 | mauD Methylamine utilization (mau) D family; mauD | 98.13 | |
| cd03010 | 127 | TlpA_like_DsbE TlpA-like family, DsbE (also known | 98.13 | |
| cd02964 | 132 | TryX_like_family Tryparedoxin (TryX)-like family; | 98.12 | |
| cd03065 | 120 | PDI_b_Calsequestrin_N PDIb family, Calsequestrin s | 98.03 | |
| PF00085 | 103 | Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio | 98.01 | |
| TIGR00385 | 173 | dsbE periplasmic protein thiol:disulfide oxidoredu | 97.96 | |
| PRK15412 | 185 | thiol:disulfide interchange protein DsbE; Provisio | 97.96 | |
| cd03004 | 104 | PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam | 97.94 | |
| cd02981 | 97 | PDI_b_family Protein Disulfide Isomerase (PDIb) fa | 97.91 | |
| KOG0568 | 342 | consensus Molecular chaperone (DnaJ superfamily) [ | 97.88 | |
| cd02958 | 114 | UAS UAS family; UAS is a domain of unknown functio | 97.84 | |
| KOG1789 | 2235 | consensus Endocytosis protein RME-8, contains DnaJ | 97.83 | |
| cd03008 | 146 | TryX_like_RdCVF Tryparedoxin (TryX)-like family, R | 97.81 | |
| cd03006 | 113 | PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamil | 97.8 | |
| cd03066 | 102 | PDI_b_Calsequestrin_middle PDIb family, Calsequest | 97.8 | |
| cd03002 | 109 | PDI_a_MPD1_like PDI family, MPD1-like subfamily; c | 97.8 | |
| PRK13728 | 181 | conjugal transfer protein TrbB; Provisional | 97.79 | |
| cd03069 | 104 | PDI_b_ERp57 PDIb family, ERp57 subfamily, first re | 97.76 | |
| PF13905 | 95 | Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_ | 97.76 | |
| cd01659 | 69 | TRX_superfamily Thioredoxin (TRX) superfamily; a l | 97.74 | |
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 97.72 | |
| cd03003 | 101 | PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam | 97.72 | |
| COG4232 | 569 | Thiol:disulfide interchange protein [Posttranslati | 97.68 | |
| PF13899 | 82 | Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_ | 97.66 | |
| cd02996 | 108 | PDI_a_ERp44 PDIa family, endoplasmic reticulum pro | 97.65 | |
| cd03001 | 103 | PDI_a_P5 PDIa family, P5 subfamily; composed of eu | 97.62 | |
| TIGR02196 | 74 | GlrX_YruB Glutaredoxin-like protein, YruB-family. | 97.6 | |
| COG0526 | 127 | TrxA Thiol-disulfide isomerase and thioredoxins [P | 97.56 | |
| cd02993 | 109 | PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfat | 97.5 | |
| TIGR01126 | 102 | pdi_dom protein disulfide-isomerase domain. This m | 97.5 | |
| cd03012 | 126 | TlpA_like_DipZ_like TlpA-like family, DipZ-like su | 97.49 | |
| PLN02399 | 236 | phospholipid hydroperoxide glutathione peroxidase | 97.49 | |
| TIGR02661 | 189 | MauD methylamine dehydrogenase accessory protein M | 97.46 | |
| cd03073 | 111 | PDI_b'_ERp72_ERp57 PDIb' family, ERp72 and ERp57 s | 97.44 | |
| COG3118 | 304 | Thioredoxin domain-containing protein [Posttransla | 97.39 | |
| TIGR00424 | 463 | APS_reduc 5'-adenylylsulfate reductase, thioredoxi | 97.38 | |
| smart00594 | 122 | UAS UAS domain. | 97.38 | |
| PRK11509 | 132 | hydrogenase-1 operon protein HyaE; Provisional | 97.38 | |
| PF07912 | 126 | ERp29_N: ERp29, N-terminal domain; InterPro: IPR01 | 97.37 | |
| PTZ00056 | 199 | glutathione peroxidase; Provisional | 97.34 | |
| cd02982 | 103 | PDI_b'_family Protein Disulfide Isomerase (PDIb') | 97.27 | |
| cd02956 | 96 | ybbN ybbN protein family; ybbN is a hypothetical p | 97.27 | |
| PF13192 | 76 | Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZY | 97.24 | |
| cd02981 | 97 | PDI_b_family Protein Disulfide Isomerase (PDIb) fa | 97.23 | |
| cd02965 | 111 | HyaE HyaE family; HyaE is also called HupG and Hox | 97.23 | |
| cd03068 | 107 | PDI_b_ERp72 PDIb family, ERp72 subfamily, first re | 97.19 | |
| cd02998 | 105 | PDI_a_ERp38 PDIa family, endoplasmic reticulum pro | 97.18 | |
| PLN02412 | 167 | probable glutathione peroxidase | 97.15 | |
| cd02960 | 130 | AGR Anterior Gradient (AGR) family; members of thi | 97.15 | |
| cd03072 | 111 | PDI_b'_ERp44 PDIb' family, ERp44 subfamily, second | 97.14 | |
| cd02999 | 100 | PDI_a_ERp44_like PDIa family, endoplasmic reticulu | 97.11 | |
| cd02995 | 104 | PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain | 97.08 | |
| TIGR02540 | 153 | gpx7 putative glutathione peroxidase Gpx7. This mo | 97.08 | |
| PLN02309 | 457 | 5'-adenylylsulfate reductase | 97.04 | |
| cd02994 | 101 | PDI_a_TMX PDIa family, TMX subfamily; composed of | 97.04 | |
| TIGR03143 | 555 | AhpF_homolog putative alkyl hydroperoxide reductas | 97.03 | |
| KOG0723 | 112 | consensus Molecular chaperone (DnaJ superfamily) [ | 97.03 | |
| TIGR02200 | 77 | GlrX_actino Glutaredoxin-like protein. This family | 97.02 | |
| cd03005 | 102 | PDI_a_ERp46 PDIa family, endoplasmic reticulum pro | 97.02 | |
| cd02961 | 101 | PDI_a_family Protein Disulfide Isomerase (PDIa) fa | 96.99 | |
| cd00340 | 152 | GSH_Peroxidase Glutathione (GSH) peroxidase family | 96.99 | |
| cd02997 | 104 | PDI_a_PDIR PDIa family, PDIR subfamily; composed o | 96.99 | |
| TIGR01068 | 101 | thioredoxin thioredoxin. Several proteins, such as | 96.95 | |
| cd02963 | 111 | TRX_DnaJ TRX domain, DnaJ domain containing protei | 96.94 | |
| cd02953 | 104 | DsbDgamma DsbD gamma family; DsbD gamma is the C-t | 96.9 | |
| PF13728 | 215 | TraF: F plasmid transfer operon protein | 96.82 | |
| KOG0910 | 150 | consensus Thioredoxin-like protein [Posttranslatio | 96.81 | |
| cd03067 | 112 | PDI_b_PDIR_N PDIb family, PDIR subfamily, N-termin | 96.81 | |
| PF08534 | 146 | Redoxin: Redoxin; InterPro: IPR013740 This redoxin | 96.79 | |
| PRK09381 | 109 | trxA thioredoxin; Provisional | 96.78 | |
| cd02950 | 142 | TxlA TRX-like protein A (TxlA) family; TxlA was or | 96.77 | |
| cd02983 | 130 | P5_C P5 family, C-terminal redox inactive TRX-like | 96.77 | |
| PF02114 | 265 | Phosducin: Phosducin; InterPro: IPR024253 The oute | 96.75 | |
| cd02969 | 171 | PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypot | 96.7 | |
| PRK10996 | 139 | thioredoxin 2; Provisional | 96.67 | |
| PTZ00443 | 224 | Thioredoxin domain-containing protein; Provisional | 96.64 | |
| KOG4277 | 468 | consensus Uncharacterized conserved protein, conta | 96.61 | |
| TIGR02180 | 84 | GRX_euk Glutaredoxin. This model represents eukary | 96.49 | |
| cd02989 | 113 | Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior | 96.46 | |
| PHA02278 | 103 | thioredoxin-like protein | 96.43 | |
| cd03072 | 111 | PDI_b'_ERp44 PDIb' family, ERp44 subfamily, second | 96.39 | |
| cd03000 | 104 | PDI_a_TMX3 PDIa family, TMX3 subfamily; composed o | 96.35 | |
| cd02948 | 102 | TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fus | 96.29 | |
| cd02954 | 114 | DIM1 Dim1 family; Dim1 is also referred to as U5 s | 96.28 | |
| cd02949 | 97 | TRX_NTR TRX domain, novel NADPH thioredoxin reduct | 96.26 | |
| cd02957 | 113 | Phd_like Phosducin (Phd)-like family; composed of | 96.25 | |
| cd02975 | 113 | PfPDO_like_N Pyrococcus furiosus protein disulfide | 96.22 | |
| cd02985 | 103 | TRX_CDSP32 TRX family, chloroplastic drought-induc | 96.21 | |
| TIGR02739 | 256 | TraF type-F conjugative transfer system pilin asse | 96.2 | |
| PF07912 | 126 | ERp29_N: ERp29, N-terminal domain; InterPro: IPR01 | 96.09 | |
| KOG2603 | 331 | consensus Oligosaccharyltransferase, gamma subunit | 96.01 | |
| PF00578 | 124 | AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Per | 95.97 | |
| KOG0907 | 106 | consensus Thioredoxin [Posttranslational modificat | 95.96 | |
| cd02987 | 175 | Phd_like_Phd Phosducin (Phd)-like family, Phd subf | 95.96 | |
| KOG3192 | 168 | consensus Mitochondrial J-type chaperone [Posttran | 95.92 | |
| KOG0912 | 375 | consensus Thiol-disulfide isomerase and thioredoxi | 95.9 | |
| PTZ00256 | 183 | glutathione peroxidase; Provisional | 95.75 | |
| cd03017 | 140 | PRX_BCP Peroxiredoxin (PRX) family, Bacterioferrit | 95.66 | |
| cd03015 | 173 | PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2- | 95.59 | |
| cd02986 | 114 | DLP Dim1 family, Dim1-like protein (DLP) subfamily | 95.56 | |
| PRK13703 | 248 | conjugal pilus assembly protein TraF; Provisional | 95.53 | |
| cd02991 | 116 | UAS_ETEA UAS family, ETEA subfamily; composed of p | 95.51 | |
| PRK10606 | 183 | btuE putative glutathione peroxidase; Provisional | 95.51 | |
| cd02984 | 97 | TRX_PICOT TRX domain, PICOT (for PKC-interacting c | 95.49 | |
| TIGR03143 | 555 | AhpF_homolog putative alkyl hydroperoxide reductas | 95.48 | |
| TIGR03137 | 187 | AhpC peroxiredoxin. This gene contains two invaria | 95.46 | |
| TIGR01626 | 184 | ytfJ_HI0045 conserved hypothetical protein YtfJ-fa | 95.46 | |
| PLN00410 | 142 | U5 snRNP protein, DIM1 family; Provisional | 95.46 | |
| KOG2501 | 157 | consensus Thioredoxin, nucleoredoxin and related p | 95.41 | |
| PRK11200 | 85 | grxA glutaredoxin 1; Provisional | 95.4 | |
| PRK00522 | 167 | tpx lipid hydroperoxide peroxidase; Provisional | 95.39 | |
| cd02970 | 149 | PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypot | 95.31 | |
| cd02947 | 93 | TRX_family TRX family; composed of two groups: Gro | 95.24 | |
| PRK09437 | 154 | bcp thioredoxin-dependent thiol peroxidase; Review | 95.22 | |
| PRK15317 | 517 | alkyl hydroperoxide reductase subunit F; Provision | 95.16 | |
| cd02951 | 125 | SoxW SoxW family; SoxW is a bacterial periplasmic | 95.09 | |
| PF06110 | 119 | DUF953: Eukaryotic protein of unknown function (DU | 94.98 | |
| cd03014 | 143 | PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical | 94.85 | |
| cd03018 | 149 | PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-lik | 94.75 | |
| KOG1672 | 211 | consensus ATP binding protein [Posttranslational m | 94.68 | |
| cd03073 | 111 | PDI_b'_ERp72_ERp57 PDIb' family, ERp72 and ERp57 s | 94.58 | |
| cd02962 | 152 | TMX2 TMX2 family; composed of proteins similar to | 94.5 | |
| TIGR00411 | 82 | redox_disulf_1 small redox-active disulfide protei | 94.46 | |
| cd02968 | 142 | SCO SCO (an acronym for Synthesis of Cytochrome c | 94.45 | |
| cd02976 | 73 | NrdH NrdH-redoxin (NrdH) family; NrdH is a small m | 94.11 | |
| KOG0911 | 227 | consensus Glutaredoxin-related protein [Posttransl | 94.11 | |
| cd02971 | 140 | PRX_family Peroxiredoxin (PRX) family; composed of | 94.06 | |
| cd02988 | 192 | Phd_like_VIAF Phosducin (Phd)-like family, Viral i | 94.06 | |
| cd02992 | 114 | PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidas | 94.05 | |
| PRK10382 | 187 | alkyl hydroperoxide reductase subunit C; Provision | 94.04 | |
| PF07449 | 107 | HyaE: Hydrogenase-1 expression protein HyaE; Inter | 93.75 | |
| cd03020 | 197 | DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamil | 93.69 | |
| cd02066 | 72 | GRX_family Glutaredoxin (GRX) family; composed of | 93.57 | |
| KOG3425 | 128 | consensus Uncharacterized conserved protein [Funct | 93.49 | |
| cd02972 | 98 | DsbA_family DsbA family; consists of DsbA and DsbA | 93.43 | |
| cd03419 | 82 | GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h | 93.41 | |
| PTZ00051 | 98 | thioredoxin; Provisional | 93.35 | |
| PRK10877 | 232 | protein disulfide isomerase II DsbC; Provisional | 93.3 | |
| KOG2640 | 319 | consensus Thioredoxin [Function unknown] | 93.07 | |
| COG1076 | 174 | DjlA DnaJ-domain-containing proteins 1 [Posttransl | 92.83 | |
| TIGR03140 | 515 | AhpF alkyl hydroperoxide reductase, F subunit. Thi | 92.68 | |
| PF01216 | 383 | Calsequestrin: Calsequestrin; InterPro: IPR001393 | 92.55 | |
| PF00462 | 60 | Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl | 92.29 | |
| TIGR02183 | 86 | GRXA Glutaredoxin, GrxA family. This model include | 92.27 | |
| TIGR01295 | 122 | PedC_BrcD bacteriocin transport accessory protein, | 92.19 | |
| PRK15000 | 200 | peroxidase; Provisional | 91.85 | |
| cd02952 | 119 | TRP14_like Human TRX-related protein 14 (TRP14)-li | 91.66 | |
| TIGR02190 | 79 | GlrX-dom Glutaredoxin-family domain. This C-termin | 91.58 | |
| PF03190 | 163 | Thioredox_DsbH: Protein of unknown function, DUF25 | 91.45 | |
| PRK13190 | 202 | putative peroxiredoxin; Provisional | 91.04 | |
| PTZ00253 | 199 | tryparedoxin peroxidase; Provisional | 90.98 | |
| cd03074 | 120 | PDI_b'_Calsequestrin_C Protein Disulfide Isomerase | 90.97 | |
| cd03023 | 154 | DsbA_Com1_like DsbA family, Com1-like subfamily; c | 90.9 | |
| cd03066 | 102 | PDI_b_Calsequestrin_middle PDIb family, Calsequest | 90.5 | |
| PRK10329 | 81 | glutaredoxin-like protein; Provisional | 89.99 | |
| PF14595 | 129 | Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A. | 89.8 | |
| COG2143 | 182 | Thioredoxin-related protein [Posttranslational mod | 89.73 | |
| cd03019 | 178 | DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a m | 89.61 | |
| cd03069 | 104 | PDI_b_ERp57 PDIb family, ERp57 subfamily, first re | 89.34 | |
| PRK13599 | 215 | putative peroxiredoxin; Provisional | 89.31 | |
| KOG0431 | 453 | consensus Auxilin-like protein and related protein | 89.22 | |
| PF13098 | 112 | Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_ | 89.2 | |
| cd03016 | 203 | PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX sub | 89.18 | |
| PF02114 | 265 | Phosducin: Phosducin; InterPro: IPR024253 The oute | 89.07 | |
| KOG3414 | 142 | consensus Component of the U4/U6.U5 snRNP/mitosis | 88.76 | |
| cd02958 | 114 | UAS UAS family; UAS is a domain of unknown functio | 88.26 | |
| COG1076 | 174 | DjlA DnaJ-domain-containing proteins 1 [Posttransl | 87.8 | |
| PRK00293 | 571 | dipZ thiol:disulfide interchange protein precursor | 87.73 | |
| TIGR02740 | 271 | TraF-like TraF-like protein. This protein is relat | 87.45 | |
| cd03067 | 112 | PDI_b_PDIR_N PDIb family, PDIR subfamily, N-termin | 87.44 | |
| PRK15317 | 517 | alkyl hydroperoxide reductase subunit F; Provision | 87.34 | |
| PF07449 | 107 | HyaE: Hydrogenase-1 expression protein HyaE; Inter | 87.11 | |
| PRK03147 | 173 | thiol-disulfide oxidoreductase; Provisional | 86.31 | |
| cd03029 | 72 | GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb | 86.22 | |
| TIGR02194 | 72 | GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red | 85.92 | |
| PRK13189 | 222 | peroxiredoxin; Provisional | 85.83 | |
| TIGR02181 | 79 | GRX_bact Glutaredoxin, GrxC family. This family of | 85.62 | |
| PTZ00062 | 204 | glutaredoxin; Provisional | 85.47 | |
| cd03418 | 75 | GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b | 84.67 | |
| cd03027 | 73 | GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg | 83.98 | |
| PF03656 | 127 | Pam16: Pam16; InterPro: IPR005341 The Pam16 protei | 83.5 | |
| PTZ00137 | 261 | 2-Cys peroxiredoxin; Provisional | 82.89 | |
| TIGR03140 | 515 | AhpF alkyl hydroperoxide reductase, F subunit. Thi | 82.15 | |
| PRK10954 | 207 | periplasmic protein disulfide isomerase I; Provisi | 82.09 | |
| cd03071 | 116 | PDI_b'_NRX PDIb' family, NRX subgroup, redox inact | 81.98 | |
| PF05768 | 81 | DUF836: Glutaredoxin-like domain (DUF836); InterPr | 81.14 | |
| PRK10638 | 83 | glutaredoxin 3; Provisional | 80.39 |
| >KOG0190 consensus Protein disulfide isomerase (prolyl 4-hydroxylase beta subunit) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.3e-36 Score=333.98 Aligned_cols=334 Identities=19% Similarity=0.276 Sum_probs=258.2
Q ss_pred cceEEEecCCCCcccccCCCcEEEEEeccCCCCCCCcchHHHHHHHHhhcc---cceeeeeccchhhhhHHHHhCCCCcc
Q 005374 135 VHAFNVVTSEDFPSIFHDSKPWLIQVYSDGSYLCGQFSGAWKTIAALLEGI---ANTGMVELGDIRLATHLAERKPIGQI 211 (699)
Q Consensus 135 ~~~V~~Lt~~nF~~~v~~~~~~lV~FYapwC~hCk~l~p~~~~~A~~L~g~---~~va~Vdc~~~~~~~~L~~k~~i~~~ 211 (699)
...|++||.+||+..|..+..+||+|||||||||++++|+|+++|+.|+.. +.+|+|||+++. .+|++|+
T Consensus 24 ~~~Vl~Lt~dnf~~~i~~~~~vlVeFYAPWCghck~LaPey~kAA~~Lke~~s~i~LakVDat~~~---~~~~~y~---- 96 (493)
T KOG0190|consen 24 EEDVLVLTKDNFKETINGHEFVLVEFYAPWCGHCKALAPEYEKAATELKEEGSPVKLAKVDATEES---DLASKYE---- 96 (493)
T ss_pred ccceEEEecccHHHHhccCceEEEEEEchhhhhhhhhCcHHHHHHHHhhccCCCceeEEeecchhh---hhHhhhc----
Confidence 446999999999999999999999999999999999999999999999874 489999999664 4999998
Q ss_pred cccccccEEEEcCCCCCCCCccccccCCcCHHHHHHHHHHHhccCCcceecccchhhhhhhhhcCCCcEEEEEEcCCCCC
Q 005374 212 FFRRGLPSLVAFPPGCKSSDCMTRFEGELSVDAVTDWFATAILKLPRIFYYTKESMGKNFLAKTGPHKVKVIFFSKTGER 291 (699)
Q Consensus 212 f~V~gyPTl~~f~~g~~~~~~~~~Y~G~rs~~~Iv~fi~k~v~~lP~~~~it~~~~~~~Fl~~~~~~~v~vl~f~~~~~~ 291 (699)
|+|||||++|++|.. +..|+|+|++++|+.|++++ .+|+...+.+.+.++.|+.+. +.+.+.+|.+.. .
T Consensus 97 --v~gyPTlkiFrnG~~----~~~Y~G~r~adgIv~wl~kq--~gPa~~~l~~~~~a~~~l~~~--~~~vig~F~d~~-~ 165 (493)
T KOG0190|consen 97 --VRGYPTLKIFRNGRS----AQDYNGPREADGIVKWLKKQ--SGPASKTLKTVDEAEEFLSKK--DVVVIGFFKDLE-S 165 (493)
T ss_pred --CCCCCeEEEEecCCc----ceeccCcccHHHHHHHHHhc--cCCCceecccHHHHHhhccCC--ceEEEEEecccc-c
Confidence 779999999999974 47999999999999999999 689888887777788888762 333344554332 2
Q ss_pred chHHHHHHHHhccCCceEEEEEccccccHhHHhhcCCCC--CCEEEEEcCCCCCceeecCCCChhHHHHHHHHhhccccc
Q 005374 292 ASPFVRQISRNYWAYASFAFVLWREEESSIWWNTFEVES--APAIVFLKDPGVKPVVYYGSFNNSRLSEVMEQNKLQGLY 369 (699)
Q Consensus 292 ~~~~~~~~A~~~~~~~~Fg~V~~~~~~s~~l~~kf~V~~--~PtIvlfk~~~~~pv~y~g~~~~~~L~~fi~~~~~~~~~ 369 (699)
....+...|..+++.+.|++.. ..++++++++.. .+.+++++.++...+.|.|+++.+.|.+||..+++|
T Consensus 166 ~~~~~~~~a~~l~~d~~F~~ts-----~~~~~~~~~~~~~~~~~i~l~kk~d~~~~~~~~~~~~~~l~~Fi~~~~~p--- 237 (493)
T KOG0190|consen 166 LAESFFDAASKLRDDYKFAHTS-----DSDVAKKLELNTEGTFPIVLFKKFDELLVKYDGSFTPELLKKFIQENSLP--- 237 (493)
T ss_pred chHHHHHHHHhccccceeeccC-----cHhHHhhccCCCCCcceEEeccccccchhhcccccCHHHHHHHHHHhccc---
Confidence 2344445666678888998432 467899999853 566999999988888888999999999999999999
Q ss_pred cCCccccccccccchhhhhhccCcCCCCCCCCCccceEEEEEec-cCChhHHHHHHHHHHHHHhhccCcccccccccccc
Q 005374 370 FCGTCVSELPQLRSVTSMELGCDARGYSRAGSDTTIWYCVILAG-RLSPELNKMRETIRRVQETLLSDDESNAADTDQSL 448 (699)
Q Consensus 370 ~~~~~~~~vp~Lts~s~~~~~c~~~~~~~~~~~~~~~lCvI~~~-~~~~~~~~~~~~lr~~a~~l~~~~~~~~~~~~~~~ 448 (699)
.+..+|.++.....- +. +.+-++++. ......+.+++.++++|+
T Consensus 238 -------lv~~ft~~~~~~~~~-------~~----~~~~~~~~~~~~~~~~e~~~~~~~~vAk----------------- 282 (493)
T KOG0190|consen 238 -------LVTEFTVANNAKIYS-------SF----VKLGLDFFVFFKCNRFEELRKKFEEVAK----------------- 282 (493)
T ss_pred -------ccceecccccceeec-------cc----cccceeEEeccccccHHHHHHHHHHHHH-----------------
Confidence 788887755543221 11 234555554 234478999999999999
Q ss_pred hhHHHhcCCCeEEEEEEeCcchHHHHHHhccccccccccCCcCCCCCCC-eEEEEEeecCCccccceeeccccccccccc
Q 005374 449 APAAVAFRNKRLTFAWLDGEAQDRYCSFYLFSETSFETCGARRDMSDVP-RLFIVRYKRNTTEDEAKIERKPRNIWDAMQ 527 (699)
Q Consensus 449 ~~~a~~~k~~~l~F~wvd~~~q~~f~~~fl~~~~~~~~c~~~~~~~~~p-~lvI~~~rr~~~~~~~~~~~~~~~~l~~~~ 527 (699)
+|+++ ++|+++|.+..+..+++|-..+.. .| ++++. +.+. .+|. + +
T Consensus 283 -----~f~~~-l~Fi~~d~e~~~~~~~~~Gl~~~~------------~~~~~v~~----~~~~--~Ky~------~---~ 329 (493)
T KOG0190|consen 283 -----KFKGK-LRFILIDPESFARVLEFFGLEEEQ------------LPIRAVIL----NEDG--SKYP------L---E 329 (493)
T ss_pred -----hcccc-eEEEEEChHHhhHHHHhcCccccc------------CCeeEEee----cccc--cccc------C---c
Confidence 89985 999999998888888888333211 14 55555 6655 5777 4 4
Q ss_pred cccCCccccchhccCCCCChHHHHHHHHHHhcCCCCCCCCcccCCCCCCCC
Q 005374 528 EQEVDPASQLVVRYNGSDEIPQIAKWVSEIIQDGDSKDLPFYRAKTPELVP 578 (699)
Q Consensus 528 ~~~~~~~~~~~~~~~g~~~~~~i~~~i~~~~~~g~~~~l~~~~~~~p~l~~ 578 (699)
+++. +...|+.|+.+++. +.....++++++|+=++
T Consensus 330 ~e~~--------------~~~~ie~f~~~~l~--Gk~~p~~kSqpiPe~~~ 364 (493)
T KOG0190|consen 330 EEEL--------------DQENIESFVKDFLD--GKVKPHLKSQPIPEDND 364 (493)
T ss_pred cccc--------------cHHHHHHHHHHHhc--CccccccccCCCCcccc
Confidence 4433 22469999999998 55566668999998776
|
|
| >KOG4277 consensus Uncharacterized conserved protein, contains thioredoxin domain [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic | Back alignment and domain information |
|---|
| >PTZ00102 disulphide isomerase; Provisional | Back alignment and domain information |
|---|
| >KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0912 consensus Thiol-disulfide isomerase and thioredoxin [Posttranslational modification, protein turnover, chaperones; Energy production and conversion] | Back alignment and domain information |
|---|
| >cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox | Back alignment and domain information |
|---|
| >COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0191 consensus Thioredoxin/protein disulfide isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains | Back alignment and domain information |
|---|
| >cd03007 PDI_a_ERp29_N PDIa family, endoplasmic reticulum protein 29 (ERp29) subfamily; ERp29 is a ubiquitous ER-resident protein expressed in high levels in secretory cells | Back alignment and domain information |
|---|
| >PF01216 Calsequestrin: Calsequestrin; InterPro: IPR001393 Calsequestrin is the principal calcium-binding protein present in the sarcoplasmic reticulum of cardiac and skeletal muscle [] | Back alignment and domain information |
|---|
| >cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention | Back alignment and domain information |
|---|
| >cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains | Back alignment and domain information |
|---|
| >KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms | Back alignment and domain information |
|---|
| >cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein | Back alignment and domain information |
|---|
| >cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX | Back alignment and domain information |
|---|
| >cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) | Back alignment and domain information |
|---|
| >cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases | Back alignment and domain information |
|---|
| >cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle | Back alignment and domain information |
|---|
| >KOG0190 consensus Protein disulfide isomerase (prolyl 4-hydroxylase beta subunit) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains | Back alignment and domain information |
|---|
| >cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 | Back alignment and domain information |
|---|
| >PRK14288 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain | Back alignment and domain information |
|---|
| >PTZ00443 Thioredoxin domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PRK14296 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG1731 consensus FAD-dependent sulfhydryl oxidase/quiescin and related proteins [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR01126 pdi_dom protein disulfide-isomerase domain | Back alignment and domain information |
|---|
| >cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) | Back alignment and domain information |
|---|
| >PTZ00037 DnaJ_C chaperone protein; Provisional | Back alignment and domain information |
|---|
| >cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain | Back alignment and domain information |
|---|
| >KOG0910 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 | Back alignment and domain information |
|---|
| >cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 | Back alignment and domain information |
|---|
| >PRK14279 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14286 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14287 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >TIGR02187 GlrX_arch Glutaredoxin-like domain protein | Back alignment and domain information |
|---|
| >cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein | Back alignment and domain information |
|---|
| >PRK14298 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14276 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >TIGR00424 APS_reduc 5'-adenylylsulfate reductase, thioredoxin-independent | Back alignment and domain information |
|---|
| >PRK14283 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14282 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK09381 trxA thioredoxin; Provisional | Back alignment and domain information |
|---|
| >COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14285 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14278 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14299 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14280 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14291 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14297 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14294 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14277 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants | Back alignment and domain information |
|---|
| >PRK14301 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus | Back alignment and domain information |
|---|
| >PLN02309 5'-adenylylsulfate reductase | Back alignment and domain information |
|---|
| >PRK14284 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] | Back alignment and domain information |
|---|
| >PRK14281 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14295 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PHA02278 thioredoxin-like protein | Back alignment and domain information |
|---|
| >PRK10767 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14290 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14300 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK10996 thioredoxin 2; Provisional | Back alignment and domain information |
|---|
| >TIGR02349 DnaJ_bact chaperone protein DnaJ | Back alignment and domain information |
|---|
| >KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14292 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PRK14293 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >PTZ00341 Ring-infected erythrocyte surface antigen; Provisional | Back alignment and domain information |
|---|
| >cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library | Back alignment and domain information |
|---|
| >KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13848 Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_B 3BOA_A 2B5E_A 1BJX_A 2K18_A 3UEM_A 3BJ5_A 2BJX_A 2R2J_A 2L4C_A | Back alignment and domain information |
|---|
| >cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif | Back alignment and domain information |
|---|
| >PRK14289 chaperone protein DnaJ; Provisional | Back alignment and domain information |
|---|
| >KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01068 thioredoxin thioredoxin | Back alignment and domain information |
|---|
| >PRK10266 curved DNA-binding protein CbpA; Provisional | Back alignment and domain information |
|---|
| >KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions | Back alignment and domain information |
|---|
| >cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO | Back alignment and domain information |
|---|
| >PTZ00102 disulphide isomerase; Provisional | Back alignment and domain information |
|---|
| >cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein | Back alignment and domain information |
|---|
| >KOG0191 consensus Thioredoxin/protein disulfide isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein | Back alignment and domain information |
|---|
| >smart00271 DnaJ DnaJ molecular chaperone homology domain | Back alignment and domain information |
|---|
| >KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd06257 DnaJ DnaJ domain or J-domain | Back alignment and domain information |
|---|
| >PHA03102 Small T antigen; Reviewed | Back alignment and domain information |
|---|
| >cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif | Back alignment and domain information |
|---|
| >cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus | Back alignment and domain information |
|---|
| >TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic | Back alignment and domain information |
|---|
| >TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ | Back alignment and domain information |
|---|
| >cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains | Back alignment and domain information |
|---|
| >cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes | Back alignment and domain information |
|---|
| >PTZ00051 thioredoxin; Provisional | Back alignment and domain information |
|---|
| >cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains | Back alignment and domain information |
|---|
| >COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0907 consensus Thioredoxin [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN00410 U5 snRNP protein, DIM1 family; Provisional | Back alignment and domain information |
|---|
| >cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding | Back alignment and domain information |
|---|
| >cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions | Back alignment and domain information |
|---|
| >TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative | Back alignment and domain information |
|---|
| >cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants | Back alignment and domain information |
|---|
| >PRK01356 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK05014 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >cd02986 DLP Dim1 family, Dim1-like protein (DLP) subfamily; DLP is a novel protein which shares 38% sequence identity to Dim1 | Back alignment and domain information |
|---|
| >TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 | Back alignment and domain information |
|---|
| >cd02983 P5_C P5 family, C-terminal redox inactive TRX-like domain; P5 is a protein disulfide isomerase (PDI)-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) | Back alignment and domain information |
|---|
| >cd02988 Phd_like_VIAF Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis | Back alignment and domain information |
|---|
| >COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK03578 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK00294 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PTZ00100 DnaJ chaperone protein; Provisional | Back alignment and domain information |
|---|
| >KOG0908 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation | Back alignment and domain information |
|---|
| >KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13848 Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_B 3BOA_A 2B5E_A 1BJX_A 2K18_A 3UEM_A 3BJ5_A 2BJX_A 2R2J_A 2L4C_A | Back alignment and domain information |
|---|
| >PTZ00062 glutaredoxin; Provisional | Back alignment and domain information |
|---|
| >cd02952 TRP14_like Human TRX-related protein 14 (TRP14)-like family; composed of proteins similar to TRP14, a 14kD cytosolic protein that shows disulfide reductase activity in vitro with a different substrate specificity compared with another human cytosolic protein, TRX1 | Back alignment and domain information |
|---|
| >PHA02624 large T antigen; Provisional | Back alignment and domain information |
|---|
| >PRK09430 djlA Dna-J like membrane chaperone protein; Provisional | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02187 GlrX_arch Glutaredoxin-like domain protein | Back alignment and domain information |
|---|
| >PHA02125 thioredoxin-like protein | Back alignment and domain information |
|---|
| >KOG0913 consensus Thiol-disulfide isomerase and thioredoxin [Posttranslational modification, protein turnover, chaperones; Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR00412 redox_disulf_2 small redox-active disulfide protein 2 | Back alignment and domain information |
|---|
| >cd02959 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; ERp19 is also known as ERp18, a protein located in the ER containing one redox active TRX domain | Back alignment and domain information |
|---|
| >PRK00293 dipZ thiol:disulfide interchange protein precursor; Provisional | Back alignment and domain information |
|---|
| >PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A | Back alignment and domain information |
|---|
| >KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK01773 hscB co-chaperone HscB; Provisional | Back alignment and domain information |
|---|
| >PRK03147 thiol-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) | Back alignment and domain information |
|---|
| >TIGR02740 TraF-like TraF-like protein | Back alignment and domain information |
|---|
| >TIGR00714 hscB Fe-S protein assembly co-chaperone HscB | Back alignment and domain information |
|---|
| >cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif | Back alignment and domain information |
|---|
| >KOG0914 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02955 SSP411 TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif | Back alignment and domain information |
|---|
| >TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | Back alignment and domain information |
|---|
| >cd03009 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, TryX and nucleoredoxin (NRX) subfamily; TryX and NRX are thioredoxin (TRX)-like protein disulfide oxidoreductases that alter the redox state of target proteins via the reversible oxidation of an active center CXXC motif | Back alignment and domain information |
|---|
| >PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional | Back alignment and domain information |
|---|
| >COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11509 hydrogenase-1 operon protein HyaE; Provisional | Back alignment and domain information |
|---|
| >cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins | Back alignment and domain information |
|---|
| >cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides | Back alignment and domain information |
|---|
| >cd03007 PDI_a_ERp29_N PDIa family, endoplasmic reticulum protein 29 (ERp29) subfamily; ERp29 is a ubiquitous ER-resident protein expressed in high levels in secretory cells | Back alignment and domain information |
|---|
| >cd02967 mauD Methylamine utilization (mau) D family; mauD protein is the translation product of the mauD gene found in methylotrophic bacteria, which are able to use methylamine as a sole carbon source and a nitrogen source | Back alignment and domain information |
|---|
| >cd03010 TlpA_like_DsbE TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif | Back alignment and domain information |
|---|
| >cd02964 TryX_like_family Tryparedoxin (TryX)-like family; composed of TryX and related proteins including nucleoredoxin (NRX), rod-derived cone viability factor (RdCVF) and the nematode homolog described as a 16-kD class of TRX | Back alignment and domain information |
|---|
| >cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle | Back alignment and domain information |
|---|
| >PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms | Back alignment and domain information |
|---|
| >TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily | Back alignment and domain information |
|---|
| >PRK15412 thiol:disulfide interchange protein DsbE; Provisional | Back alignment and domain information |
|---|
| >cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains | Back alignment and domain information |
|---|
| >cd02981 PDI_b_family Protein Disulfide Isomerase (PDIb) family, redox inactive TRX-like domain b; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants | Back alignment and domain information |
|---|
| >KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02958 UAS UAS family; UAS is a domain of unknown function | Back alignment and domain information |
|---|
| >KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03008 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors | Back alignment and domain information |
|---|
| >cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox | Back alignment and domain information |
|---|
| >cd03066 PDI_b_Calsequestrin_middle PDIb family, Calsequestrin subfamily, Middle TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle | Back alignment and domain information |
|---|
| >cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein | Back alignment and domain information |
|---|
| >PRK13728 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >cd03069 PDI_b_ERp57 PDIb family, ERp57 subfamily, first redox inactive TRX-like domain b; ERp57 (or ERp60) exhibits both disulfide oxidase and reductase functions like PDI, by catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER and acting as isomerases to correct any non-native disulfide bonds | Back alignment and domain information |
|---|
| >PF13905 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_A 1OC8_B 1O6J_A 1OC9_B 1O81_A 3FKF_A 1O85_A 1O7U_A 1O8W_A | Back alignment and domain information |
|---|
| >cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold | Back alignment and domain information |
|---|
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains | Back alignment and domain information |
|---|
| >COG4232 Thiol:disulfide interchange protein [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] | Back alignment and domain information |
|---|
| >PF13899 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_A 1UC7_A 2JU5_A 1VRS_D 2FWG_A 2FWF_A 2FWH_A 2FWE_A 3FK8_A | Back alignment and domain information |
|---|
| >cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention | Back alignment and domain information |
|---|
| >cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) | Back alignment and domain information |
|---|
| >TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family | Back alignment and domain information |
|---|
| >COG0526 TrxA Thiol-disulfide isomerase and thioredoxins [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] | Back alignment and domain information |
|---|
| >cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases | Back alignment and domain information |
|---|
| >TIGR01126 pdi_dom protein disulfide-isomerase domain | Back alignment and domain information |
|---|
| >cd03012 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain | Back alignment and domain information |
|---|
| >PLN02399 phospholipid hydroperoxide glutathione peroxidase | Back alignment and domain information |
|---|
| >TIGR02661 MauD methylamine dehydrogenase accessory protein MauD | Back alignment and domain information |
|---|
| >cd03073 PDI_b'_ERp72_ERp57 PDIb' family, ERp72 and ERp57 subfamily, second redox inactive TRX-like domain b'; ERp72 and ER57 are involved in oxidative protein folding in the ER, like PDI | Back alignment and domain information |
|---|
| >COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00424 APS_reduc 5'-adenylylsulfate reductase, thioredoxin-independent | Back alignment and domain information |
|---|
| >smart00594 UAS UAS domain | Back alignment and domain information |
|---|
| >PRK11509 hydrogenase-1 operon protein HyaE; Provisional | Back alignment and domain information |
|---|
| >PF07912 ERp29_N: ERp29, N-terminal domain; InterPro: IPR012883 ERp29 (P52555 from SWISSPROT) is a ubiquitously expressed endoplasmic reticulum protein, and is involved in the processes of protein maturation and protein secretion in this organelle [, ] | Back alignment and domain information |
|---|
| >PTZ00056 glutathione peroxidase; Provisional | Back alignment and domain information |
|---|
| >cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants | Back alignment and domain information |
|---|
| >cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain | Back alignment and domain information |
|---|
| >PF13192 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZYN_A 1HYU_A 1ILO_A 1J08_F 2YWM_B 2AYT_B 2HLS_B 1A8L_A 2K8S_B | Back alignment and domain information |
|---|
| >cd02981 PDI_b_family Protein Disulfide Isomerase (PDIb) family, redox inactive TRX-like domain b; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants | Back alignment and domain information |
|---|
| >cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO | Back alignment and domain information |
|---|
| >cd03068 PDI_b_ERp72 PDIb family, ERp72 subfamily, first redox inactive TRX-like domain b; ERp72 exhibits both disulfide oxidase and reductase functions like PDI, by catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER and acting as isomerases to correct any non-native disulfide bonds | Back alignment and domain information |
|---|
| >cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 | Back alignment and domain information |
|---|
| >PLN02412 probable glutathione peroxidase | Back alignment and domain information |
|---|
| >cd02960 AGR Anterior Gradient (AGR) family; members of this family are similar to secreted proteins encoded by the cement gland-specific genes XAG-1 and XAG-2, expressed in the anterior region of dorsal ectoderm of Xenopus | Back alignment and domain information |
|---|
| >cd03072 PDI_b'_ERp44 PDIb' family, ERp44 subfamily, second redox inactive TRX-like domain b'; ERp44 is an endoplasmic reticulum (ER)-resident protein, induced during stress, involved in thiol-mediated ER retention | Back alignment and domain information |
|---|
| >cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 | Back alignment and domain information |
|---|
| >cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 | Back alignment and domain information |
|---|
| >TIGR02540 gpx7 putative glutathione peroxidase Gpx7 | Back alignment and domain information |
|---|
| >PLN02309 5'-adenylylsulfate reductase | Back alignment and domain information |
|---|
| >cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX | Back alignment and domain information |
|---|
| >TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit | Back alignment and domain information |
|---|
| >KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02200 GlrX_actino Glutaredoxin-like protein | Back alignment and domain information |
|---|
| >cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains | Back alignment and domain information |
|---|
| >cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants | Back alignment and domain information |
|---|
| >cd00340 GSH_Peroxidase Glutathione (GSH) peroxidase family; tetrameric selenoenzymes that catalyze the reduction of a variety of hydroperoxides including lipid peroxidases, using GSH as a specific electron donor substrate | Back alignment and domain information |
|---|
| >cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) | Back alignment and domain information |
|---|
| >TIGR01068 thioredoxin thioredoxin | Back alignment and domain information |
|---|
| >cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain | Back alignment and domain information |
|---|
| >cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD | Back alignment and domain information |
|---|
| >PF13728 TraF: F plasmid transfer operon protein | Back alignment and domain information |
|---|
| >KOG0910 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03067 PDI_b_PDIR_N PDIb family, PDIR subfamily, N-terminal TRX-like b domain; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) | Back alignment and domain information |
|---|
| >PF08534 Redoxin: Redoxin; InterPro: IPR013740 This redoxin domain is found in peroxiredoxin, thioredoxin and glutaredoxin proteins | Back alignment and domain information |
|---|
| >PRK09381 trxA thioredoxin; Provisional | Back alignment and domain information |
|---|
| >cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus | Back alignment and domain information |
|---|
| >cd02983 P5_C P5 family, C-terminal redox inactive TRX-like domain; P5 is a protein disulfide isomerase (PDI)-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) | Back alignment and domain information |
|---|
| >PF02114 Phosducin: Phosducin; InterPro: IPR024253 The outer and inner segments of vertebrate rod photoreceptor cells contain phosducin, a soluble phosphoprotein that complexes with the beta/gamma-subunits of the GTP-binding protein, transducin | Back alignment and domain information |
|---|
| >cd02969 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs | Back alignment and domain information |
|---|
| >PRK10996 thioredoxin 2; Provisional | Back alignment and domain information |
|---|
| >PTZ00443 Thioredoxin domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >KOG4277 consensus Uncharacterized conserved protein, contains thioredoxin domain [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02180 GRX_euk Glutaredoxin | Back alignment and domain information |
|---|
| >cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif | Back alignment and domain information |
|---|
| >PHA02278 thioredoxin-like protein | Back alignment and domain information |
|---|
| >cd03072 PDI_b'_ERp44 PDIb' family, ERp44 subfamily, second redox inactive TRX-like domain b'; ERp44 is an endoplasmic reticulum (ER)-resident protein, induced during stress, involved in thiol-mediated ER retention | Back alignment and domain information |
|---|
| >cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus | Back alignment and domain information |
|---|
| >cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein | Back alignment and domain information |
|---|
| >cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein | Back alignment and domain information |
|---|
| >cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains | Back alignment and domain information |
|---|
| >cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions | Back alignment and domain information |
|---|
| >cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding | Back alignment and domain information |
|---|
| >cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif | Back alignment and domain information |
|---|
| >TIGR02739 TraF type-F conjugative transfer system pilin assembly protein TraF | Back alignment and domain information |
|---|
| >PF07912 ERp29_N: ERp29, N-terminal domain; InterPro: IPR012883 ERp29 (P52555 from SWISSPROT) is a ubiquitously expressed endoplasmic reticulum protein, and is involved in the processes of protein maturation and protein secretion in this organelle [, ] | Back alignment and domain information |
|---|
| >KOG2603 consensus Oligosaccharyltransferase, gamma subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00578 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Peroxiredoxins (Prxs) are a ubiquitous family of antioxidant enzymes that also control cytokine-induced peroxide levels which mediate signal transduction in mammalian cells | Back alignment and domain information |
|---|
| >KOG0907 consensus Thioredoxin [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions | Back alignment and domain information |
|---|
| >KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0912 consensus Thiol-disulfide isomerase and thioredoxin [Posttranslational modification, protein turnover, chaperones; Energy production and conversion] | Back alignment and domain information |
|---|
| >PTZ00256 glutathione peroxidase; Provisional | Back alignment and domain information |
|---|
| >cd03017 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides | Back alignment and domain information |
|---|
| >cd03015 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides | Back alignment and domain information |
|---|
| >cd02986 DLP Dim1 family, Dim1-like protein (DLP) subfamily; DLP is a novel protein which shares 38% sequence identity to Dim1 | Back alignment and domain information |
|---|
| >PRK13703 conjugal pilus assembly protein TraF; Provisional | Back alignment and domain information |
|---|
| >cd02991 UAS_ETEA UAS family, ETEA subfamily; composed of proteins similar to human ETEA protein, the translation product of a highly expressed gene in the T-cells and eosinophils of atopic dermatitis patients compared with those of normal individuals | Back alignment and domain information |
|---|
| >PRK10606 btuE putative glutathione peroxidase; Provisional | Back alignment and domain information |
|---|
| >cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes | Back alignment and domain information |
|---|
| >TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit | Back alignment and domain information |
|---|
| >TIGR03137 AhpC peroxiredoxin | Back alignment and domain information |
|---|
| >TIGR01626 ytfJ_HI0045 conserved hypothetical protein YtfJ-family, TIGR01626 | Back alignment and domain information |
|---|
| >PLN00410 U5 snRNP protein, DIM1 family; Provisional | Back alignment and domain information |
|---|
| >KOG2501 consensus Thioredoxin, nucleoredoxin and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11200 grxA glutaredoxin 1; Provisional | Back alignment and domain information |
|---|
| >PRK00522 tpx lipid hydroperoxide peroxidase; Provisional | Back alignment and domain information |
|---|
| >cd02970 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypothetical proteins that show sequence similarity to PRXs | Back alignment and domain information |
|---|
| >cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains | Back alignment and domain information |
|---|
| >PRK09437 bcp thioredoxin-dependent thiol peroxidase; Reviewed | Back alignment and domain information |
|---|
| >PRK15317 alkyl hydroperoxide reductase subunit F; Provisional | Back alignment and domain information |
|---|
| >cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation | Back alignment and domain information |
|---|
| >PF06110 DUF953: Eukaryotic protein of unknown function (DUF953); InterPro: IPR010357 This family consists of several hypothetical eukaryotic proteins of unknown function that are thioredoxin-like | Back alignment and domain information |
|---|
| >cd03014 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 2-cys PRX subfamily; composed of PRXs containing peroxidatic and resolving cysteines, similar to the homodimeric thiol specific antioxidant (TSA) protein also known as TRX-dependent thiol peroxidase (Tpx) | Back alignment and domain information |
|---|
| >cd03018 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-like subfamily; composed of proteins similar to Mycobacterium tuberculosis AhpE | Back alignment and domain information |
|---|
| >KOG1672 consensus ATP binding protein [Posttranslational modification, protein turnover, chaperones; Energy production and conversion] | Back alignment and domain information |
|---|
| >cd03073 PDI_b'_ERp72_ERp57 PDIb' family, ERp72 and ERp57 subfamily, second redox inactive TRX-like domain b'; ERp72 and ER57 are involved in oxidative protein folding in the ER, like PDI | Back alignment and domain information |
|---|
| >cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library | Back alignment and domain information |
|---|
| >TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 | Back alignment and domain information |
|---|
| >cd02968 SCO SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold | Back alignment and domain information |
|---|
| >cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile | Back alignment and domain information |
|---|
| >KOG0911 consensus Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02971 PRX_family Peroxiredoxin (PRX) family; composed of the different classes of PRXs including many proteins originally known as bacterioferritin comigratory proteins (BCP), based on their electrophoretic mobility before their function was identified | Back alignment and domain information |
|---|
| >cd02988 Phd_like_VIAF Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis | Back alignment and domain information |
|---|
| >cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein | Back alignment and domain information |
|---|
| >PRK10382 alkyl hydroperoxide reductase subunit C; Provisional | Back alignment and domain information |
|---|
| >PF07449 HyaE: Hydrogenase-1 expression protein HyaE; InterPro: IPR010893 This family contains bacterial hydrogenase-1 expression proteins approximately 120 residues long | Back alignment and domain information |
|---|
| >cd03020 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold | Back alignment and domain information |
|---|
| >cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >KOG3425 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >cd02972 DsbA_family DsbA family; consists of DsbA and DsbA-like proteins, including DsbC, DsbG, glutathione (GSH) S-transferase kappa (GSTK), 2-hydroxychromene-2-carboxylate (HCCA) isomerase, an oxidoreductase (FrnE) presumed to be involved in frenolicin biosynthesis, a 27-kDa outer membrane protein, and similar proteins | Back alignment and domain information |
|---|
| >cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >PTZ00051 thioredoxin; Provisional | Back alignment and domain information |
|---|
| >PRK10877 protein disulfide isomerase II DsbC; Provisional | Back alignment and domain information |
|---|
| >KOG2640 consensus Thioredoxin [Function unknown] | Back alignment and domain information |
|---|
| >COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit | Back alignment and domain information |
|---|
| >PF01216 Calsequestrin: Calsequestrin; InterPro: IPR001393 Calsequestrin is the principal calcium-binding protein present in the sarcoplasmic reticulum of cardiac and skeletal muscle [] | Back alignment and domain information |
|---|
| >PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors | Back alignment and domain information |
|---|
| >TIGR02183 GRXA Glutaredoxin, GrxA family | Back alignment and domain information |
|---|
| >TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative | Back alignment and domain information |
|---|
| >PRK15000 peroxidase; Provisional | Back alignment and domain information |
|---|
| >cd02952 TRP14_like Human TRX-related protein 14 (TRP14)-like family; composed of proteins similar to TRP14, a 14kD cytosolic protein that shows disulfide reductase activity in vitro with a different substrate specificity compared with another human cytosolic protein, TRX1 | Back alignment and domain information |
|---|
| >TIGR02190 GlrX-dom Glutaredoxin-family domain | Back alignment and domain information |
|---|
| >PF03190 Thioredox_DsbH: Protein of unknown function, DUF255; InterPro: IPR004879 This is a group of uncharacterised proteins | Back alignment and domain information |
|---|
| >PRK13190 putative peroxiredoxin; Provisional | Back alignment and domain information |
|---|
| >PTZ00253 tryparedoxin peroxidase; Provisional | Back alignment and domain information |
|---|
| >cd03074 PDI_b'_Calsequestrin_C Protein Disulfide Isomerase (PDIb') family, Calsequestrin subfamily, C-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle | Back alignment and domain information |
|---|
| >cd03023 DsbA_Com1_like DsbA family, Com1-like subfamily; composed of proteins similar to Com1, a 27-kDa outer membrane-associated immunoreactive protein originally found in both acute and chronic disease strains of the pathogenic bacteria Coxiella burnetti | Back alignment and domain information |
|---|
| >cd03066 PDI_b_Calsequestrin_middle PDIb family, Calsequestrin subfamily, Middle TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle | Back alignment and domain information |
|---|
| >PRK10329 glutaredoxin-like protein; Provisional | Back alignment and domain information |
|---|
| >PF14595 Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A | Back alignment and domain information |
|---|
| >COG2143 Thioredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03019 DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a monomeric thiol disulfide oxidoreductase protein containing a redox active CXXC motif imbedded in a TRX fold | Back alignment and domain information |
|---|
| >cd03069 PDI_b_ERp57 PDIb family, ERp57 subfamily, first redox inactive TRX-like domain b; ERp57 (or ERp60) exhibits both disulfide oxidase and reductase functions like PDI, by catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER and acting as isomerases to correct any non-native disulfide bonds | Back alignment and domain information |
|---|
| >PRK13599 putative peroxiredoxin; Provisional | Back alignment and domain information |
|---|
| >KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A | Back alignment and domain information |
|---|
| >cd03016 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine | Back alignment and domain information |
|---|
| >PF02114 Phosducin: Phosducin; InterPro: IPR024253 The outer and inner segments of vertebrate rod photoreceptor cells contain phosducin, a soluble phosphoprotein that complexes with the beta/gamma-subunits of the GTP-binding protein, transducin | Back alignment and domain information |
|---|
| >KOG3414 consensus Component of the U4/U6 | Back alignment and domain information |
|---|
| >cd02958 UAS UAS family; UAS is a domain of unknown function | Back alignment and domain information |
|---|
| >COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK00293 dipZ thiol:disulfide interchange protein precursor; Provisional | Back alignment and domain information |
|---|
| >TIGR02740 TraF-like TraF-like protein | Back alignment and domain information |
|---|
| >cd03067 PDI_b_PDIR_N PDIb family, PDIR subfamily, N-terminal TRX-like b domain; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) | Back alignment and domain information |
|---|
| >PRK15317 alkyl hydroperoxide reductase subunit F; Provisional | Back alignment and domain information |
|---|
| >PF07449 HyaE: Hydrogenase-1 expression protein HyaE; InterPro: IPR010893 This family contains bacterial hydrogenase-1 expression proteins approximately 120 residues long | Back alignment and domain information |
|---|
| >PRK03147 thiol-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria | Back alignment and domain information |
|---|
| >TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH | Back alignment and domain information |
|---|
| >PRK13189 peroxiredoxin; Provisional | Back alignment and domain information |
|---|
| >TIGR02181 GRX_bact Glutaredoxin, GrxC family | Back alignment and domain information |
|---|
| >PTZ00062 glutaredoxin; Provisional | Back alignment and domain information |
|---|
| >cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions | Back alignment and domain information |
|---|
| >PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] | Back alignment and domain information |
|---|
| >PTZ00137 2-Cys peroxiredoxin; Provisional | Back alignment and domain information |
|---|
| >TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit | Back alignment and domain information |
|---|
| >PRK10954 periplasmic protein disulfide isomerase I; Provisional | Back alignment and domain information |
|---|
| >cd03071 PDI_b'_NRX PDIb' family, NRX subgroup, redox inactive TRX-like domain b'; composed of vertebrate nucleoredoxins (NRX) | Back alignment and domain information |
|---|
| >PF05768 DUF836: Glutaredoxin-like domain (DUF836); InterPro: IPR008554 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors | Back alignment and domain information |
|---|
| >PRK10638 glutaredoxin 3; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 699 | ||||
| 3apq_A | 210 | Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt | 1e-11 | ||
| 3apo_A | 780 | Crystal Structure Of Full-Length Erdj5 Length = 780 | 1e-10 | ||
| 2o37_A | 92 | J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S | 8e-05 | ||
| 2lo1_A | 71 | Nmr Structure Of The Protein Bc008182, A Dnaj-Like | 1e-04 | ||
| 2och_A | 73 | J-domain Of Dnj-12 From Caenorhabditis Elegans Leng | 7e-04 |
| >pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 | Back alignment and structure |
|
| >pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 | Back alignment and structure |
| >pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 | Back alignment and structure |
| >pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 | Back alignment and structure |
| >pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 699 | |||
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 1e-19 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 4e-14 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 4e-10 | |
| 3t58_A | 519 | Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. | 2e-08 | |
| 2och_A | 73 | Hypothetical protein DNJ-12; HSP40, J-domain, chap | 5e-08 | |
| 2o37_A | 92 | Protein SIS1; HSP40, J-domain, cochaperone, APC900 | 7e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 8e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-06 | |
| 2lgw_A | 99 | DNAJ homolog subfamily B member 2; J domain, HSJ1A | 7e-07 | |
| 2dmx_A | 92 | DNAJ homolog subfamily B member 8; DNAJ J domain, | 7e-07 | |
| 2ej7_A | 82 | HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati | 9e-07 | |
| 2l6l_A | 155 | DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, | 1e-06 | |
| 2ctw_A | 109 | DNAJ homolog subfamily C member 5; J-domain, chape | 1e-06 | |
| 2qsa_A | 109 | DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s | 1e-06 | |
| 1hdj_A | 77 | Human HSP40, HDJ-1; molecular chaperone; NMR {Homo | 2e-06 | |
| 3us3_A | 367 | Calsequestrin-1; calcium-binding protein; 1.74A {O | 2e-06 | |
| 2yua_A | 99 | Williams-beuren syndrome chromosome region 18 prot | 3e-06 | |
| 1wjz_A | 94 | 1700030A21RIK protein; J-domain, DNAJ like protein | 5e-06 | |
| 2ctq_A | 112 | DNAJ homolog subfamily C member 12; J-domain, chap | 6e-06 | |
| 1bq0_A | 103 | DNAJ, HSP40; chaperone, heat shock, protein foldin | 2e-05 | |
| 2ctp_A | 78 | DNAJ homolog subfamily B member 12; J-domain, chap | 2e-05 | |
| 2cug_A | 88 | Mkiaa0962 protein; DNAJ-like domain, structural ge | 3e-05 | |
| 2r2j_A | 382 | Thioredoxin domain-containing protein 4; CRFS moti | 4e-05 | |
| 1gh6_A | 114 | Large T antigen; tumor suppressor, oncoprotein, an | 4e-05 | |
| 2ctr_A | 88 | DNAJ homolog subfamily B member 9; J-domain, chape | 5e-05 | |
| 3idv_A | 241 | Protein disulfide-isomerase A4; thioredoxin-like f | 6e-05 | |
| 2dn9_A | 79 | DNAJ homolog subfamily A member 3; J-domain, TID1, | 7e-05 | |
| 3q6o_A | 244 | Sulfhydryl oxidase 1; protein disulfide isomerase, | 1e-04 | |
| 2pf4_E | 174 | Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, | 2e-04 | |
| 2ys8_A | 90 | RAB-related GTP-binding protein RABJ; DNAJ domain, | 3e-04 | |
| 2b5e_A | 504 | Protein disulfide-isomerase; 2.40A {Saccharomyces | 5e-04 |
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 | Back alignment and structure |
|---|
Score = 87.2 bits (216), Expect = 1e-19
Identities = 47/213 (22%), Positives = 84/213 (39%), Gaps = 25/213 (11%)
Query: 40 YDALGIKPYSSVEQVKEAYEKFSSKW----NSGEEIPSTADFLKIQYAYELLTDPLWKRN 95
Y LG+ +S ++++A++K + K N + DFLKI AYE+L D ++
Sbjct: 5 YSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNP-NAHGDFLKINRAYEVLKDEDLRKK 63
Query: 96 YDVYGIDEQLHILEKVREQYGEESYSRIDLPLLDATDHSVHAFNVVTSEDFPSIFHDSKP 155
YD YG + + + G + S + +F + + +
Sbjct: 64 YDKYG-----E--KGLEDNQGGQYESWSYYRYDFGIYDDDPEIITLERREFDAAVNSGEL 116
Query: 156 WLIQVYSDGSYLCGQFSGAWKTIAALLEGIANTGMVELGDIRLATHLAERKPIGQIFFRR 215
W + YS G C + W+ A ++G+ G V GD R L K +
Sbjct: 117 WFVNFYSPGCSHCHDLAPTWREFAKEVDGLLRIGAVNCGDDR---MLCRMKGV------N 167
Query: 216 GLPSLVAFPPGCKSSDCMTRFEGELSVDAVTDW 248
PSL F G + ++ G+ S +++ +
Sbjct: 168 SYPSLFIFRSGMAA----VKYNGDRSKESLVAF 196
|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 | Back alignment and structure |
|---|
| >3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* Length = 519 | Back alignment and structure |
|---|
| >2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 | Back alignment and structure |
|---|
| >2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 | Back alignment and structure |
|---|
| >2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 | Back alignment and structure |
|---|
| >2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 | Back alignment and structure |
|---|
| >1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 | Back alignment and structure |
|---|
| >3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3trq_A* 3trp_A* 3uom_A Length = 367 | Back alignment and structure |
|---|
| >2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 | Back alignment and structure |
|---|
| >2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 | Back alignment and structure |
|---|
| >2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 | Back alignment and structure |
|---|
| >2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} Length = 382 | Back alignment and structure |
|---|
| >1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 | Back alignment and structure |
|---|
| >2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Length = 241 | Back alignment and structure |
|---|
| >2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} Length = 244 | Back alignment and structure |
|---|
| >2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 | Back alignment and structure |
|---|
| >2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Length = 504 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 699 | |||
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 100.0 | |
| 3us3_A | 367 | Calsequestrin-1; calcium-binding protein; 1.74A {O | 100.0 | |
| 1sji_A | 350 | Calsequestrin 2, calsequestrin, cardiac muscle iso | 100.0 | |
| 2r2j_A | 382 | Thioredoxin domain-containing protein 4; CRFS moti | 100.0 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 100.0 | |
| 3f8u_A | 481 | Protein disulfide-isomerase A3ERP57; endoplasmic r | 100.0 | |
| 2b5e_A | 504 | Protein disulfide-isomerase; 2.40A {Saccharomyces | 100.0 | |
| 3ed3_A | 298 | Protein disulfide-isomerase MPD1; thioredoxin-like | 99.94 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 99.93 | |
| 3idv_A | 241 | Protein disulfide-isomerase A4; thioredoxin-like f | 99.91 | |
| 3q6o_A | 244 | Sulfhydryl oxidase 1; protein disulfide isomerase, | 99.85 | |
| 3t58_A | 519 | Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. | 99.79 | |
| 2ywm_A | 229 | Glutaredoxin-like protein; redox protein, structur | 99.78 | |
| 1a8l_A | 226 | Protein disulfide oxidoreductase; PDI, thioredoxin | 99.76 | |
| 3uem_A | 361 | Protein disulfide-isomerase; thioredoxin-like doma | 99.76 | |
| 3h79_A | 127 | Thioredoxin-like protein; thioredoxin fold, cataly | 99.76 | |
| 2h8l_A | 252 | Protein disulfide-isomerase A3; thioredoxin-like f | 99.73 | |
| 3ec3_A | 250 | Protein disulfide-isomerase A4; thioredoxin-like f | 99.72 | |
| 2och_A | 73 | Hypothetical protein DNJ-12; HSP40, J-domain, chap | 99.71 | |
| 1hdj_A | 77 | Human HSP40, HDJ-1; molecular chaperone; NMR {Homo | 99.7 | |
| 2dml_A | 130 | Protein disulfide-isomerase A6; thioredoxin domain | 99.68 | |
| 2o37_A | 92 | Protein SIS1; HSP40, J-domain, cochaperone, APC900 | 99.67 | |
| 2ctp_A | 78 | DNAJ homolog subfamily B member 12; J-domain, chap | 99.67 | |
| 2dn9_A | 79 | DNAJ homolog subfamily A member 3; J-domain, TID1, | 99.66 | |
| 2ej7_A | 82 | HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati | 99.65 | |
| 3zzx_A | 105 | Thioredoxin; oxidoreductase; 1.88A {Litopenaeus va | 99.65 | |
| 2cug_A | 88 | Mkiaa0962 protein; DNAJ-like domain, structural ge | 99.65 | |
| 2ctr_A | 88 | DNAJ homolog subfamily B member 9; J-domain, chape | 99.64 | |
| 1x5d_A | 133 | Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC | 99.63 | |
| 2djj_A | 121 | PDI, protein disulfide-isomerase; thioredoxin fold | 99.62 | |
| 2voc_A | 112 | Thioredoxin; electron transport, homodimer, disulf | 99.62 | |
| 2dj1_A | 140 | Protein disulfide-isomerase A4; protein ERP-72, ER | 99.62 | |
| 3gnj_A | 111 | Thioredoxin domain protein; APC92103, STR genomics | 99.62 | |
| 2lgw_A | 99 | DNAJ homolog subfamily B member 2; J domain, HSJ1A | 99.62 | |
| 3uvt_A | 111 | Thioredoxin domain-containing protein 5; thioredox | 99.62 | |
| 1bq0_A | 103 | DNAJ, HSP40; chaperone, heat shock, protein foldin | 99.62 | |
| 3uem_A | 361 | Protein disulfide-isomerase; thioredoxin-like doma | 99.62 | |
| 2ctw_A | 109 | DNAJ homolog subfamily C member 5; J-domain, chape | 99.62 | |
| 3ga4_A | 178 | Dolichyl-diphosphooligosaccharide-protein glycosyl | 99.61 | |
| 2dj3_A | 133 | Protein disulfide-isomerase A4; protein ERP-72, ER | 99.61 | |
| 1mek_A | 120 | Protein disulfide isomerase; electron transport, r | 99.61 | |
| 2ctq_A | 112 | DNAJ homolog subfamily C member 12; J-domain, chap | 99.61 | |
| 2trx_A | 108 | Thioredoxin; electron transport; 1.68A {Escherichi | 99.6 | |
| 3tco_A | 109 | Thioredoxin (TRXA-1); disulfide oxidoreductase, ox | 99.6 | |
| 3die_A | 106 | Thioredoxin, TRX; electron transport, SWAP domain, | 99.6 | |
| 2dmx_A | 92 | DNAJ homolog subfamily B member 8; DNAJ J domain, | 99.6 | |
| 3p2a_A | 148 | Thioredoxin 2, putative thioredoxin-like protein; | 99.6 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 99.59 | |
| 2i4a_A | 107 | Thioredoxin; acidophIle, disulfide exchange, oxido | 99.59 | |
| 1t00_A | 112 | Thioredoxin, TRX; redox regulation, multifunction | 99.59 | |
| 1thx_A | 115 | Thioredoxin, thioredoxin 2; oxido-reductase, elect | 99.59 | |
| 1nsw_A | 105 | Thioredoxin, TRX; thermostability, electron transp | 99.59 | |
| 3aps_A | 122 | DNAJ homolog subfamily C member 10; thioredoxin fo | 99.58 | |
| 2yua_A | 99 | Williams-beuren syndrome chromosome region 18 prot | 99.58 | |
| 2e0q_A | 104 | Thioredoxin; electron transport; 1.49A {Sulfolobus | 99.58 | |
| 2o8v_B | 128 | Thioredoxin 1; disulfide crosslinked complex, oxid | 99.58 | |
| 4f9z_D | 227 | Endoplasmic reticulum resident protein 27; thiored | 99.58 | |
| 3hz4_A | 140 | Thioredoxin; NYSGXRC, PSI-II, reduced form, protei | 99.58 | |
| 2yzu_A | 109 | Thioredoxin; redox protein, electron transport, st | 99.57 | |
| 4euy_A | 105 | Uncharacterized protein; structural genomics, PSI- | 99.57 | |
| 1x5e_A | 126 | Thioredoxin domain containing protein 1; TMX, TXND | 99.57 | |
| 1wjz_A | 94 | 1700030A21RIK protein; J-domain, DNAJ like protein | 99.57 | |
| 3hxs_A | 141 | Thioredoxin, TRXP; electron transport; 2.00A {Bact | 99.57 | |
| 2qgv_A | 140 | Hydrogenase-1 operon protein HYAE; alpha-beta prot | 99.57 | |
| 2l5l_A | 136 | Thioredoxin; structural genomics, electron transpo | 99.56 | |
| 2ppt_A | 155 | Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc | 99.56 | |
| 2qsa_A | 109 | DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s | 99.56 | |
| 1fb6_A | 105 | Thioredoxin M; electron transport; 2.10A {Spinacia | 99.56 | |
| 1dby_A | 107 | Chloroplast thioredoxin M CH2; thioredoxin CH2, ch | 99.56 | |
| 2c0g_A | 248 | ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, | 99.56 | |
| 1oaz_A | 123 | Thioredoxin 1; immune system, antibody/complex, an | 99.56 | |
| 2qsi_A | 137 | Putative hydrogenase expression/formation protein; | 99.55 | |
| 2i1u_A | 121 | Thioredoxin, TRX, MPT46; redox protein, electron t | 99.55 | |
| 2hls_A | 243 | Protein disulfide oxidoreductase; thioredoxin fold | 99.55 | |
| 3qfa_C | 116 | Thioredoxin; protein-protein complex, rossmann fol | 99.54 | |
| 1w4v_A | 119 | Thioredoxin, mitochondrial; antioxidant enzyme, mi | 99.54 | |
| 3idv_A | 241 | Protein disulfide-isomerase A4; thioredoxin-like f | 99.54 | |
| 2dj0_A | 137 | Thioredoxin-related transmembrane protein 2; AVLA2 | 99.54 | |
| 2es7_A | 142 | Q8ZP25_salty, putative thiol-disulfide isomerase a | 99.54 | |
| 1gh6_A | 114 | Large T antigen; tumor suppressor, oncoprotein, an | 99.53 | |
| 4f9z_D | 227 | Endoplasmic reticulum resident protein 27; thiored | 99.53 | |
| 2pu9_C | 111 | TRX-F, thioredoxin F-type, chloroplast; protein-pr | 99.52 | |
| 3ul3_B | 128 | Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; | 99.52 | |
| 3dxb_A | 222 | Thioredoxin N-terminally fused to PUF60(UHM); spli | 99.52 | |
| 2qc7_A | 240 | ERP31, ERP28, endoplasmic reticulum protein ERP29; | 99.52 | |
| 1v98_A | 140 | Thioredoxin; oxidoreductase, structural genomics, | 99.51 | |
| 1r26_A | 125 | Thioredoxin; redox-active disulfide, electron tran | 99.51 | |
| 2ys8_A | 90 | RAB-related GTP-binding protein RABJ; DNAJ domain, | 99.51 | |
| 1xwb_A | 106 | Thioredoxin; dimerization, redox regulation, THI X | 99.5 | |
| 1gh2_A | 107 | Thioredoxin-like protein; redox-active center, ele | 99.5 | |
| 3d6i_A | 112 | Monothiol glutaredoxin-3; thioredoxin-like, electr | 99.5 | |
| 1faf_A | 79 | Large T antigen; J domain, HPD motif, anti-paralle | 99.5 | |
| 1ep7_A | 112 | Thioredoxin CH1, H-type; electron transport; 2.10A | 99.5 | |
| 2pf4_E | 174 | Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, | 99.49 | |
| 2yj7_A | 106 | LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti | 99.23 | |
| 3f3q_A | 109 | Thioredoxin-1; His TAG, electron transport, cytopl | 99.49 | |
| 2vlu_A | 122 | Thioredoxin, thioredoxin H isoform 2.; oxidoreduct | 99.48 | |
| 3m9j_A | 105 | Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} | 99.48 | |
| 2l6l_A | 155 | DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, | 99.47 | |
| 2l57_A | 126 | Uncharacterized protein; structural genomics, unkn | 99.47 | |
| 1faa_A | 124 | Thioredoxin F; electron transport; 1.85A {Spinacia | 99.47 | |
| 2xc2_A | 117 | Thioredoxinn; oxidoreductase, protein disulfide re | 99.47 | |
| 2l6c_A | 110 | Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu | 99.46 | |
| 1zma_A | 118 | Bacterocin transport accessory protein; alpha-beta | 99.46 | |
| 1syr_A | 112 | Thioredoxin; SGPP, structural genomics, PSI, prote | 99.46 | |
| 3lz8_A | 329 | Putative chaperone DNAJ; structure genomics, struc | 99.46 | |
| 2av4_A | 160 | Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI | 99.46 | |
| 3emx_A | 135 | Thioredoxin; structural genomics, oxidoreductase, | 99.44 | |
| 2vim_A | 104 | Thioredoxin, TRX; thioredoxin fold, oxidoreductase | 99.44 | |
| 3gix_A | 149 | Thioredoxin-like protein 4B; PRE-mRNA splicing, TX | 99.43 | |
| 2j23_A | 121 | Thioredoxin; immune protein, autoreactivity, cross | 99.43 | |
| 2oe3_A | 114 | Thioredoxin-3; electron transport, alpha/beta sand | 99.42 | |
| 1iur_A | 88 | KIAA0730 protein; DNAJ like domain, riken structur | 99.41 | |
| 3evi_A | 118 | Phosducin-like protein 2; alpha beta, 3-layer(ABA) | 99.41 | |
| 3qcp_A | 470 | QSOX from trypanosoma brucei (tbqsox); ERV fold, t | 99.41 | |
| 1a8l_A | 226 | Protein disulfide oxidoreductase; PDI, thioredoxin | 99.4 | |
| 2b5e_A | 504 | Protein disulfide-isomerase; 2.40A {Saccharomyces | 99.4 | |
| 2wz9_A | 153 | Glutaredoxin-3; protein binding; 1.55A {Homo sapie | 99.4 | |
| 3d22_A | 139 | TRXH4, thioredoxin H-type; electron transport, cyt | 99.39 | |
| 3hho_A | 174 | CO-chaperone protein HSCB homolog; structural geno | 99.38 | |
| 1n4c_A | 182 | Auxilin; four helix bundle, protein binding; NMR { | 99.38 | |
| 2qwo_B | 92 | Putative tyrosine-protein phosphatase auxilin; cha | 99.37 | |
| 1qgv_A | 142 | Spliceosomal protein U5-15KD; snRNP, thioredoxin, | 99.37 | |
| 1xfl_A | 124 | Thioredoxin H1; AT3G51030, structural genomics, pr | 99.37 | |
| 2dbc_A | 135 | PDCL2, unnamed protein product; phosducin-like pro | 99.36 | |
| 2vm1_A | 118 | Thioredoxin, thioredoxin H isoform 1.; oxidoreduct | 99.35 | |
| 3uo3_A | 181 | J-type CO-chaperone JAC1, mitochondrial; structura | 99.35 | |
| 1fpo_A | 171 | HSC20, chaperone protein HSCB; molecular chaperone | 99.35 | |
| 2f51_A | 118 | Thioredoxin; electron transport; 1.90A {Trichomona | 99.34 | |
| 3cxg_A | 133 | Putative thioredoxin; malaria, structural GEN oxid | 99.34 | |
| 1wmj_A | 130 | Thioredoxin H-type; structural genomics, program f | 99.33 | |
| 1ti3_A | 113 | Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul | 99.33 | |
| 3bvo_A | 207 | CO-chaperone protein HSCB, mitochondrial precurso; | 99.33 | |
| 2guz_A | 71 | Mitochondrial import inner membrane translocase su | 99.33 | |
| 3f8u_A | 481 | Protein disulfide-isomerase A3ERP57; endoplasmic r | 99.32 | |
| 2kuc_A | 130 | Putative disulphide-isomerase; structural genomics | 99.32 | |
| 3ag7_A | 106 | Putative uncharacterized protein F9E10.5; J-domain | 99.31 | |
| 2trc_P | 217 | Phosducin, MEKA, PP33; transducin, beta-gamma, sig | 99.31 | |
| 1fo5_A | 85 | Thioredoxin; disulfide oxidoreductase, structural | 99.3 | |
| 1nho_A | 85 | Probable thioredoxin; beta sheet, alpha helix, oxi | 99.29 | |
| 1a0r_P | 245 | Phosducin, MEKA, PP33; transducin, beta-gamma, sig | 99.26 | |
| 1sji_A | 350 | Calsequestrin 2, calsequestrin, cardiac muscle iso | 99.24 | |
| 2ywm_A | 229 | Glutaredoxin-like protein; redox protein, structur | 99.24 | |
| 2fwh_A | 134 | Thiol:disulfide interchange protein DSBD; thioredo | 99.24 | |
| 3us3_A | 367 | Calsequestrin-1; calcium-binding protein; 1.74A {O | 99.24 | |
| 3kp8_A | 106 | Vkorc1/thioredoxin domain protein; blood coagulati | 99.24 | |
| 3fk8_A | 133 | Disulphide isomerase; APC61824.1, xylella fastidio | 99.23 | |
| 2djk_A | 133 | PDI, protein disulfide-isomerase; thioredoxin fold | 99.21 | |
| 2lst_A | 130 | Thioredoxin; structural genomics, NEW YORK structu | 98.83 | |
| 1wou_A | 123 | Thioredoxin -related protein, 14 kDa; electron tra | 99.19 | |
| 2hls_A | 243 | Protein disulfide oxidoreductase; thioredoxin fold | 99.19 | |
| 2h8l_A | 252 | Protein disulfide-isomerase A3; thioredoxin-like f | 99.17 | |
| 3f9u_A | 172 | Putative exported cytochrome C biogenesis-related; | 99.1 | |
| 1sen_A | 164 | Thioredoxin-like protein P19; endoplasmic reticulu | 99.06 | |
| 1ilo_A | 77 | Conserved hypothetical protein MTH895; beta-alpha- | 99.03 | |
| 3ec3_A | 250 | Protein disulfide-isomerase A4; thioredoxin-like f | 99.01 | |
| 3dml_A | 116 | Putative uncharacterized protein; thioredoxin, oxi | 99.01 | |
| 2ju5_A | 154 | Thioredoxin disulfide isomerase; protein, oxidored | 98.98 | |
| 3iv4_A | 112 | Putative oxidoreductase; APC23140, meticillin-resi | 98.96 | |
| 2b5x_A | 148 | YKUV protein, TRXY; thioredoxin-like, oxidoreducta | 98.93 | |
| 1lu4_A | 136 | Soluble secreted antigen MPT53; thioredoxin-like f | 98.92 | |
| 1zzo_A | 136 | RV1677; thioredoxin fold, structural genomics, PSI | 98.89 | |
| 3kp9_A | 291 | Vkorc1/thioredoxin domain protein; warfarin, disul | 98.88 | |
| 2h30_A | 164 | Thioredoxin, peptide methionine sulfoxide reductas | 98.87 | |
| 3raz_A | 151 | Thioredoxin-related protein; structural genomics, | 98.87 | |
| 3erw_A | 145 | Sporulation thiol-disulfide oxidoreductase A; thio | 98.85 | |
| 3or5_A | 165 | Thiol:disulfide interchange protein, thioredoxin p | 98.81 | |
| 2r2j_A | 382 | Thioredoxin domain-containing protein 4; CRFS moti | 98.8 | |
| 3ph9_A | 151 | Anterior gradient protein 3 homolog; thioredoxin f | 98.77 | |
| 3hcz_A | 148 | Possible thiol-disulfide isomerase; APC61559.2, cy | 98.75 | |
| 2lja_A | 152 | Putative thiol-disulfide oxidoreductase; structura | 98.73 | |
| 2f9s_A | 151 | Thiol-disulfide oxidoreductase RESA; thioredoxin-l | 98.73 | |
| 2l5o_A | 153 | Putative thioredoxin; structural genomics, unknown | 98.71 | |
| 4evm_A | 138 | Thioredoxin family protein; structural genomics, n | 98.7 | |
| 3fkf_A | 148 | Thiol-disulfide oxidoreductase; structural genomic | 98.69 | |
| 2fgx_A | 107 | Putative thioredoxin; NET3, NESG, GFT-glutaredoxin | 98.69 | |
| 3ira_A | 173 | Conserved protein; methanosarcina mazei,structural | 98.69 | |
| 3gl3_A | 152 | Putative thiol:disulfide interchange protein DSBE; | 98.67 | |
| 3ia1_A | 154 | THIO-disulfide isomerase/thioredoxin; oxidoreducta | 98.63 | |
| 3lwa_A | 183 | Secreted thiol-disulfide isomerase; thioredoxin, P | 98.61 | |
| 2b1k_A | 168 | Thiol:disulfide interchange protein DSBE; C-termin | 98.59 | |
| 3lor_A | 160 | Thiol-disulfide isomerase and thioredoxins; PSI, M | 98.59 | |
| 1kng_A | 156 | Thiol:disulfide interchange protein CYCY; thioredo | 98.56 | |
| 3ed3_A | 298 | Protein disulfide-isomerase MPD1; thioredoxin-like | 98.55 | |
| 3ha9_A | 165 | Uncharacterized thioredoxin-like protein; PSI, MCS | 98.54 | |
| 3eyt_A | 158 | Uncharacterized protein SPOA0173; thioredoxin-like | 98.53 | |
| 2lrn_A | 152 | Thiol:disulfide interchange protein; structural ge | 98.52 | |
| 1z6n_A | 167 | Hypothetical protein PA1234; alpha-beta-alpha sand | 98.52 | |
| 1i5g_A | 144 | Tryparedoxin II; electron transport; HET: TS5; 1.4 | 98.5 | |
| 3ewl_A | 142 | Uncharacterized conserved protein BF1870; alpha-be | 98.5 | |
| 1ttz_A | 87 | Conserved hypothetical protein; structural genomic | 98.5 | |
| 1o8x_A | 146 | Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot | 98.47 | |
| 3eur_A | 142 | Uncharacterized protein; PSI2,MCSG, conserved prot | 98.44 | |
| 1o73_A | 144 | Tryparedoxin; electron transport, trypanosomatid, | 98.44 | |
| 3kcm_A | 154 | Thioredoxin family protein; SGX, thioredoxin prote | 98.43 | |
| 3hdc_A | 158 | Thioredoxin family protein; ATCC53774, DSM 7210, , | 98.39 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 98.37 | |
| 2lrt_A | 152 | Uncharacterized protein; structural genomics, thio | 98.34 | |
| 3s9f_A | 165 | Tryparedoxin; thioredoxin fold, disulfide reductas | 98.33 | |
| 3bj5_A | 147 | Protein disulfide-isomerase; thioredoxin fold, cha | 98.32 | |
| 2cvb_A | 188 | Probable thiol-disulfide isomerase/thioredoxin; re | 98.32 | |
| 2ywi_A | 196 | Hypothetical conserved protein; uncharacterized co | 98.32 | |
| 2hyx_A | 352 | Protein DIPZ; thioredoxin fold, jelly-roll, struct | 98.31 | |
| 2guz_B | 65 | Mitochondrial import inner membrane translocase su | 98.31 | |
| 1jfu_A | 186 | Thiol:disulfide interchange protein TLPA; thioredo | 98.3 | |
| 2l4c_A | 124 | Endoplasmic reticulum resident protein 27; ERP27, | 98.29 | |
| 2lus_A | 143 | Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carci | 97.58 | |
| 2e7p_A | 116 | Glutaredoxin; thioredoxin fold, poplar, electron t | 98.25 | |
| 3fw2_A | 150 | Thiol-disulfide oxidoreductase; structural genomic | 98.23 | |
| 3kh7_A | 176 | Thiol:disulfide interchange protein DSBE; TRX-like | 98.23 | |
| 2dlx_A | 153 | UBX domain-containing protein 7; UAS domain, prote | 98.22 | |
| 2k8s_A | 80 | Thioredoxin; dimer, structural genomics, PSI-2, pr | 98.21 | |
| 2k6v_A | 172 | Putative cytochrome C oxidase assembly protein; th | 98.18 | |
| 3cmi_A | 171 | Peroxiredoxin HYR1; thioredoxin-like fold, oxidore | 98.18 | |
| 1hyu_A | 521 | AHPF, alkyl hydroperoxide reductase subunit F; thi | 98.15 | |
| 2vup_A | 190 | Glutathione peroxidase-like protein; oxidoreductas | 98.13 | |
| 2ggt_A | 164 | SCO1 protein homolog, mitochondrial; copper chaper | 98.12 | |
| 2ls5_A | 159 | Uncharacterized protein; structural genomics, unkn | 97.38 | |
| 2p5q_A | 170 | Glutathione peroxidase 5; thioredoxin fold, oxidor | 98.09 | |
| 2p31_A | 181 | CL683, glutathione peroxidase 7; thioredoxin fold, | 98.09 | |
| 1ego_A | 85 | Glutaredoxin; electron transport; NMR {Escherichia | 98.08 | |
| 1wjk_A | 100 | C330018D20RIK protein; glutaredoxin, thioredoxin f | 98.06 | |
| 2rli_A | 171 | SCO2 protein homolog, mitochondrial; copper protei | 98.04 | |
| 3dwv_A | 187 | Glutathione peroxidase-like protein; alpha beta, 3 | 98.03 | |
| 3u5r_E | 218 | Uncharacterized protein; structural genomics, PSI- | 97.98 | |
| 1eej_A | 216 | Thiol:disulfide interchange protein; oxidoreductas | 97.97 | |
| 2v1m_A | 169 | Glutathione peroxidase; selenium, selenocysteine, | 97.96 | |
| 4fo5_A | 143 | Thioredoxin-like protein; AHPC/TSA family protein, | 97.95 | |
| 2obi_A | 183 | PHGPX, GPX-4, phospholipid hydroperoxide glutathio | 97.9 | |
| 3gyk_A | 175 | 27KDA outer membrane protein; APC61738.2, siliciba | 97.87 | |
| 1we0_A | 187 | Alkyl hydroperoxide reductase C; peroxiredoxin, AH | 97.85 | |
| 1zof_A | 198 | Alkyl hydroperoxide-reductase; decamer, toroide-sh | 97.83 | |
| 3zzx_A | 105 | Thioredoxin; oxidoreductase; 1.88A {Litopenaeus va | 97.82 | |
| 2f8a_A | 208 | Glutathione peroxidase 1; thioredoxin fold, struct | 97.81 | |
| 1t3b_A | 211 | Thiol:disulfide interchange protein DSBC; oxidored | 97.8 | |
| 2bmx_A | 195 | Alkyl hydroperoxidase C; peroxiredoxin, antioxidan | 97.79 | |
| 3h79_A | 127 | Thioredoxin-like protein; thioredoxin fold, cataly | 97.79 | |
| 3kij_A | 180 | Probable glutathione peroxidase 8; human PDI-perox | 97.78 | |
| 3drn_A | 161 | Peroxiredoxin, bacterioferritin comigratory prote | 97.75 | |
| 1xzo_A | 174 | BSSCO, hypothetical protein YPMQ; thioredoxin-like | 97.72 | |
| 2qc7_A | 240 | ERP31, ERP28, endoplasmic reticulum protein ERP29; | 97.71 | |
| 1xvw_A | 160 | Hypothetical protein RV2238C/MT2298; thioredoxin f | 97.71 | |
| 2gs3_A | 185 | PHGPX, GPX-4, phospholipid hydroperoxide glutathio | 97.71 | |
| 2qsi_A | 137 | Putative hydrogenase expression/formation protein; | 97.7 | |
| 2l4c_A | 124 | Endoplasmic reticulum resident protein 27; ERP27, | 97.7 | |
| 1un2_A | 197 | DSBA, thiol-disulfide interchange protein; disulfi | 97.65 | |
| 1qmv_A | 197 | Human thioredoxin peroxidase-B; peroxiredoxin, sul | 97.65 | |
| 2dml_A | 130 | Protein disulfide-isomerase A6; thioredoxin domain | 97.64 | |
| 2qgv_A | 140 | Hydrogenase-1 operon protein HYAE; alpha-beta prot | 97.63 | |
| 2h01_A | 192 | 2-Cys peroxiredoxin; thioredoxin peroxidase, struc | 97.61 | |
| 2es7_A | 142 | Q8ZP25_salty, putative thiol-disulfide isomerase a | 97.6 | |
| 2djk_A | 133 | PDI, protein disulfide-isomerase; thioredoxin fold | 97.6 | |
| 2c0g_A | 248 | ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, | 97.59 | |
| 3ga4_A | 178 | Dolichyl-diphosphooligosaccharide-protein glycosyl | 97.56 | |
| 1zye_A | 220 | Thioredoxin-dependent peroxide reductase; catenane | 97.55 | |
| 1h75_A | 81 | Glutaredoxin-like protein NRDH; electron transport | 97.52 | |
| 3hd5_A | 195 | Thiol:disulfide interchange protein DSBA; protein | 97.48 | |
| 2voc_A | 112 | Thioredoxin; electron transport, homodimer, disulf | 97.47 | |
| 1uul_A | 202 | Tryparedoxin peroxidase homologue; peroxiredoxin, | 97.47 | |
| 1r7h_A | 75 | NRDH-redoxin; thioredoxin, glutaredoxin, redox pro | 97.46 | |
| 3h93_A | 192 | Thiol:disulfide interchange protein DSBA; disulfid | 97.45 | |
| 3tco_A | 109 | Thioredoxin (TRXA-1); disulfide oxidoreductase, ox | 97.39 | |
| 3hxs_A | 141 | Thioredoxin, TRXP; electron transport; 2.00A {Bact | 97.38 | |
| 2b7k_A | 200 | SCO1 protein; metallochaperone, cytochrome C oxida | 97.36 | |
| 2znm_A | 195 | Thiol:disulfide interchange protein DSBA; thioredo | 97.32 | |
| 3q6o_A | 244 | Sulfhydryl oxidase 1; protein disulfide isomerase, | 97.32 | |
| 3die_A | 106 | Thioredoxin, TRX; electron transport, SWAP domain, | 97.31 | |
| 2dj1_A | 140 | Protein disulfide-isomerase A4; protein ERP-72, ER | 97.3 | |
| 1mek_A | 120 | Protein disulfide isomerase; electron transport, r | 97.26 | |
| 3qfa_C | 116 | Thioredoxin; protein-protein complex, rossmann fol | 97.25 | |
| 3gkn_A | 163 | Bacterioferritin comigratory protein; BCP, PRX, at | 97.2 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 97.2 | |
| 3ztl_A | 222 | Thioredoxin peroxidase; oxidoreductase, reductase, | 97.19 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 97.19 | |
| 1x5d_A | 133 | Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC | 97.19 | |
| 3gnj_A | 111 | Thioredoxin domain protein; APC92103, STR genomics | 97.17 | |
| 3t58_A | 519 | Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. | 97.17 | |
| 2l5l_A | 136 | Thioredoxin; structural genomics, electron transpo | 97.17 | |
| 1nm3_A | 241 | Protein HI0572; hybrid, peroxiredoxin, glutaredoxi | 97.16 | |
| 1x5e_A | 126 | Thioredoxin domain containing protein 1; TMX, TXND | 97.16 | |
| 1v58_A | 241 | Thiol:disulfide interchange protein DSBG; reduced | 97.15 | |
| 3m9j_A | 105 | Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} | 97.14 | |
| 1kte_A | 105 | Thioltransferase; redox-active center, electron tr | 97.13 | |
| 2yzu_A | 109 | Thioredoxin; redox protein, electron transport, st | 97.12 | |
| 1thx_A | 115 | Thioredoxin, thioredoxin 2; oxido-reductase, elect | 97.11 | |
| 1oaz_A | 123 | Thioredoxin 1; immune system, antibody/complex, an | 97.11 | |
| 2i4a_A | 107 | Thioredoxin; acidophIle, disulfide exchange, oxido | 97.11 | |
| 3uvt_A | 111 | Thioredoxin domain-containing protein 5; thioredox | 97.1 | |
| 3p2a_A | 148 | Thioredoxin 2, putative thioredoxin-like protein; | 97.08 | |
| 4euy_A | 105 | Uncharacterized protein; structural genomics, PSI- | 97.08 | |
| 1w4v_A | 119 | Thioredoxin, mitochondrial; antioxidant enzyme, mi | 97.07 | |
| 2i81_A | 213 | 2-Cys peroxiredoxin; structural genomics consortiu | 97.06 | |
| 2e0q_A | 104 | Thioredoxin; electron transport; 1.49A {Sulfolobus | 97.06 | |
| 2klx_A | 89 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 97.04 | |
| 3ul3_B | 128 | Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; | 97.04 | |
| 2trx_A | 108 | Thioredoxin; electron transport; 1.68A {Escherichi | 97.04 | |
| 3aps_A | 122 | DNAJ homolog subfamily C member 10; thioredoxin fo | 97.04 | |
| 1xwb_A | 106 | Thioredoxin; dimerization, redox regulation, THI X | 97.03 | |
| 1nsw_A | 105 | Thioredoxin, TRX; thermostability, electron transp | 97.02 | |
| 1dby_A | 107 | Chloroplast thioredoxin M CH2; thioredoxin CH2, ch | 96.98 | |
| 1xvq_A | 175 | Thiol peroxidase; thioredoxin fold, structural gen | 96.98 | |
| 2i3y_A | 215 | Epididymal secretory glutathione peroxidase; thior | 96.95 | |
| 2a4v_A | 159 | Peroxiredoxin DOT5; yeast nuclear thiol peroxidase | 96.94 | |
| 2vim_A | 104 | Thioredoxin, TRX; thioredoxin fold, oxidoreductase | 96.92 | |
| 2j23_A | 121 | Thioredoxin; immune protein, autoreactivity, cross | 96.92 | |
| 2l57_A | 126 | Uncharacterized protein; structural genomics, unkn | 96.91 | |
| 3hz4_A | 140 | Thioredoxin; NYSGXRC, PSI-II, reduced form, protei | 96.9 | |
| 1gh2_A | 107 | Thioredoxin-like protein; redox-active center, ele | 96.9 | |
| 2o8v_B | 128 | Thioredoxin 1; disulfide crosslinked complex, oxid | 96.9 | |
| 1ep7_A | 112 | Thioredoxin CH1, H-type; electron transport; 2.10A | 96.88 | |
| 1fb6_A | 105 | Thioredoxin M; electron transport; 2.10A {Spinacia | 96.88 | |
| 2oe3_A | 114 | Thioredoxin-3; electron transport, alpha/beta sand | 96.87 | |
| 2jsy_A | 167 | Probable thiol peroxidase; solution structure, ant | 96.87 | |
| 1syr_A | 112 | Thioredoxin; SGPP, structural genomics, PSI, prote | 96.84 | |
| 2ppt_A | 155 | Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc | 96.83 | |
| 2i1u_A | 121 | Thioredoxin, TRX, MPT46; redox protein, electron t | 96.82 | |
| 1t00_A | 112 | Thioredoxin, TRX; redox regulation, multifunction | 96.81 | |
| 2av4_A | 160 | Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI | 96.81 | |
| 2c0d_A | 221 | Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, th | 96.8 | |
| 3d6i_A | 112 | Monothiol glutaredoxin-3; thioredoxin-like, electr | 96.79 | |
| 3f3q_A | 109 | Thioredoxin-1; His TAG, electron transport, cytopl | 96.74 | |
| 2dj0_A | 137 | Thioredoxin-related transmembrane protein 2; AVLA2 | 96.73 | |
| 1fo5_A | 85 | Thioredoxin; disulfide oxidoreductase, structural | 96.69 | |
| 2hze_A | 114 | Glutaredoxin-1; thioredoxin fold, arsenic, dimethy | 96.66 | |
| 1v98_A | 140 | Thioredoxin; oxidoreductase, structural genomics, | 96.66 | |
| 2l6c_A | 110 | Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu | 96.64 | |
| 2cq9_A | 130 | GLRX2 protein, glutaredoxin 2; glutathione-S-trans | 96.63 | |
| 4g2e_A | 157 | Peroxiredoxin; redox protein, structural genomics, | 96.62 | |
| 2vlu_A | 122 | Thioredoxin, thioredoxin H isoform 2.; oxidoreduct | 96.62 | |
| 2r37_A | 207 | Glutathione peroxidase 3; plasma, structural genom | 96.59 | |
| 1r26_A | 125 | Thioredoxin; redox-active disulfide, electron tran | 96.58 | |
| 2djj_A | 121 | PDI, protein disulfide-isomerase; thioredoxin fold | 96.56 | |
| 2dj3_A | 133 | Protein disulfide-isomerase A4; protein ERP-72, ER | 96.55 | |
| 1nho_A | 85 | Probable thioredoxin; beta sheet, alpha helix, oxi | 96.54 | |
| 2xc2_A | 117 | Thioredoxinn; oxidoreductase, protein disulfide re | 96.53 | |
| 2wz9_A | 153 | Glutaredoxin-3; protein binding; 1.55A {Homo sapie | 96.51 | |
| 1z6m_A | 175 | Conserved hypothetical protein; structural genomic | 96.46 | |
| 2pn8_A | 211 | Peroxiredoxin-4; thioredoxin, oxidoreductase, stru | 96.45 | |
| 3ixr_A | 179 | Bacterioferritin comigratory protein; alpha beta p | 96.43 | |
| 2ht9_A | 146 | Glutaredoxin-2; thioredoxin fold, iron-sulfur clus | 96.38 | |
| 3dxb_A | 222 | Thioredoxin N-terminally fused to PUF60(UHM); spli | 96.33 | |
| 1xfl_A | 124 | Thioredoxin H1; AT3G51030, structural genomics, pr | 96.32 | |
| 2yan_A | 105 | Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H | 96.29 | |
| 2rem_A | 193 | Disulfide oxidoreductase; disulfide oxidoreductase | 96.28 | |
| 1ti3_A | 113 | Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul | 96.28 | |
| 1n8j_A | 186 | AHPC, alkyl hydroperoxide reductase C22 protein; p | 96.27 | |
| 3ic4_A | 92 | Glutaredoxin (GRX-1); structural genomics, PSI, MC | 96.26 | |
| 3c1r_A | 118 | Glutaredoxin-1; oxidized form, oxidoreductase, cyt | 96.23 | |
| 1fov_A | 82 | Glutaredoxin 3, GRX3; active site disulfide, CIS P | 96.19 | |
| 3bj5_A | 147 | Protein disulfide-isomerase; thioredoxin fold, cha | 96.14 | |
| 1q98_A | 165 | Thiol peroxidase, TPX; structural genomics, NYSGXR | 96.13 | |
| 2fwh_A | 134 | Thiol:disulfide interchange protein DSBD; thioredo | 96.13 | |
| 3qpm_A | 240 | Peroxiredoxin; oxidoreductase, thioredoxin fold, p | 96.09 | |
| 2vm1_A | 118 | Thioredoxin, thioredoxin H isoform 1.; oxidoreduct | 96.07 | |
| 2pu9_C | 111 | TRX-F, thioredoxin F-type, chloroplast; protein-pr | 96.05 | |
| 1tp9_A | 162 | Peroxiredoxin, PRX D (type II); oligomer, thioredo | 96.05 | |
| 2kuc_A | 130 | Putative disulphide-isomerase; structural genomics | 96.02 | |
| 1wmj_A | 130 | Thioredoxin H-type; structural genomics, program f | 96.01 | |
| 1wou_A | 123 | Thioredoxin -related protein, 14 kDa; electron tra | 96.0 | |
| 3gix_A | 149 | Thioredoxin-like protein 4B; PRE-mRNA splicing, TX | 95.98 | |
| 3tjj_A | 254 | Peroxiredoxin-4; thioredoxin fold, sulfenylation, | 95.98 | |
| 2trc_P | 217 | Phosducin, MEKA, PP33; transducin, beta-gamma, sig | 95.97 | |
| 3me7_A | 170 | Putative uncharacterized protein; electron transfe | 95.97 | |
| 1zma_A | 118 | Bacterocin transport accessory protein; alpha-beta | 95.95 | |
| 3emx_A | 135 | Thioredoxin; structural genomics, oxidoreductase, | 95.92 | |
| 2dbc_A | 135 | PDCL2, unnamed protein product; phosducin-like pro | 95.92 | |
| 3hz8_A | 193 | Thiol:disulfide interchange protein DSBA; thiol-ox | 95.91 | |
| 3iv4_A | 112 | Putative oxidoreductase; APC23140, meticillin-resi | 95.87 | |
| 2khp_A | 92 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 95.85 | |
| 3evi_A | 118 | Phosducin-like protein 2; alpha beta, 3-layer(ABA) | 95.83 | |
| 3cxg_A | 133 | Putative thioredoxin; malaria, structural GEN oxid | 95.83 | |
| 1faa_A | 124 | Thioredoxin F; electron transport; 1.85A {Spinacia | 95.81 | |
| 3gv1_A | 147 | Disulfide interchange protein; neisseria gonorrhoe | 95.78 | |
| 4gqc_A | 164 | Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, f | 95.77 | |
| 2yj7_A | 106 | LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti | 94.74 | |
| 1qgv_A | 142 | Spliceosomal protein U5-15KD; snRNP, thioredoxin, | 95.72 | |
| 3d22_A | 139 | TRXH4, thioredoxin H-type; electron transport, cyt | 95.7 | |
| 2pwj_A | 171 | Mitochondrial peroxiredoxin; alpha and beta protei | 95.69 | |
| 3nzn_A | 103 | Glutaredoxin; structural genomics, PSI2, MCSG, pro | 95.68 | |
| 2yzh_A | 171 | Probable thiol peroxidase; redox protein, antioxid | 95.63 | |
| 3l9v_A | 189 | Putative thiol-disulfide isomerase or thioredoxin; | 95.63 | |
| 2f51_A | 118 | Thioredoxin; electron transport; 1.90A {Trichomona | 95.59 | |
| 3feu_A | 185 | Putative lipoprotein; alpha-beta structure, struct | 95.45 | |
| 3a2v_A | 249 | Probable peroxiredoxin; thioredoxin peroxidase, hy | 95.42 | |
| 1psq_A | 163 | Probable thiol peroxidase; structural genomics, NY | 95.42 | |
| 3zrd_A | 200 | Thiol peroxidase; oxidoreductase, 2Cys peroxiredox | 95.41 | |
| 2wfc_A | 167 | Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidan | 95.39 | |
| 3fk8_A | 133 | Disulphide isomerase; APC61824.1, xylella fastidio | 95.33 | |
| 1a0r_P | 245 | Phosducin, MEKA, PP33; transducin, beta-gamma, sig | 95.32 | |
| 3uma_A | 184 | Hypothetical peroxiredoxin protein; nysgrc, PSI bi | 95.18 | |
| 3rhb_A | 113 | ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox | 95.1 | |
| 2lqo_A | 92 | Putative glutaredoxin RV3198.1/MT3292; TRX fold, o | 95.08 | |
| 3qmx_A | 99 | Glutaredoxin A, glutaredoxin 3; electron transport | 95.07 | |
| 2lst_A | 130 | Thioredoxin; structural genomics, NEW YORK structu | 93.91 | |
| 3mng_A | 173 | Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, | 94.9 | |
| 1wik_A | 109 | Thioredoxin-like protein 2; picot homology 2 domai | 94.89 | |
| 1zzo_A | 136 | RV1677; thioredoxin fold, structural genomics, PSI | 94.64 | |
| 3erw_A | 145 | Sporulation thiol-disulfide oxidoreductase A; thio | 94.63 | |
| 3p7x_A | 166 | Probable thiol peroxidase; thioredoxin fold, oxido | 94.59 | |
| 2b5x_A | 148 | YKUV protein, TRXY; thioredoxin-like, oxidoreducta | 94.56 | |
| 2ec4_A | 178 | FAS-associated factor 1; UAS domain, protein FAF1, | 94.52 | |
| 3qcp_A | 470 | QSOX from trypanosoma brucei (tbqsox); ERV fold, t | 94.5 | |
| 1lu4_A | 136 | Soluble secreted antigen MPT53; thioredoxin-like f | 94.49 | |
| 1hyu_A | 521 | AHPF, alkyl hydroperoxide reductase subunit F; thi | 94.17 | |
| 2lja_A | 152 | Putative thiol-disulfide oxidoreductase; structura | 93.99 | |
| 3msz_A | 89 | Glutaredoxin 1; alpha-beta sandwich, center for st | 93.91 | |
| 1ilo_A | 77 | Conserved hypothetical protein MTH895; beta-alpha- | 93.88 | |
| 3dml_A | 116 | Putative uncharacterized protein; thioredoxin, oxi | 93.83 | |
| 2l5o_A | 153 | Putative thioredoxin; structural genomics, unknown | 93.16 | |
| 2f9s_A | 151 | Thiol-disulfide oxidoreductase RESA; thioredoxin-l | 93.16 | |
| 2v2g_A | 233 | Peroxiredoxin 6; oxidoreductase, antioxidant enzym | 93.01 | |
| 3ctg_A | 129 | Glutaredoxin-2; reduced form, electron transport, | 92.75 | |
| 4evm_A | 138 | Thioredoxin family protein; structural genomics, n | 92.65 | |
| 3raz_A | 151 | Thioredoxin-related protein; structural genomics, | 92.34 | |
| 3fkf_A | 148 | Thiol-disulfide oxidoreductase; structural genomic | 92.22 | |
| 3hcz_A | 148 | Possible thiol-disulfide isomerase; APC61559.2, cy | 91.87 | |
| 3l9s_A | 191 | Thiol:disulfide interchange protein; thioredoxin-f | 91.66 | |
| 2ju5_A | 154 | Thioredoxin disulfide isomerase; protein, oxidored | 91.11 | |
| 3h8q_A | 114 | Thioredoxin reductase 3; oxidoreductase, structura | 91.1 | |
| 3or5_A | 165 | Thiol:disulfide interchange protein, thioredoxin p | 90.99 | |
| 3ia1_A | 154 | THIO-disulfide isomerase/thioredoxin; oxidoreducta | 90.79 | |
| 3gl3_A | 152 | Putative thiol:disulfide interchange protein DSBE; | 90.49 | |
| 4hde_A | 170 | SCO1/SENC family lipoprotein; structural genomics, | 90.29 | |
| 3lor_A | 160 | Thiol-disulfide isomerase and thioredoxins; PSI, M | 89.99 | |
| 1prx_A | 224 | HORF6; peroxiredoxin, hydrogen peroxide, redox reg | 88.84 | |
| 3eyt_A | 158 | Uncharacterized protein SPOA0173; thioredoxin-like | 88.3 | |
| 2lrn_A | 152 | Thiol:disulfide interchange protein; structural ge | 88.29 | |
| 2h30_A | 164 | Thioredoxin, peptide methionine sulfoxide reductas | 88.18 | |
| 4dvc_A | 184 | Thiol:disulfide interchange protein DSBA; pilus as | 88.14 | |
| 2fgx_A | 107 | Putative thioredoxin; NET3, NESG, GFT-glutaredoxin | 87.29 | |
| 3keb_A | 224 | Probable thiol peroxidase; structural genomics, AP | 87.19 | |
| 3hdc_A | 158 | Thioredoxin family protein; ATCC53774, DSM 7210, , | 86.95 | |
| 3ha9_A | 165 | Uncharacterized thioredoxin-like protein; PSI, MCS | 86.64 | |
| 3l4n_A | 127 | Monothiol glutaredoxin-6; C-terminal domain of GRX | 86.59 | |
| 3f9u_A | 172 | Putative exported cytochrome C biogenesis-related; | 86.22 | |
| 2dlx_A | 153 | UBX domain-containing protein 7; UAS domain, prote | 86.21 | |
| 1kng_A | 156 | Thiol:disulfide interchange protein CYCY; thioredo | 86.21 | |
| 3kcm_A | 154 | Thioredoxin family protein; SGX, thioredoxin prote | 85.63 | |
| 3lwa_A | 183 | Secreted thiol-disulfide isomerase; thioredoxin, P | 85.34 | |
| 3c7m_A | 195 | Thiol:disulfide interchange protein DSBA-like; red | 84.62 | |
| 1xcc_A | 220 | 1-Cys peroxiredoxin; unknown function, structural | 84.48 | |
| 3fw2_A | 150 | Thiol-disulfide oxidoreductase; structural genomic | 84.45 | |
| 3kp8_A | 106 | Vkorc1/thioredoxin domain protein; blood coagulati | 83.74 | |
| 2wci_A | 135 | Glutaredoxin-4; redox-active center, iron-sulfur c | 82.82 | |
| 2axo_A | 270 | Hypothetical protein ATU2684; alpha beta protein., | 82.75 | |
| 1nm3_A | 241 | Protein HI0572; hybrid, peroxiredoxin, glutaredoxi | 82.29 | |
| 2b1k_A | 168 | Thiol:disulfide interchange protein DSBE; C-termin | 81.94 | |
| 2ct6_A | 111 | SH3 domain-binding glutamic acid-rich-like protein | 81.54 | |
| 3s9f_A | 165 | Tryparedoxin; thioredoxin fold, disulfide reductas | 81.39 | |
| 1o8x_A | 146 | Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot | 80.46 |
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} | Back alignment and structure |
|---|
Probab=100.00 E-value=3.9e-46 Score=442.90 Aligned_cols=367 Identities=19% Similarity=0.311 Sum_probs=245.4
Q ss_pred ccCcccccCcCCCCCHHHHHHHHHHHHHhcCCCCCC---ChHHHHHHHHHHHHHcCChhhhcccCcCCchhhhhhhhhhc
Q 005374 36 PPSHYDALGIKPYSSVEQVKEAYEKFSSKWNSGEEI---PSTADFLKIQYAYELLTDPLWKRNYDVYGIDEQLHILEKVR 112 (699)
Q Consensus 36 ~~d~Y~vLgv~~~as~~eIk~ayr~l~~~~HPDk~~---~~~~~f~~I~~Ay~vL~d~~~R~~YD~~g~~~~~~~~~~~~ 112 (699)
..|||+||||+++|+.++||+|||+|+++||||+++ .+.++|++|++||++|+||.+|+.||++|.++..... +
T Consensus 20 ~~~~y~~lg~~~~a~~~~i~~ay~~l~~~~hpd~~~~~~~~~~~f~~i~~ay~~L~~~~~r~~yd~~~~~~~~~~~---~ 96 (780)
T 3apo_A 20 DQNFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHGDFLKINRAYEVLKDEDLRKKYDKYGEKGLEDNQ---G 96 (780)
T ss_dssp ---CHHHHTCCTTCCHHHHHHHHCC-----------------------CTHHHHHHSHHHHHHHTTC-------------
T ss_pred CCCHHHHcCCCCCCCHHHHHHHHHHHHHHHCcCCCCCChHHHHHHHHHHHHHHHHcChHHHHHHHhhcccccccCC---C
Confidence 679999999999999999999999999999999985 3577899999999999999999999999988765442 4
Q ss_pred cccCccccccccCCCCCCCCCCcceEEEecCCCCcccccCCCcEEEEEeccCCCCCCCcchHHHHHHHHhhcccceeeee
Q 005374 113 EQYGEESYSRIDLPLLDATDHSVHAFNVVTSEDFPSIFHDSKPWLIQVYSDGSYLCGQFSGAWKTIAALLEGIANTGMVE 192 (699)
Q Consensus 113 ~~~~~~~f~~~~f~f~~~~d~~~~~V~~Lt~~nF~~~v~~~~~~lV~FYapwC~hCk~l~p~~~~~A~~L~g~~~va~Vd 192 (699)
+++..++|++..|++|.+. +.|..||.++|++.++++++|||+||||||+||+++.|.|+++|+.+++.+.+++||
T Consensus 97 ~~~~~~~~~~~~fg~~~~~----~~v~~l~~~~f~~~i~~~~~~lv~Fya~wC~~C~~~~p~~~~~a~~~~~~v~~~~vd 172 (780)
T 3apo_A 97 GQYESWSYYRYDFGIYDDD----PEIITLERREFDAAVNSGELWFVNFYSPGSSHSHDLAPTWREFAKEVDGLLRIGAVN 172 (780)
T ss_dssp -------CCSSSSSTTTTC----TTEEECCHHHHHHHHTSSSCEEEEEECSSCHHHHHHHHHHHHHHHHTTTTSEEEEEE
T ss_pred CCcccccccchhhcccCCC----cceeeechHhHHhhhcCCCcEEEEEeCCCCcchhHhhHHHHHHHHHhcCceEEEEEe
Confidence 5567777777778877653 368999999999999889999999999999999999999999999999888999999
Q ss_pred ccchhhhhHHHHhCCCCcccccccccEEEEcCCCCCCCCccccccCCcCHHHHHHHHHHHhccCCcceecccc---hhhh
Q 005374 193 LGDIRLATHLAERKPIGQIFFRRGLPSLVAFPPGCKSSDCMTRFEGELSVDAVTDWFATAILKLPRIFYYTKE---SMGK 269 (699)
Q Consensus 193 c~~~~~~~~L~~k~~i~~~f~V~gyPTl~~f~~g~~~~~~~~~Y~G~rs~~~Iv~fi~k~v~~lP~~~~it~~---~~~~ 269 (699)
|++++. ||++++ |+++|||++|++|.. ...|.|.++++.|++|+.+++ .|....+++. +.++
T Consensus 173 ~~~~~~---l~~~~~------v~~~Pt~~~~~~g~~----~~~~~G~~~~~~l~~~l~~~~--~~~~~~i~~~~~~~~l~ 237 (780)
T 3apo_A 173 CGDDRM---LCRMKG------VNSYPSLFIFRSGMA----AVKYNGDRSKESLVAFAMQHV--RSTVTELSTGNFVNAIE 237 (780)
T ss_dssp TTTCSS---CC--------------CEEEEECTTSC----CEECCSCSCHHHHHHHHHTTS--CCCEEECCHHHHHHHHH
T ss_pred CCCcHH---HHHHcC------CceeeeEEEEeCCcE----eeEecCCCCHHHHHHHHHHhc--hhhheeccchhhHHHHH
Confidence 996655 999998 779999999999864 368999999999999999983 3444445554 3466
Q ss_pred hhhhhcCCCcEEEEEEcCCCC-C-chHHHHHHHHhccCCceEEEEEccccccHhHHhhcCCCCCCEEEEEcC------CC
Q 005374 270 NFLAKTGPHKVKVIFFSKTGE-R-ASPFVRQISRNYWAYASFAFVLWREEESSIWWNTFEVESAPAIVFLKD------PG 341 (699)
Q Consensus 270 ~Fl~~~~~~~v~vl~f~~~~~-~-~~~~~~~~A~~~~~~~~Fg~V~~~~~~s~~l~~kf~V~~~PtIvlfk~------~~ 341 (699)
.|+.. +.+.|++|.++.+ + ....++.++..|++.+.||++.... ...+++++++++.| +++|++ .+
T Consensus 238 ~~~~~---~~~~vi~f~~~~~~~~~~~~~~~l~~~f~~~~~f~~v~c~~--~~~l~~~~gi~~~p-~~~f~~~~~~~~~~ 311 (780)
T 3apo_A 238 TAFAA---GVGWLITFCSKGEDCLTSQTRLRLSGMLDGLVNVGWVDCDA--QDSLCKSLDTTAST-TAYFPPGATLNDRE 311 (780)
T ss_dssp HHHHH---TCEEEEEEECTTSCCCCHHHHHHHHHHTTTTEEEEEEETTT--SHHHHTCC-----C-EEEECTTCCSSTTT
T ss_pred hhhcc---CCCEEEEEecCcccccCHHHHHHHHHHhhccceEEEEEcCC--CHHHHHHhCCCCCc-eeeeccccccCCCc
Confidence 66654 4466777754332 2 3456677888899999999997433 35799999999888 666765 23
Q ss_pred CCceeecCCCChhHHHHHHHHhhccccccCCccccccccccchhhhhhccCcCCCCCCCCCccceEEEEEeccCChhHHH
Q 005374 342 VKPVVYYGSFNNSRLSEVMEQNKLQGLYFCGTCVSELPQLRSVTSMELGCDARGYSRAGSDTTIWYCVILAGRLSPELNK 421 (699)
Q Consensus 342 ~~pv~y~g~~~~~~L~~fi~~~~~~~~~~~~~~~~~vp~Lts~s~~~~~c~~~~~~~~~~~~~~~lCvI~~~~~~~~~~~ 421 (699)
..++.|.|.++...|..||.. .+| .+..+|..+... .+.. . .++|++.... +...
T Consensus 312 ~~~~~y~g~~~~~~i~~~i~~-~~p----------~v~~it~~~f~~-~~~~-------~----~~lv~F~~~~--~~~~ 366 (780)
T 3apo_A 312 KSSVLFLNSLDAKEIYMEIIH-NLP----------DFELLSANQLED-RLAH-------H----RWLVFFHFGK--NENA 366 (780)
T ss_dssp GGGSEEECCCCHHHHHHHHHH-HSC----------CCCEECHHHHHH-HHTT-------S----EEEEEEECC-------
T ss_pred ccceeccccccHHHHHHHHHH-hCC----------CcccCCHHHHHH-Hhcc-------C----CeEEEEecCC--cccc
Confidence 456789999999999999994 677 788887655543 2211 1 4565555321 1111
Q ss_pred HHHHHHHHHHhhccCcccccccccccchhHHHhcCCCeEEEEEEeCcchHHHHHHh
Q 005374 422 MRETIRRVQETLLSDDESNAADTDQSLAPAAVAFRNKRLTFAWLDGEAQDRYCSFY 477 (699)
Q Consensus 422 ~~~~lr~~a~~l~~~~~~~~~~~~~~~~~~a~~~k~~~l~F~wvd~~~q~~f~~~f 477 (699)
..+ .+..+|..++++.+.|+|+|+..+.++++.|
T Consensus 367 ~~~----------------------~~~~~A~~~~~~~i~f~~~D~~~~~~~~~~~ 400 (780)
T 3apo_A 367 NDP----------------------ELKKLKTLLKNEHIQVVRFDCSSAPGICSDL 400 (780)
T ss_dssp CCG----------------------GGGGHHHHHGGGTEEEEEEEGGGCHHHHHHT
T ss_pred chH----------------------HHHHHHHhhccCceeEEEEeCCCchhhHhhc
Confidence 222 3344455777677999999999888999876
|
| >3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3v1w_A* 3trq_A* 3trp_A* 3uom_A | Back alignment and structure |
|---|
| >1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A | Back alignment and structure |
|---|
| >2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} | Back alignment and structure |
|---|
| >3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A | Back alignment and structure |
|---|
| >2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A | Back alignment and structure |
|---|
| >3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A | Back alignment and structure |
|---|
| >3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* | Back alignment and structure |
|---|
| >2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A | Back alignment and structure |
|---|
| >1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A | Back alignment and structure |
|---|
| >3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A | Back alignment and structure |
|---|
| >3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2h8l_A Protein disulfide-isomerase A3; thioredoxin-like fold; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3ec3_A Protein disulfide-isomerase A4; thioredoxin-like fold, endoplasmic reticulum, glycoprotein, redox-active center; 1.92A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A | Back alignment and structure |
|---|
| >1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3zzx_A Thioredoxin; oxidoreductase; 1.88A {Litopenaeus vannamei} | Back alignment and structure |
|---|
| >2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A | Back alignment and structure |
|---|
| >2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A | Back alignment and structure |
|---|
| >2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A | Back alignment and structure |
|---|
| >1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A | Back alignment and structure |
|---|
| >3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A | Back alignment and structure |
|---|
| >2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3ga4_A Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit OST6; oxidoreductase, active site loop, redox state, membrane; HET: PG4; 1.30A {Saccharomyces cerevisiae} PDB: 3g7y_A 3g9b_A* | Back alignment and structure |
|---|
| >2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 | Back alignment and structure |
|---|
| >2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... | Back alignment and structure |
|---|
| >3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A | Back alignment and structure |
|---|
| >2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} | Back alignment and structure |
|---|
| >1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A | Back alignment and structure |
|---|
| >3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A | Back alignment and structure |
|---|
| >2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} | Back alignment and structure |
|---|
| >4f9z_D Endoplasmic reticulum resident protein 27; thioredoxin fold, ER foldase, ERP57, binding protein; HET: PE3 PE4; 2.20A {Homo sapiens} PDB: 2l4c_A | Back alignment and structure |
|---|
| >3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A | Back alignment and structure |
|---|
| >4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} | Back alignment and structure |
|---|
| >1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A | Back alignment and structure |
|---|
| >2qgv_A Hydrogenase-1 operon protein HYAE; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Shigella flexneri 2A} PDB: 2hfd_A | Back alignment and structure |
|---|
| >2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C | Back alignment and structure |
|---|
| >1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2c0g_A ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, protein disulfide isomerase, PIPE, dorsal-ventral patterning, chaperone, WIND mutants; 1.75A {Drosophila melanogaster} SCOP: a.71.1.1 c.47.1.7 PDB: 1ovn_A 2c0f_A 2c1y_A 2c0e_A | Back alignment and structure |
|---|
| >1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2qsi_A Putative hydrogenase expression/formation protein; HUPG, MCS SAD, structural genomics, protein structure initiative; 1.80A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A | Back alignment and structure |
|---|
| >2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* | Back alignment and structure |
|---|
| >1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A | Back alignment and structure |
|---|
| >3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A | Back alignment and structure |
|---|
| >2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A | Back alignment and structure |
|---|
| >1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >4f9z_D Endoplasmic reticulum resident protein 27; thioredoxin fold, ER foldase, ERP57, binding protein; HET: PE3 PE4; 2.20A {Homo sapiens} PDB: 2l4c_A | Back alignment and structure |
|---|
| >2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A | Back alignment and structure |
|---|
| >3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} | Back alignment and structure |
|---|
| >2qc7_A ERP31, ERP28, endoplasmic reticulum protein ERP29; B domain (residues 33-153), D domain (residues 154-261), CHA; 2.90A {Homo sapiens} PDB: 1g7e_A 1g7d_A | Back alignment and structure |
|---|
| >1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A | Back alignment and structure |
|---|
| >1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A | Back alignment and structure |
|---|
| >2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C | Back alignment and structure |
|---|
| >2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} | Back alignment and structure |
|---|
| >3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B | Back alignment and structure |
|---|
| >2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* | Back alignment and structure |
|---|
| >3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... | Back alignment and structure |
|---|
| >2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} | Back alignment and structure |
|---|
| >1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A | Back alignment and structure |
|---|
| >2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A | Back alignment and structure |
|---|
| >1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A | Back alignment and structure |
|---|
| >2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii} | Back alignment and structure |
|---|
| >3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} | Back alignment and structure |
|---|
| >3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} SCOP: c.47.1.0 PDB: 1xbs_A | Back alignment and structure |
|---|
| >2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} | Back alignment and structure |
|---|
| >2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A | Back alignment and structure |
|---|
| >1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 | Back alignment and structure |
|---|
| >3evi_A Phosducin-like protein 2; alpha beta, 3-layer(ABA) sandwich, unknown function; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3qcp_A QSOX from trypanosoma brucei (tbqsox); ERV fold, thioredoxin fold, sulfhydryl oxidase, oxidoreducta; HET: FAD; 2.30A {Trypanosoma brucei} PDB: 3qd9_A* | Back alignment and structure |
|---|
| >1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A | Back alignment and structure |
|---|
| >2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A | Back alignment and structure |
|---|
| >2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A | Back alignment and structure |
|---|
| >3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A | Back alignment and structure |
|---|
| >1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J | Back alignment and structure |
|---|
| >2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A | Back alignment and structure |
|---|
| >1qgv_A Spliceosomal protein U5-15KD; snRNP, thioredoxin, transcription; 1.40A {Homo sapiens} SCOP: c.47.1.8 PDB: 1syx_A 1pqn_A | Back alignment and structure |
|---|
| >1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A | Back alignment and structure |
|---|
| >3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A | Back alignment and structure |
|---|
| >1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 | Back alignment and structure |
|---|
| >2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa} | Back alignment and structure |
|---|
| >1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A | Back alignment and structure |
|---|
| >2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2trc_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; 2.40A {Rattus norvegicus} SCOP: c.47.1.6 | Back alignment and structure |
|---|
| >1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1a0r_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; HET: FAR; 2.80A {Bos taurus} SCOP: c.47.1.6 PDB: 1b9y_C 1b9x_C | Back alignment and structure |
|---|
| >1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A | Back alignment and structure |
|---|
| >2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A | Back alignment and structure |
|---|
| >2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A | Back alignment and structure |
|---|
| >3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3v1w_A* 3trq_A* 3trp_A* 3uom_A | Back alignment and structure |
|---|
| >3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP} | Back alignment and structure |
|---|
| >3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >2djk_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp2_A | Back alignment and structure |
|---|
| >2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} | Back alignment and structure |
|---|
| >1wou_A Thioredoxin -related protein, 14 kDa; electron transport; 1.80A {Homo sapiens} SCOP: c.47.1.16 PDB: 1v9w_A | Back alignment and structure |
|---|
| >2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2h8l_A Protein disulfide-isomerase A3; thioredoxin-like fold; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3f9u_A Putative exported cytochrome C biogenesis-related; exported cytochrome C biogenesis-related protein, bacteroide fragilis; 2.20A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A | Back alignment and structure |
|---|
| >1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3ec3_A Protein disulfide-isomerase A4; thioredoxin-like fold, endoplasmic reticulum, glycoprotein, redox-active center; 1.92A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3dml_A Putative uncharacterized protein; thioredoxin, oxidoreductase, sulfur oxidation, thiol- disulfide oxidoreductase; HET: MSE; 1.90A {Paracoccus denitrificans} PDB: 3d4t_A* | Back alignment and structure |
|---|
| >2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} | Back alignment and structure |
|---|
| >3iv4_A Putative oxidoreductase; APC23140, meticillin-resistant staphylococcus aureus, oxidor thioredoxin fold, structural genomics, PSI-2; HET: MSE; 1.50A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A | Back alignment and structure |
|---|
| >1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A | Back alignment and structure |
|---|
| >3kp9_A Vkorc1/thioredoxin domain protein; warfarin, disulfide formation, blood coagulation, oxidoreduc blood coagulation,oxidoreductase; HET: U10; 3.60A {Synechococcus SP} | Back alignment and structure |
|---|
| >2h30_A Thioredoxin, peptide methionine sulfoxide reductase MSRA/MSRB; reduced, thiol-disulfide exchange, oxidoreductase; 1.60A {Neisseria gonorrhoeae} PDB: 2jzr_A 2jzs_A 2k9f_A 2fy6_A | Back alignment and structure |
|---|
| >3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3ph9_A Anterior gradient protein 3 homolog; thioredoxin fold, protein disulfide isomerase, endoplasmic R isomerase; 1.83A {Homo sapiens} SCOP: c.47.1.0 PDB: 2lns_A 2lnt_A | Back alignment and structure |
|---|
| >3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A | Back alignment and structure |
|---|
| >2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} | Back alignment and structure |
|---|
| >3ira_A Conserved protein; methanosarcina mazei,structural genomics, MCSG, protein structure initiative, midwest center for STRU genomics; 2.10A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3lwa_A Secreted thiol-disulfide isomerase; thioredoxin, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.75A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >2b1k_A Thiol:disulfide interchange protein DSBE; C-terminal thioredoxin-like domain, N-terminal beta-sheet, fingerprint rigion, oxidoreductase; 1.90A {Escherichia coli} PDB: 3k8n_A 2g0f_A 1z5y_E 2b1l_A | Back alignment and structure |
|---|
| >3lor_A Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, structural genomics, midwest CE structural genomics; HET: MSE; 2.20A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3eyt_A Uncharacterized protein SPOA0173; thioredoxin-like superfamily protein SPOA0173, silicibacter DSS, structural genomics, PSI-2; 1.95A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} | Back alignment and structure |
|---|
| >1z6n_A Hypothetical protein PA1234; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.47.1.1 PDB: 3lef_A | Back alignment and structure |
|---|
| >1i5g_A Tryparedoxin II; electron transport; HET: TS5; 1.40A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1o6j_A 1o81_A 1oc8_A 1oc9_B 1fg4_A 1oc9_A | Back alignment and structure |
|---|
| >3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A | Back alignment and structure |
|---|
| >1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A | Back alignment and structure |
|---|
| >3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15} | Back alignment and structure |
|---|
| >3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15} | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3s9f_A Tryparedoxin; thioredoxin fold, disulfide reductase, electron transport; 1.80A {Leishmania major} | Back alignment and structure |
|---|
| >3bj5_A Protein disulfide-isomerase; thioredoxin fold, chaperone, endoplasmic reticulum, isomeras membrane, redox-active center; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2cvb_A Probable thiol-disulfide isomerase/thioredoxin; redox protein, structural genomics, riken struc genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.47.1.10 PDB: 2ywo_A | Back alignment and structure |
|---|
| >2ywi_A Hypothetical conserved protein; uncharacterized conserved protein, NPPSFA, national project protein structural and functional analyses; 1.60A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >2hyx_A Protein DIPZ; thioredoxin fold, jelly-roll, structural genomics, TB struct genomics consortium, TBSGC, unknown function; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1jfu_A Thiol:disulfide interchange protein TLPA; thioredoxin-like, double disulfide bridge, membrane protein; 1.60A {Bradyrhizobium japonicum} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2l4c_A Endoplasmic reticulum resident protein 27; ERP27, PDI, B domain, peptide binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lus_A Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carcinoscorpius rotundicauda} | Back alignment and structure |
|---|
| >2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A | Back alignment and structure |
|---|
| >3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, thiol-disulfide oxidoreduct TLPA-like family, PSI-2; 1.74A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3kh7_A Thiol:disulfide interchange protein DSBE; TRX-like, thiol-disulfide exchange, cell inner membrane, CYT C-type biogenesis, disulfide bond; 1.75A {Pseudomonas aeruginosa} PDB: 3kh9_A | Back alignment and structure |
|---|
| >2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24 | Back alignment and structure |
|---|
| >2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea} | Back alignment and structure |
|---|
| >2k6v_A Putative cytochrome C oxidase assembly protein; thioredoxin fold, electron transfer protein, metal binding protein, electron transport; NMR {Thermus thermophilus} | Back alignment and structure |
|---|
| >3cmi_A Peroxiredoxin HYR1; thioredoxin-like fold, oxidoreductase, peroxidase, redox-ACT center; 2.02A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A | Back alignment and structure |
|---|
| >2vup_A Glutathione peroxidase-like protein; oxidoreductase, trypanothione, dithiol-dependant peroxidase; 2.10A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >2ggt_A SCO1 protein homolog, mitochondrial; copper chaperone, Cu-binding protein, mitochondrial assembly factor, redox, nickel, disuplhide, mitochondrion; 2.40A {Homo sapiens} SCOP: c.47.1.10 PDB: 2gqk_A 2gql_A 2gqm_A 2gt5_A 2gt6_A 2gvp_A 2hrf_A 2hrn_A 1wp0_A | Back alignment and structure |
|---|
| >2ls5_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, NEW structural genomics research consortium; NMR {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2p5q_A Glutathione peroxidase 5; thioredoxin fold, oxidoreductase; 2.00A {Populus trichocarpa x populusdeltoides} PDB: 2p5r_A | Back alignment and structure |
|---|
| >2p31_A CL683, glutathione peroxidase 7; thioredoxin fold, NPGPX, phospholipid hydroperoxidase, struc genomics, structural genomics consortium, SGC; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A | Back alignment and structure |
|---|
| >1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2rli_A SCO2 protein homolog, mitochondrial; copper protein, thioredoxin fold, metal transport, structural genomics, spine2-complexes; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3dwv_A Glutathione peroxidase-like protein; alpha beta, 3-layer(ABA) sandwich, glutaredoxin fold, oxidor peroxidase; 1.41A {Trypanosoma brucei} PDB: 2rm5_A 2rm6_A 3e0u_A | Back alignment and structure |
|---|
| >3u5r_E Uncharacterized protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, hypothetical protein; 2.05A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1eej_A Thiol:disulfide interchange protein; oxidoreductase, protein disulfide isomerase, protein folding, redox protein, redox-active center; HET: MES; 1.90A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1tjd_A 1jzd_A 1jzo_A 1g0t_A 2iyj_A | Back alignment and structure |
|---|
| >2v1m_A Glutathione peroxidase; selenium, selenocysteine, oxidoreductase, lipid peroxidase, schistosoma detoxification pathway; 1.00A {Schistosoma mansoni} PDB: 2wgr_A | Back alignment and structure |
|---|
| >4fo5_A Thioredoxin-like protein; AHPC/TSA family protein, structural genomics, joint center F structural genomics, JCSG; 2.02A {Parabacteroides distasonis} | Back alignment and structure |
|---|
| >2obi_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase (GPX4); human GPX4, selenoprotein, thioredoxin-fold, anti-oxidatve defense system; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3gyk_A 27KDA outer membrane protein; APC61738.2, silicibacter pomeroyi DSS-3, thioredoxin-like, oxidoreductase, structural genomics, PSI-2; HET: MSE; 1.76A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >1we0_A Alkyl hydroperoxide reductase C; peroxiredoxin, AHPC, oxidoreductase; 2.90A {Amphibacillus xylanus} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >1zof_A Alkyl hydroperoxide-reductase; decamer, toroide-shaped complex, oxidoreductase; 2.95A {Helicobacter pylori} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3zzx_A Thioredoxin; oxidoreductase; 1.88A {Litopenaeus vannamei} | Back alignment and structure |
|---|
| >2f8a_A Glutathione peroxidase 1; thioredoxin fold, structural genomics, structural genomics consortium, SGC, oxidoreductase; 1.50A {Homo sapiens} SCOP: c.47.1.10 PDB: 1gp1_A 2he3_A | Back alignment and structure |
|---|
| >1t3b_A Thiol:disulfide interchange protein DSBC; oxidoreductase, protein disulfide isomerase, protein folding, redox protein; 2.50A {Haemophilus influenzae} SCOP: c.47.1.9 d.17.3.1 | Back alignment and structure |
|---|
| >2bmx_A Alkyl hydroperoxidase C; peroxiredoxin, antioxidant defense system, oxidoreductase, structural proteomics in EURO spine; 2.4A {Mycobacterium tuberculosis} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3kij_A Probable glutathione peroxidase 8; human PDI-peroxidase, membrane, oxidoreductase, transmembrane; 1.80A {Homo sapiens} SCOP: c.47.1.0 PDB: 3cyn_A | Back alignment and structure |
|---|
| >3drn_A Peroxiredoxin, bacterioferritin comigratory prote homolog; bacterioferritin comigratory protein, oxidore; HET: CIT; 2.15A {Sulfolobus solfataricus} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >1xzo_A BSSCO, hypothetical protein YPMQ; thioredoxin-like fold, structural genomics, montreal-kingsto bacterial structural genomics initiative, BSGI; 1.70A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1on4_A | Back alignment and structure |
|---|
| >2qc7_A ERP31, ERP28, endoplasmic reticulum protein ERP29; B domain (residues 33-153), D domain (residues 154-261), CHA; 2.90A {Homo sapiens} PDB: 1g7e_A 1g7d_A | Back alignment and structure |
|---|
| >1xvw_A Hypothetical protein RV2238C/MT2298; thioredoxin fold, oxidized cystein sulfenic acid, structural genomics, PSI; 1.90A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1xxu_A | Back alignment and structure |
|---|
| >2gs3_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase; GSHPX-4,phospholipid hydroperoxide; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2qsi_A Putative hydrogenase expression/formation protein; HUPG, MCS SAD, structural genomics, protein structure initiative; 1.80A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >2l4c_A Endoplasmic reticulum resident protein 27; ERP27, PDI, B domain, peptide binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1un2_A DSBA, thiol-disulfide interchange protein; disulfide oxidoreductase, oxidoreductase, protein disulfide isomerase, protein folding, thioredoxin; 2.4A {Escherichia coli} SCOP: c.47.1.13 | Back alignment and structure |
|---|
| >2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2qgv_A Hydrogenase-1 operon protein HYAE; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Shigella flexneri 2A} PDB: 2hfd_A | Back alignment and structure |
|---|
| >2h01_A 2-Cys peroxiredoxin; thioredoxin peroxidase, structural genomics, SGC, structural genomics consortium, oxidoreductase; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A | Back alignment and structure |
|---|
| >2djk_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp2_A | Back alignment and structure |
|---|
| >2c0g_A ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, protein disulfide isomerase, PIPE, dorsal-ventral patterning, chaperone, WIND mutants; 1.75A {Drosophila melanogaster} SCOP: a.71.1.1 c.47.1.7 PDB: 1ovn_A 2c0f_A 2c1y_A 2c0e_A | Back alignment and structure |
|---|
| >3ga4_A Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit OST6; oxidoreductase, active site loop, redox state, membrane; HET: PG4; 1.30A {Saccharomyces cerevisiae} PDB: 3g7y_A 3g9b_A* | Back alignment and structure |
|---|
| >1zye_A Thioredoxin-dependent peroxide reductase; catenane, dodecamer, peroxiredoxin, oxidoreductase; 3.30A {Bos taurus} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3hd5_A Thiol:disulfide interchange protein DSBA; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.35A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A | Back alignment and structure |
|---|
| >1uul_A Tryparedoxin peroxidase homologue; peroxiredoxin, oxidoreductase; 2.8A {Trypanosoma cruzi} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3h93_A Thiol:disulfide interchange protein DSBA; disulfide bond, redox-active center, transcription regulator; HET: MSE GOL; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A | Back alignment and structure |
|---|
| >2b7k_A SCO1 protein; metallochaperone, cytochrome C oxidase, metal binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 PDB: 2b7j_A | Back alignment and structure |
|---|
| >2znm_A Thiol:disulfide interchange protein DSBA; thioredoxin fold, DSBA-like, oxidoreductase; 2.30A {Neisseria meningitidis serogroup B} PDB: 3dvx_A | Back alignment and structure |
|---|
| >3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A | Back alignment and structure |
|---|
| >2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 | Back alignment and structure |
|---|
| >3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* | Back alignment and structure |
|---|
| >3gkn_A Bacterioferritin comigratory protein; BCP, PRX, atypical 2-Cys, oxidoreduc; HET: BIH; 1.47A {Xanthomonas campestris PV} PDB: 3gkk_A 3gkm_A | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} | Back alignment and structure |
|---|
| >3ztl_A Thioredoxin peroxidase; oxidoreductase, reductase, schistosomiasis, thioredoxin fold; 3.00A {Schistosoma mansoni} PDB: 3zvj_A 3zvj_D | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* | Back alignment and structure |
|---|
| >2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 | Back alignment and structure |
|---|
| >1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v58_A Thiol:disulfide interchange protein DSBG; reduced DSBG, redox protein, protein disulfide isomerase, thioredoxin fold; 1.70A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1v57_A 2h0i_A 2h0h_A 2h0g_A 2iy2_A | Back alignment and structure |
|---|
| >3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... | Back alignment and structure |
|---|
| >1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* | Back alignment and structure |
|---|
| >2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A | Back alignment and structure |
|---|
| >1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} | Back alignment and structure |
|---|
| >3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A | Back alignment and structure |
|---|
| >3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} | Back alignment and structure |
|---|
| >4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} | Back alignment and structure |
|---|
| >1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A | Back alignment and structure |
|---|
| >2i81_A 2-Cys peroxiredoxin; structural genomics consortium, SGC, oxidoreductase; 2.45A {Plasmodium vivax sai-1} PDB: 2h66_A | Back alignment and structure |
|---|
| >2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A | Back alignment and structure |
|---|
| >2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} | Back alignment and structure |
|---|
| >3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... | Back alignment and structure |
|---|
| >3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A | Back alignment and structure |
|---|
| >1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A | Back alignment and structure |
|---|
| >1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1xvq_A Thiol peroxidase; thioredoxin fold, structural genomics, PSI, protein structur initiative, TB structural genomics consortium, TBSGC; 1.75A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1y25_A | Back alignment and structure |
|---|
| >2i3y_A Epididymal secretory glutathione peroxidase; thioredoxin fold, epididymal androgen related protein, struc genomics, structural genomics consortium; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2a4v_A Peroxiredoxin DOT5; yeast nuclear thiol peroxidase, atypical 2-Cys peroxiredoxin, oxidoreductase; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} | Back alignment and structure |
|---|
| >2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} | Back alignment and structure |
|---|
| >2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} | Back alignment and structure |
|---|
| >3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} | Back alignment and structure |
|---|
| >1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A | Back alignment and structure |
|---|
| >1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C | Back alignment and structure |
|---|
| >2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A | Back alignment and structure |
|---|
| >2jsy_A Probable thiol peroxidase; solution structure, antioxidant, oxidoreductase; NMR {Bacillus subtilis} PDB: 2jsz_A | Back alignment and structure |
|---|
| >1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A | Back alignment and structure |
|---|
| >1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii} | Back alignment and structure |
|---|
| >2c0d_A Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, thioredoxin dependant, mitochondrial, antioxidant, oxidoreductase, redox-active center; 1.78A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B | Back alignment and structure |
|---|
| >2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B | Back alignment and structure |
|---|
| >1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A | Back alignment and structure |
|---|
| >2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4g2e_A Peroxiredoxin; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 1.40A {Sulfolobus tokodaii} PDB: 2ywn_A 3hjp_A | Back alignment and structure |
|---|
| >2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* | Back alignment and structure |
|---|
| >2r37_A Glutathione peroxidase 3; plasma, structural genomics consort oxidoreductase, secreted, selenium, selenocysteine; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A | Back alignment and structure |
|---|
| >2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A | Back alignment and structure |
|---|
| >2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A | Back alignment and structure |
|---|
| >1z6m_A Conserved hypothetical protein; structural genomics, MCSG,, protein structure initiative, midwest center for structural genomics; HET: MSE; 1.30A {Enterococcus faecalis} SCOP: c.47.1.13 | Back alignment and structure |
|---|
| >2pn8_A Peroxiredoxin-4; thioredoxin, oxidoreductase, structural genomics consortium, SGC; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3ixr_A Bacterioferritin comigratory protein; alpha beta protein, oxidoreductase; 1.60A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* | Back alignment and structure |
|---|
| >3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} | Back alignment and structure |
|---|
| >1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2rem_A Disulfide oxidoreductase; disulfide oxidoreductase, DSBA, thioredoxin fold, redox- active center; 1.90A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1n8j_A AHPC, alkyl hydroperoxide reductase C22 protein; peroxiredoxin, decamer, antioxidant, peroxidase, AHPF, oxidoreductase; 2.17A {Salmonella typhimurium} SCOP: c.47.1.10 PDB: 1yep_A 1yf1_A 1yf0_A 1yex_A 3emp_A | Back alignment and structure |
|---|
| >3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* | Back alignment and structure |
|---|
| >1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* | Back alignment and structure |
|---|
| >3bj5_A Protein disulfide-isomerase; thioredoxin fold, chaperone, endoplasmic reticulum, isomeras membrane, redox-active center; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1q98_A Thiol peroxidase, TPX; structural genomics, NYSGXRC, PSI, protein structure initiative; 1.90A {Haemophilus influenzae} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A | Back alignment and structure |
|---|
| >3qpm_A Peroxiredoxin; oxidoreductase, thioredoxin fold, peroxidase; 1.90A {Larimichthys crocea} | Back alignment and structure |
|---|
| >2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A | Back alignment and structure |
|---|
| >2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A | Back alignment and structure |
|---|
| >1tp9_A Peroxiredoxin, PRX D (type II); oligomer, thioredoxin fold, oxidoreductase; 1.62A {Populus trichocarpa} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa} | Back alignment and structure |
|---|
| >1wou_A Thioredoxin -related protein, 14 kDa; electron transport; 1.80A {Homo sapiens} SCOP: c.47.1.16 PDB: 1v9w_A | Back alignment and structure |
|---|
| >3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} SCOP: c.47.1.0 PDB: 1xbs_A | Back alignment and structure |
|---|
| >3tjj_A Peroxiredoxin-4; thioredoxin fold, sulfenylation, endoplasmic reticulum, oxidoreductase; HET: CSO; 1.91A {Homo sapiens} PDB: 3tjk_A 3tjb_A 3tjf_A 3tjg_A 3tkq_A 3tkp_A 3tks_A 3tkr_A 3tks_C | Back alignment and structure |
|---|
| >2trc_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; 2.40A {Rattus norvegicus} SCOP: c.47.1.6 | Back alignment and structure |
|---|
| >3me7_A Putative uncharacterized protein; electron transfer protein, electron transport, structural GE PSI-2, protein structure initiative; 1.50A {Aquifex aeolicus} PDB: 3me8_A | Back alignment and structure |
|---|
| >1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3hz8_A Thiol:disulfide interchange protein DSBA; thiol-oxidoreductase, disulfide bond; 1.45A {Neisseria meningitidis MC58} PDB: 3dvw_A 3a3t_A | Back alignment and structure |
|---|
| >3iv4_A Putative oxidoreductase; APC23140, meticillin-resistant staphylococcus aureus, oxidor thioredoxin fold, structural genomics, PSI-2; HET: MSE; 1.50A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} | Back alignment and structure |
|---|
| >3evi_A Phosducin-like protein 2; alpha beta, 3-layer(ABA) sandwich, unknown function; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3gv1_A Disulfide interchange protein; neisseria gonorrhoeae (strain 700825 / FA 1090), DSBC, structural genomics, unknown funct 2; 2.00A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >4gqc_A Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, fully folded, locally unfolded, peroxide, DTT, structural genomics, riken; 2.00A {Aeropyrum pernix} PDB: 2cx3_A 2cx4_A 4gqf_A | Back alignment and structure |
|---|
| >2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} | Back alignment and structure |
|---|
| >1qgv_A Spliceosomal protein U5-15KD; snRNP, thioredoxin, transcription; 1.40A {Homo sapiens} SCOP: c.47.1.8 PDB: 1syx_A 1pqn_A | Back alignment and structure |
|---|
| >3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A | Back alignment and structure |
|---|
| >2pwj_A Mitochondrial peroxiredoxin; alpha and beta protein, oxidoreductase; 2.80A {Pisum sativum} | Back alignment and structure |
|---|
| >3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >2yzh_A Probable thiol peroxidase; redox protein, antioxidant, oxidoreductase, STRU genomics, NPPSFA; 1.85A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3l9v_A Putative thiol-disulfide isomerase or thioredoxin; thioredoxin-fold, SRGA, thiol-disulfide oxidoreductase, ISOM oxidoreductase; HET: PE8 P4C P6G; 2.15A {Salmonella enterica subsp} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >3feu_A Putative lipoprotein; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Vibrio fischeri} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3a2v_A Probable peroxiredoxin; thioredoxin peroxidase, hydrogen peroxide, antioxidant, oxidoreductase, redox-active center; 1.65A {Aeropyrum pernix} PDB: 1x0r_A 2zct_A 2nvl_A 2e2g_A 2cv4_A* 3a5w_A 2e2m_A 3a2x_A 3a2w_A | Back alignment and structure |
|---|
| >1psq_A Probable thiol peroxidase; structural genomics, NYSGXRC, PSI, structure initiative, NEW YORK SGX research center for STRU genomics; 2.30A {Streptococcus pneumoniae} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3zrd_A Thiol peroxidase; oxidoreductase, 2Cys peroxiredoxin, thioredoxin-fold, ROS PR; 1.74A {Yersinia pseudotuberculosis} PDB: 2xpe_A 2xpd_A 3zre_A 2yjh_A 4af2_A 3hvs_A* 1qxh_A* 3i43_A* 3hvv_A 3hvx_A | Back alignment and structure |
|---|
| >2wfc_A Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidant enzymes; 1.75A {Arenicola marina} | Back alignment and structure |
|---|
| >3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >1a0r_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; HET: FAR; 2.80A {Bos taurus} SCOP: c.47.1.6 PDB: 1b9y_C 1b9x_C | Back alignment and structure |
|---|
| >3uma_A Hypothetical peroxiredoxin protein; nysgrc, PSI biology, structural genomics, NEW YORK structura genomics research consortium; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* | Back alignment and structure |
|---|
| >2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} | Back alignment and structure |
|---|
| >3mng_A Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, substrate analog, DTT, oxidoreductase; 1.45A {Homo sapiens} SCOP: c.47.1.10 PDB: 2vl3_A 1oc3_A 2vl2_A 2vl9_A 1urm_A 1hd2_A 1h4o_A | Back alignment and structure |
|---|
| >1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A | Back alignment and structure |
|---|
| >3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3p7x_A Probable thiol peroxidase; thioredoxin fold, oxidoreductase; HET: PG4; 1.96A {Staphylococcus aureus} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A | Back alignment and structure |
|---|
| >2ec4_A FAS-associated factor 1; UAS domain, protein FAF1, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3qcp_A QSOX from trypanosoma brucei (tbqsox); ERV fold, thioredoxin fold, sulfhydryl oxidase, oxidoreducta; HET: FAD; 2.30A {Trypanosoma brucei} PDB: 3qd9_A* | Back alignment and structure |
|---|
| >1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A | Back alignment and structure |
|---|
| >2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* | Back alignment and structure |
|---|
| >1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3dml_A Putative uncharacterized protein; thioredoxin, oxidoreductase, sulfur oxidation, thiol- disulfide oxidoreductase; HET: MSE; 1.90A {Paracoccus denitrificans} PDB: 3d4t_A* | Back alignment and structure |
|---|
| >2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A | Back alignment and structure |
|---|
| >2v2g_A Peroxiredoxin 6; oxidoreductase, antioxidant enzymes; 1.60A {Arenicola marina} PDB: 2v32_A 2v41_A | Back alignment and structure |
|---|
| >3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* | Back alignment and structure |
|---|
| >4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3l9s_A Thiol:disulfide interchange protein; thioredoxin-fold, DSBA, thiol-disulfide oxidoreductase, DISU bond, redox-active center; 1.58A {Salmonella enterica subsp} SCOP: c.47.1.13 PDB: 1a23_A 1a24_A 1a2j_A 1a2l_A 1a2m_A 1dsb_A 1fvk_A 3dks_A 1bq7_A 1fvj_A 1acv_A 1u3a_A* 1ti1_A* 2hi7_A* 2leg_A* 2zup_A* 3e9j_B* 1ac1_A 2b6m_A 2b3s_A | Back alignment and structure |
|---|
| >2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} | Back alignment and structure |
|---|
| >3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >4hde_A SCO1/SENC family lipoprotein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; HET: MSE; 1.32A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3lor_A Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, structural genomics, midwest CE structural genomics; HET: MSE; 2.20A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >1prx_A HORF6; peroxiredoxin, hydrogen peroxide, redox regulation, cellular signaling, antioxidant; 2.00A {Homo sapiens} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3eyt_A Uncharacterized protein SPOA0173; thioredoxin-like superfamily protein SPOA0173, silicibacter DSS, structural genomics, PSI-2; 1.95A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} | Back alignment and structure |
|---|
| >2h30_A Thioredoxin, peptide methionine sulfoxide reductase MSRA/MSRB; reduced, thiol-disulfide exchange, oxidoreductase; 1.60A {Neisseria gonorrhoeae} PDB: 2jzr_A 2jzs_A 2k9f_A 2fy6_A | Back alignment and structure |
|---|
| >4dvc_A Thiol:disulfide interchange protein DSBA; pilus assembly, oxidoreductase, thioredoxin fold, D disulfide bond, DSBB; HET: DMS; 1.20A {Vibrio cholerae} PDB: 2ijy_A 1bed_A | Back alignment and structure |
|---|
| >2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} | Back alignment and structure |
|---|
| >3keb_A Probable thiol peroxidase; structural genomics, APC40679, PSI-2, Pro structure initiative; HET: MSE; 1.80A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15} | Back alignment and structure |
|---|
| >3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3f9u_A Putative exported cytochrome C biogenesis-related; exported cytochrome C biogenesis-related protein, bacteroide fragilis; 2.20A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24 | Back alignment and structure |
|---|
| >1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15} | Back alignment and structure |
|---|
| >3lwa_A Secreted thiol-disulfide isomerase; thioredoxin, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.75A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3c7m_A Thiol:disulfide interchange protein DSBA-like; redox protein, periplasm, redox-active center, oxidoreductase; HET: PGE; 1.55A {Escherichia coli} PDB: 3l9u_A | Back alignment and structure |
|---|
| >1xcc_A 1-Cys peroxiredoxin; unknown function, structural genomics, structural genomics consortium, SGC; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 PDB: 3tb2_A | Back alignment and structure |
|---|
| >3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, thiol-disulfide oxidoreduct TLPA-like family, PSI-2; 1.74A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP} | Back alignment and structure |
|---|
| >2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A | Back alignment and structure |
|---|
| >2axo_A Hypothetical protein ATU2684; alpha beta protein., structural genomics, PSI, protein struc initiative; 1.80A {Agrobacterium tumefaciens str} SCOP: c.47.1.19 | Back alignment and structure |
|---|
| >1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 | Back alignment and structure |
|---|
| >2b1k_A Thiol:disulfide interchange protein DSBE; C-terminal thioredoxin-like domain, N-terminal beta-sheet, fingerprint rigion, oxidoreductase; 1.90A {Escherichia coli} PDB: 3k8n_A 2g0f_A 1z5y_E 2b1l_A | Back alignment and structure |
|---|
| >2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3s9f_A Tryparedoxin; thioredoxin fold, disulfide reductase, electron transport; 1.80A {Leishmania major} | Back alignment and structure |
|---|
| >1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 699 | ||||
| d1fafa_ | 79 | a.2.3.1 (A:) Large T antigen, the N-terminal J dom | 7e-08 | |
| d1wjza_ | 94 | a.2.3.1 (A:) CSL-type zinc finger-containing prote | 9e-08 | |
| d1hdja_ | 77 | a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 | 4e-07 | |
| d1xbla_ | 75 | a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain | 4e-07 | |
| d2djja1 | 116 | c.47.1.2 (A:6-121) Protein disulfide isomerase, PD | 3e-04 | |
| d1nz6a_ | 98 | a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T | 4e-04 | |
| d1gh6a_ | 114 | a.2.3.1 (A:) Large T antigen, the N-terminal J dom | 7e-04 | |
| d1fpoa1 | 76 | a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma | 0.001 |
| >d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Long alpha-hairpin superfamily: Chaperone J-domain family: Chaperone J-domain domain: Large T antigen, the N-terminal J domain species: Murine polyomavirus [TaxId: 10634]
Score = 48.1 bits (114), Expect = 7e-08
Identities = 11/77 (14%), Positives = 30/77 (38%), Gaps = 3/77 (3%)
Query: 30 VLPRSFPPSHYDALGIKPY--SSVEQVKEAYEKFSSKWNSGEEIPSTADFLKIQYAYELL 87
VL R+ + L + ++++AY++ S + ++ S A ++ +
Sbjct: 4 VLSRADKERLLELLKLPRQLWGDFGRMQQAYKQQSLLLHP-DKGGSHALMQELNSLWGTF 62
Query: 88 TDPLWKRNYDVYGIDEQ 104
++ ++ G Q
Sbjct: 63 KTEVYNLRMNLGGTGFQ 79
|
| >d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
| >d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 | Back information, alignment and structure |
|---|
| >d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Length = 116 | Back information, alignment and structure |
|---|
| >d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 | Back information, alignment and structure |
|---|
| >d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 | Back information, alignment and structure |
|---|
| >d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 699 | |||
| d2b5ea4 | 119 | Protein disulfide isomerase, PDI {Baker's yeast (S | 99.84 | |
| d1a8ya1 | 124 | Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax | 99.81 | |
| d1meka_ | 120 | Protein disulfide isomerase, PDI {Human (Homo sapi | 99.81 | |
| d2djja1 | 116 | Protein disulfide isomerase, PDI {Fungi (Humicola | 99.8 | |
| d2c0ga2 | 122 | Windbeutel, N-terminal domain {Fruit fly (Drosophi | 99.8 | |
| d1thxa_ | 108 | Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} | 99.79 | |
| d1fb6a_ | 104 | Thioredoxin {Spinach (Spinacia oleracea), thioredo | 99.78 | |
| d1g7ea_ | 122 | Endoplasmic reticulum protein ERP29, N-terminal do | 99.78 | |
| d2b5ea1 | 140 | Protein disulfide isomerase, PDI {Baker's yeast (S | 99.77 | |
| d2trxa_ | 108 | Thioredoxin {Escherichia coli [TaxId: 562]} | 99.77 | |
| d1nw2a_ | 105 | Thioredoxin {Alicyclobacillus acidocaldarius, form | 99.76 | |
| d1dbya_ | 107 | Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 | 99.75 | |
| d1xbla_ | 75 | DnaJ chaperone, N-terminal (J) domain {Escherichia | 99.75 | |
| d1hdja_ | 77 | HSP40 {Human (Homo sapiens) [TaxId: 9606]} | 99.72 | |
| d1ep7a_ | 112 | Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 | 99.63 | |
| d1gh6a_ | 114 | Large T antigen, the N-terminal J domain {Simian v | 99.63 | |
| d1f9ma_ | 112 | Thioredoxin {Spinach (Spinacia oleracea), thioredo | 99.63 | |
| d1wjza_ | 94 | CSL-type zinc finger-containing protein 3 (J-domai | 99.6 | |
| d1fo5a_ | 85 | MJ0307, thioredoxin/glutaredoxin-like protein {Arc | 99.59 | |
| d1xwaa_ | 111 | Thioredoxin {Fruit fly (Drosophila melanogaster) [ | 99.58 | |
| d1xfla_ | 114 | Thioredoxin {Thale cress (Arabidopsis thaliana) [T | 99.57 | |
| d1syra_ | 103 | Thioredoxin {Malarial parasite (Plasmodium falcipa | 99.56 | |
| d1ti3a_ | 113 | Thioredoxin {European aspen (Populus tremula), thi | 99.56 | |
| d1gh2a_ | 107 | Thioredoxin-like protein, N-terminal domain {Human | 99.56 | |
| d2ifqa1 | 105 | Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} | 99.56 | |
| d1nhoa_ | 85 | MTH807, thioredoxin/glutaredoxin-like protein {Arc | 99.55 | |
| d2es7a1 | 119 | Hydrogenase-1 operon protein HyaE {Salmonella typh | 99.55 | |
| d1r26a_ | 113 | Thioredoxin {Trypanosoma brucei [TaxId: 5691]} | 99.54 | |
| d2hfda1 | 132 | Hydrogenase-1 operon protein HyaE {Escherichia col | 99.54 | |
| d1a8la2 | 107 | Protein disulfide isomerase, PDI {Archaeon Pyrococ | 99.54 | |
| d1fafa_ | 79 | Large T antigen, the N-terminal J domain {Murine p | 99.52 | |
| d1qgva_ | 137 | spliceosomal protein U5-15Kd {Human (Homo sapiens) | 99.49 | |
| d1zmaa1 | 115 | Bacterocin transport accessory protein Bta {Strept | 99.46 | |
| d1fpoa1 | 76 | HSC20 (HSCB), N-terminal (J) domain {Escherichia c | 99.4 | |
| d1hyua4 | 96 | Alkyl hydroperoxide reductase subunit F (AhpF), N- | 99.33 | |
| d1iura_ | 88 | Hypothetical protein KIAA0730 {Human (Homo sapiens | 99.33 | |
| d1nz6a_ | 98 | Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} | 99.33 | |
| d1woua_ | 119 | Putative 42-9-9 protein (thioredoxin containing pr | 99.31 | |
| d2fwha1 | 117 | Thiol:disulfide interchange protein DsbD, C-termin | 99.26 | |
| d2trcp_ | 217 | Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} | 98.82 | |
| d1bjxa_ | 110 | Protein disulfide isomerase, PDI {Human (Homo sapi | 98.55 | |
| d1sena_ | 135 | Thioredoxin-like protein p19, TLP19 {Human (Homo s | 98.52 | |
| d2fy6a1 | 143 | Peptide methionine sulfoxide reductase MsrA/MsrB, | 98.48 | |
| d1a8ya2 | 102 | Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax | 98.47 | |
| d1zzoa1 | 134 | Lipoprotein DsbF {Mycobacterium tuberculosis [TaxI | 98.46 | |
| d2djka1 | 133 | Protein disulfide isomerase, PDI {Fungi (Humicola | 98.37 | |
| d1lu4a_ | 134 | Soluble secreted antigen MPT53 {Mycobacterium tube | 98.3 | |
| d2b5xa1 | 143 | thiol:disulfide oxidoreductase YkuV {Bacillus subt | 98.2 | |
| d2dlxa1 | 147 | UBX domain-containing protein 7 {Human (Homo sapie | 98.19 | |
| d1z5ye1 | 136 | Thioredoxin-like protein CcmG (CycY, DsbE) {Escher | 98.17 | |
| d2b5ea4 | 119 | Protein disulfide isomerase, PDI {Baker's yeast (S | 98.14 | |
| d1st9a_ | 137 | Thiol-disulfide oxidoreductase ResA {Bacillus subt | 98.14 | |
| d1knga_ | 144 | Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyr | 98.13 | |
| d1wjka_ | 100 | Thioredoxin-like structure containing protein C330 | 98.07 | |
| d1i5ga_ | 144 | Tryparedoxin II {Crithidia fasciculata [TaxId: 565 | 98.06 | |
| d1thxa_ | 108 | Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} | 98.01 | |
| d1a8ya1 | 124 | Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax | 97.94 | |
| d1meka_ | 120 | Protein disulfide isomerase, PDI {Human (Homo sapi | 97.88 | |
| d1nw2a_ | 105 | Thioredoxin {Alicyclobacillus acidocaldarius, form | 97.86 | |
| d1fb6a_ | 104 | Thioredoxin {Spinach (Spinacia oleracea), thioredo | 97.84 | |
| d1dbya_ | 107 | Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 | 97.81 | |
| d1o73a_ | 144 | Tryparedoxin I {Trypanosoma brucei brucei [TaxId: | 97.79 | |
| d1ep7a_ | 112 | Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 | 97.77 | |
| d2c0ga2 | 122 | Windbeutel, N-terminal domain {Fruit fly (Drosophi | 97.71 | |
| d2djja1 | 116 | Protein disulfide isomerase, PDI {Fungi (Humicola | 97.71 | |
| d2trxa_ | 108 | Thioredoxin {Escherichia coli [TaxId: 562]} | 97.66 | |
| d1g7ea_ | 122 | Endoplasmic reticulum protein ERP29, N-terminal do | 97.65 | |
| d1o8xa_ | 144 | Tryparedoxin I {Crithidia fasciculata [TaxId: 5656 | 97.65 | |
| d2b5ea3 | 125 | Protein disulfide isomerase, PDI {Baker's yeast (S | 97.63 | |
| d1jfua_ | 176 | Membrane-anchored thioredoxin-like protein TlpA, s | 97.61 | |
| d1xwaa_ | 111 | Thioredoxin {Fruit fly (Drosophila melanogaster) [ | 97.61 | |
| d2b5ea1 | 140 | Protein disulfide isomerase, PDI {Baker's yeast (S | 97.6 | |
| d2cvba1 | 187 | Probable thiol-disulfide isomerase/thioredoxin TTH | 97.56 | |
| d1syra_ | 103 | Thioredoxin {Malarial parasite (Plasmodium falcipa | 97.55 | |
| d1fo5a_ | 85 | MJ0307, thioredoxin/glutaredoxin-like protein {Arc | 97.45 | |
| d2hfda1 | 132 | Hydrogenase-1 operon protein HyaE {Escherichia col | 97.36 | |
| d1gh2a_ | 107 | Thioredoxin-like protein, N-terminal domain {Human | 97.36 | |
| d1ti3a_ | 113 | Thioredoxin {European aspen (Populus tremula), thi | 97.32 | |
| d1nhoa_ | 85 | MTH807, thioredoxin/glutaredoxin-like protein {Arc | 97.29 | |
| d1f9ma_ | 112 | Thioredoxin {Spinach (Spinacia oleracea), thioredo | 97.25 | |
| d2es7a1 | 119 | Hydrogenase-1 operon protein HyaE {Salmonella typh | 97.24 | |
| d1r26a_ | 113 | Thioredoxin {Trypanosoma brucei [TaxId: 5691]} | 97.17 | |
| d1xfla_ | 114 | Thioredoxin {Thale cress (Arabidopsis thaliana) [T | 97.15 | |
| d1qgva_ | 137 | spliceosomal protein U5-15Kd {Human (Homo sapiens) | 97.11 | |
| d2ifqa1 | 105 | Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} | 97.06 | |
| d1zmaa1 | 115 | Bacterocin transport accessory protein Bta {Strept | 96.92 | |
| d1z6na1 | 166 | Hypothetical protein PA1234 {Pseudomonas aeruginos | 96.87 | |
| d2djka1 | 133 | Protein disulfide isomerase, PDI {Fungi (Humicola | 96.78 | |
| d1a8la2 | 107 | Protein disulfide isomerase, PDI {Archaeon Pyrococ | 96.76 | |
| d1woua_ | 119 | Putative 42-9-9 protein (thioredoxin containing pr | 96.61 | |
| d1eeja1 | 156 | Disulfide bond isomerase, DsbC, C-terminal domain | 96.18 | |
| d1bjxa_ | 110 | Protein disulfide isomerase, PDI {Human (Homo sapi | 95.98 | |
| d2b5ea3 | 125 | Protein disulfide isomerase, PDI {Baker's yeast (S | 95.67 | |
| d1hyua4 | 96 | Alkyl hydroperoxide reductase subunit F (AhpF), N- | 95.56 | |
| d2fwha1 | 117 | Thiol:disulfide interchange protein DsbD, C-termin | 95.29 | |
| d2cx4a1 | 160 | Bacterioferritin comigratory protein {Archaeon Aer | 95.05 | |
| d2trcp_ | 217 | Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} | 94.82 | |
| d1t3ba1 | 150 | Disulfide bond isomerase, DsbC, C-terminal domain | 94.64 | |
| d2bmxa1 | 169 | Alkyl hydroperoxide reductase AhpC {Mycobacterium | 94.63 | |
| d2a4va1 | 156 | Peroxiredoxin dot5 {Baker's yeast (Saccharomyces c | 94.35 | |
| d1a8ya2 | 102 | Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax | 94.32 | |
| d1e2ya_ | 167 | Tryparedoxin peroxidase (thioredoxin peroxidase ho | 93.99 | |
| d1r7ha_ | 74 | Glutaredoxin-like NRDH-redoxin {Corynebacterium am | 93.45 | |
| d1iloa_ | 77 | MTH985, a thioredoxin {Archaeon Methanobacterium t | 93.29 | |
| d1we0a1 | 166 | Alkyl hydroperoxide reductase AhpC {Amphibacillus | 92.9 | |
| d2dlxa1 | 147 | UBX domain-containing protein 7 {Human (Homo sapie | 92.11 | |
| d2h01a1 | 170 | Thioredoxin peroxidase 2 (thioredoxin peroxidase B | 91.89 | |
| d1zofa1 | 170 | Thioredoxin reductase TsaA {Helicobacter pylori [T | 91.55 | |
| d1h75a_ | 76 | Glutaredoxin-like NRDH-redoxin {Escherichia coli [ | 91.51 | |
| d2zcta1 | 237 | Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} | 90.62 | |
| d1qxha_ | 164 | Thiol peroxidase Tpx {Escherichia coli [TaxId: 562 | 90.32 | |
| d1a8la1 | 119 | Protein disulfide isomerase, PDI {Archaeon Pyrococ | 89.66 | |
| d1a8ya3 | 119 | Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax | 89.4 | |
| d1zyea1 | 158 | Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [ | 89.29 | |
| d1a8la1 | 119 | Protein disulfide isomerase, PDI {Archaeon Pyrococ | 88.61 | |
| d1egoa_ | 85 | Glutaredoxin (Grx, thioltransferase) {Escherichia | 88.22 | |
| d1xvwa1 | 153 | Putative peroxiredoxin Rv2238c/MT2298 {Mycobacteri | 87.83 | |
| d2f8aa1 | 184 | Glutathione peroxidase {Human (Homo sapiens) [TaxI | 87.53 | |
| d1q98a_ | 164 | Thiol peroxidase Tpx {Haemophilus influenzae [TaxI | 87.46 | |
| d1uula_ | 194 | Tryparedoxin peroxidase (thioredoxin peroxidase ho | 85.12 | |
| d1n8ja_ | 186 | Alkyl hydroperoxide reductase AhpC {Salmonella typ | 84.31 | |
| d1nm3a1 | 74 | C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus | 83.97 | |
| d1beda_ | 181 | Disulfide-bond formation facilitator (DsbA) {Vibri | 83.86 | |
| d1z6ma1 | 172 | Hypothetical protein EF0770 {Enterococcus faecalis | 83.33 | |
| d2b5ea2 | 98 | Protein disulfide isomerase, PDI {Baker's yeast (S | 83.16 | |
| d1wp0a1 | 160 | Thioredoxin-like protein Sco1 (YpmQ), soluble doma | 82.28 | |
| d1xzoa1 | 172 | Thioredoxin-like protein Sco1 (YpmQ), soluble doma | 81.26 |
| >d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Thioredoxin fold superfamily: Thioredoxin-like family: PDI-like domain: Protein disulfide isomerase, PDI species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.84 E-value=5.9e-22 Score=179.24 Aligned_cols=109 Identities=14% Similarity=0.194 Sum_probs=97.2
Q ss_pred CCcceEEEecCCCCcccccCCCcEEEEEeccCCCCCCCcchHHHHHHHHhhc-ccceeeeeccchhhhhHHHHhCCCCcc
Q 005374 133 HSVHAFNVVTSEDFPSIFHDSKPWLIQVYSDGSYLCGQFSGAWKTIAALLEG-IANTGMVELGDIRLATHLAERKPIGQI 211 (699)
Q Consensus 133 ~~~~~V~~Lt~~nF~~~v~~~~~~lV~FYapwC~hCk~l~p~~~~~A~~L~g-~~~va~Vdc~~~~~~~~L~~k~~i~~~ 211 (699)
+.++.|.+||.+||++.|.+++.|||+||+|||+||+++.|+|+++|..+.+ .+.||+|||++++. ||++++
T Consensus 7 ~~~s~v~~lt~~~f~~~i~~~~~~lV~fya~wC~~C~~~~~~~~~la~~~~~~~v~~~~vd~~~~~~---l~~~~~---- 79 (119)
T d2b5ea4 7 PEDSAVVKLATDSFNEYIQSHDLVLAEFFAPWCGHCKNMAPEYVKAAETLVEKNITLAQIDCTENQD---LCMEHN---- 79 (119)
T ss_dssp CTTSSCEECCTTTHHHHHTTCSEEEEEEECTTCHHHHHHHHHHHHHHHHTTTTTCEEEEEETTTCHH---HHHHTT----
T ss_pred CCCCccEEcCHHHHHHHHhcCCeEEEEEECCccCcccccchhhhhhhhhhcccceeeeeeeccchHH---HHHHhc----
Confidence 3466789999999999998899999999999999999999999999999864 46999999996655 999998
Q ss_pred cccccccEEEEcCCCCCCCCccccccCCcCHHHHHHHHHHH
Q 005374 212 FFRRGLPSLVAFPPGCKSSDCMTRFEGELSVDAVTDWFATA 252 (699)
Q Consensus 212 f~V~gyPTl~~f~~g~~~~~~~~~Y~G~rs~~~Iv~fi~k~ 252 (699)
|++||||++|++|... ....|.|+++.++|++|+.++
T Consensus 80 --v~~~Pti~~f~~g~~~--~~~~y~g~~~~~~l~~fi~k~ 116 (119)
T d2b5ea4 80 --IPGFPSLKIFKNSDVN--NSIDYEGPRTAEAIVQFMIKQ 116 (119)
T ss_dssp --CCSSSEEEEEETTCTT--CEEECCSCCSHHHHHHHHHHH
T ss_pred --cccCCeEEEEECCEEe--eeEEecCCCCHHHHHHHHHHh
Confidence 7799999999988654 456799999999999999987
|
| >d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} | Back information, alignment and structure |
|---|
| >d2c0ga2 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} | Back information, alignment and structure |
|---|
| >d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1g7ea_ c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} | Back information, alignment and structure |
|---|
| >d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} | Back information, alignment and structure |
|---|
| >d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} | Back information, alignment and structure |
|---|
| >d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2trcp_ c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1bjxa_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sena_ c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fy6a1 c.47.1.10 (A:33-175) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]} | Back information, alignment and structure |
|---|
| >d1a8ya2 c.47.1.3 (A:127-228) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1zzoa1 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2djka1 c.47.1.2 (A:1-133) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} | Back information, alignment and structure |
|---|
| >d1lu4a_ c.47.1.10 (A:) Soluble secreted antigen MPT53 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2b5xa1 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase YkuV {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z5ye1 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG (CycY, DsbE) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1st9a_ c.47.1.10 (A:) Thiol-disulfide oxidoreductase ResA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1knga_ c.47.1.10 (A:) Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyrhizobium japonicum [TaxId: 375]} | Back information, alignment and structure |
|---|
| >d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1i5ga_ c.47.1.10 (A:) Tryparedoxin II {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} | Back information, alignment and structure |
|---|
| >d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} | Back information, alignment and structure |
|---|
| >d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1o73a_ c.47.1.10 (A:) Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 5702]} | Back information, alignment and structure |
|---|
| >d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2c0ga2 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} | Back information, alignment and structure |
|---|
| >d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g7ea_ c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1o8xa_ c.47.1.10 (A:) Tryparedoxin I {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d2b5ea3 c.47.1.2 (A:240-364) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jfua_ c.47.1.10 (A:) Membrane-anchored thioredoxin-like protein TlpA, soluble domain {Bradyrhizobium japonicum [TaxId: 375]} | Back information, alignment and structure |
|---|
| >d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cvba1 c.47.1.10 (A:2-188) Probable thiol-disulfide isomerase/thioredoxin TTHA0593 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} | Back information, alignment and structure |
|---|
| >d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1z6na1 c.47.1.1 (A:1-166) Hypothetical protein PA1234 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2djka1 c.47.1.2 (A:1-133) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} | Back information, alignment and structure |
|---|
| >d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eeja1 c.47.1.9 (A:61-216) Disulfide bond isomerase, DsbC, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1bjxa_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b5ea3 c.47.1.2 (A:240-364) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2cx4a1 c.47.1.10 (A:4-163) Bacterioferritin comigratory protein {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2trcp_ c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1t3ba1 c.47.1.9 (A:61-210) Disulfide bond isomerase, DsbC, C-terminal domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2bmxa1 c.47.1.10 (A:2-170) Alkyl hydroperoxide reductase AhpC {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2a4va1 c.47.1.10 (A:59-214) Peroxiredoxin dot5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1a8ya2 c.47.1.3 (A:127-228) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1e2ya_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} | Back information, alignment and structure |
|---|
| >d1iloa_ c.47.1.1 (A:) MTH985, a thioredoxin {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1we0a1 c.47.1.10 (A:1-166) Alkyl hydroperoxide reductase AhpC {Amphibacillus xylanus [TaxId: 1449]} | Back information, alignment and structure |
|---|
| >d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h01a1 c.47.1.10 (A:2-171) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Plasmodium yoelii [TaxId: 5861]} | Back information, alignment and structure |
|---|
| >d1zofa1 c.47.1.10 (A:1-170) Thioredoxin reductase TsaA {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2zcta1 c.47.1.10 (A:6-242) Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1qxha_ c.47.1.10 (A:) Thiol peroxidase Tpx {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a8la1 c.47.1.2 (A:1-119) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1a8ya3 c.47.1.3 (A:229-347) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1zyea1 c.47.1.10 (A:6-163) Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1a8la1 c.47.1.2 (A:1-119) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xvwa1 c.47.1.10 (A:1-153) Putative peroxiredoxin Rv2238c/MT2298 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2f8aa1 c.47.1.10 (A:12-195) Glutathione peroxidase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q98a_ c.47.1.10 (A:) Thiol peroxidase Tpx {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1uula_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1n8ja_ c.47.1.10 (A:) Alkyl hydroperoxide reductase AhpC {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1beda_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1z6ma1 c.47.1.13 (A:1-172) Hypothetical protein EF0770 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2b5ea2 c.47.1.2 (A:142-239) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wp0a1 c.47.1.10 (A:138-297) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xzoa1 c.47.1.10 (A:3-174) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|