Citrus Sinensis ID: 005376
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 699 | ||||||
| 224126279 | 923 | predicted protein [Populus trichocarpa] | 0.894 | 0.677 | 0.704 | 0.0 | |
| 255563641 | 965 | actin binding protein, putative [Ricinus | 0.875 | 0.634 | 0.656 | 0.0 | |
| 224117388 | 983 | predicted protein [Populus trichocarpa] | 0.678 | 0.482 | 0.785 | 0.0 | |
| 302143198 | 499 | unnamed protein product [Vitis vinifera] | 0.706 | 0.989 | 0.722 | 0.0 | |
| 225461154 | 1004 | PREDICTED: formin-like protein 5-like [V | 0.672 | 0.468 | 0.743 | 0.0 | |
| 356514976 | 978 | PREDICTED: uncharacterized protein LOC10 | 0.705 | 0.504 | 0.702 | 0.0 | |
| 297796339 | 902 | hypothetical protein ARALYDRAFT_495546 [ | 0.805 | 0.624 | 0.677 | 0.0 | |
| 46405141 | 900 | formin homology 2 domain-containing prot | 0.805 | 0.625 | 0.675 | 0.0 | |
| 14596027 | 900 | Unknown protein [Arabidopsis thaliana] g | 0.805 | 0.625 | 0.674 | 0.0 | |
| 15239699 | 900 | formin-like protein 5 [Arabidopsis thali | 0.805 | 0.625 | 0.674 | 0.0 |
| >gi|224126279|ref|XP_002319800.1| predicted protein [Populus trichocarpa] gi|222858176|gb|EEE95723.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 795 bits (2053), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 462/656 (70%), Positives = 522/656 (79%), Gaps = 31/656 (4%)
Query: 62 LAPHKILSLSDY-----SVGSGNSKEEKLDIGKFDGTASFGAVGGTAKSFNENGQVLPPL 116
L H ++S + S+ S +K + L++ D + S GAV AKS + + ++ P+
Sbjct: 274 LGHHSFGNISSHEKMGSSLESRFNKSDALNVS-LDESMSLGAVSAAAKS-SGDSKMNTPV 331
Query: 117 KPPPGRVGSTLQGMPPLKPPPGRAEPLPHEPPASLRPHPPSGPPPPPPPPPAPRPPPAPA 176
PPGR GS P LKPPPGRAEPLP EPPASLRP PPS P PPPPP P PA +
Sbjct: 332 PHPPGRTGSN----PFLKPPPGRAEPLPPEPPASLRP-PPSKAGPTPPPPPPAPPAPAKS 386
Query: 177 PAPRAPPPPP-----------KPGPPPPPPPRGGPAPRPPPPMPSGSKVPRPPLGQKH-- 223
+ P PP KPGP PPP GG APRPPPPMPSG KVPRPPLG KH
Sbjct: 387 SSSTGPRPPGPPPPPPIAPGVKPGPRTLPPPIGGSAPRPPPPMPSGPKVPRPPLGSKHPS 446
Query: 224 -SSSSVGAGAEGDANAPKTKLKPFFWDKVLANPDNSMVWHQIKSGSFQFNEEMIETLFGY 282
++SS GAG E DA+APK KLKPFFWDKVLANPD+SMVWHQIKSGSFQFNEEMIETLFGY
Sbjct: 447 NTASSEGAGMEDDADAPKAKLKPFFWDKVLANPDHSMVWHQIKSGSFQFNEEMIETLFGY 506
Query: 283 S-EKSKNEKKKGSSLDTGPQYIQIIDQKKAQNLSIMLRALNVTLEEVCDALLEGNELPAE 341
+ +K+KNE+KK SS D P +IQI+D KKAQNLSI+LRALNVT+EEVCDAL EGNELP E
Sbjct: 507 APDKNKNERKKESSQDPTPHFIQILDPKKAQNLSILLRALNVTIEEVCDALREGNELPVE 566
Query: 342 LIQTLLKMAPTAEEELKLRLFNGELSQLGPAERFLKALVDIPFSFKRLEALLFMCTLQEE 401
L+Q LL+MAPTA+EELKLRL++GELSQLGPAERFLKALVDIPF+FKRLEALL MCTLQEE
Sbjct: 567 LVQNLLRMAPTADEELKLRLYSGELSQLGPAERFLKALVDIPFAFKRLEALLLMCTLQEE 626
Query: 402 VSATKESFEILEVACKELRNSRLFLKLLEAVLKTGNRMNDGTFRGGAQAFKLDTLLKLSD 461
++++KESFE LEVACKELRNSRLFLKLLEAVLKTGNRMNDGTFRGGAQAFKLDTLLKLSD
Sbjct: 627 ITSSKESFETLEVACKELRNSRLFLKLLEAVLKTGNRMNDGTFRGGAQAFKLDTLLKLSD 686
Query: 462 VKGVDGKTTLLHFVVQEIIRSEGVRAARRARESRSFSSV--KTDDLLEETSKSNETDEHY 519
VKGVDGKTTLLHFVVQEI+RSEGVRAAR RESRS SSV KTDDLLEE S +T+EHY
Sbjct: 687 VKGVDGKTTLLHFVVQEIVRSEGVRAARAGRESRSLSSVSIKTDDLLEEI--STDTEEHY 744
Query: 520 RNLGLQAVSHLSSELENVKKAAAIDADSLTGTVSKLGHALLKTRDFLNTDMKNLGENSGF 579
NLGLQ VSHLSSELENVK+AA +D D+LT + +KLG +LL T++FLN DMKNL E+SGF
Sbjct: 745 CNLGLQVVSHLSSELENVKRAAVVDTDNLTRSAAKLGQSLLVTQNFLNKDMKNLEEDSGF 804
Query: 580 HETLKSFVQNAEGDIMWLLEEEKRIMSLVKSTGDYFHGNAGKDEGLRLFTIVRDFFIMLD 639
H+TLK FVQNAE D+M LLEEEKRIM+LVKSTGDYFHGNAGKDEGLRLF IVRDF I+LD
Sbjct: 805 HQTLKGFVQNAEVDVMSLLEEEKRIMALVKSTGDYFHGNAGKDEGLRLFVIVRDFLIILD 864
Query: 640 KACKQVKDAPKKSTKSLKKEGSTASSSSDTPQQPSPDLRHRLFPAITERRVEDFSS 695
K CK+V++A K+ K+ KKE ST SS S+ QQ DLR RLFPAI ERR ED SS
Sbjct: 865 KVCKEVREAQKRLAKTQKKEASTVSSPSNQRQQLLADLRQRLFPAIAERRPEDSSS 920
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255563641|ref|XP_002522822.1| actin binding protein, putative [Ricinus communis] gi|223537906|gb|EEF39520.1| actin binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224117388|ref|XP_002317562.1| predicted protein [Populus trichocarpa] gi|222860627|gb|EEE98174.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|302143198|emb|CBI20493.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225461154|ref|XP_002280117.1| PREDICTED: formin-like protein 5-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356514976|ref|XP_003526177.1| PREDICTED: uncharacterized protein LOC100776210 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297796339|ref|XP_002866054.1| hypothetical protein ARALYDRAFT_495546 [Arabidopsis lyrata subsp. lyrata] gi|297311889|gb|EFH42313.1| hypothetical protein ARALYDRAFT_495546 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|46405141|gb|AAS93430.1| formin homology 2 domain-containing protein 5 [Arabidopsis thaliana] gi|47716755|gb|AAT37554.1| formin homology 2 domain-containing protein 5 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|14596027|gb|AAK68741.1| Unknown protein [Arabidopsis thaliana] gi|22136490|gb|AAM91323.1| unknown protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|15239699|ref|NP_200276.1| formin-like protein 5 [Arabidopsis thaliana] gi|30696498|ref|NP_851191.1| formin-like protein 5 [Arabidopsis thaliana] gi|160013957|sp|Q94B77.2|FH5_ARATH RecName: Full=Formin-like protein 5; Short=AtFH5; Short=AtFORMIN-5; AltName: Full=Formin homology 2 domain-containing protein 5 gi|9758957|dbj|BAB09344.1| unnamed protein product [Arabidopsis thaliana] gi|332009139|gb|AED96522.1| formin-like protein 5 [Arabidopsis thaliana] gi|332009140|gb|AED96523.1| formin-like protein 5 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 699 | ||||||
| TAIR|locus:2172129 | 900 | Fh5 "formin homology5" [Arabid | 0.683 | 0.531 | 0.654 | 9.1e-167 | |
| TAIR|locus:2158576 | 899 | FH6 "formin homolog 6" [Arabid | 0.366 | 0.284 | 0.561 | 3.9e-100 | |
| TAIR|locus:2094493 | 1051 | AFH1 "formin homology 1" [Arab | 0.356 | 0.236 | 0.589 | 8.5e-96 | |
| TAIR|locus:2079807 | 884 | AT3G05470 [Arabidopsis thalian | 0.580 | 0.459 | 0.467 | 2.6e-94 | |
| TAIR|locus:2043989 | 894 | AT2G43800 [Arabidopsis thalian | 0.589 | 0.460 | 0.454 | 7.1e-90 | |
| TAIR|locus:2020568 | 760 | FH8 "formin 8" [Arabidopsis th | 0.587 | 0.540 | 0.391 | 3.5e-78 | |
| TAIR|locus:2025981 | 929 | AT1G59910 [Arabidopsis thalian | 0.597 | 0.449 | 0.393 | 3.6e-76 | |
| TAIR|locus:2156248 | 782 | AT5G48360 [Arabidopsis thalian | 0.309 | 0.276 | 0.475 | 1.6e-67 | |
| TAIR|locus:2079711 | 841 | AT3G07540 [Arabidopsis thalian | 0.343 | 0.285 | 0.356 | 3.3e-48 | |
| MGI|MGI:1194490 | 1255 | Diap1 "diaphanous homolog 1 (D | 0.340 | 0.189 | 0.305 | 4.1e-28 |
| TAIR|locus:2172129 Fh5 "formin homology5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1553 (551.7 bits), Expect = 9.1e-167, Sum P(2) = 9.1e-167
Identities = 317/484 (65%), Positives = 366/484 (75%)
Query: 219 LGQKHSSSSVGAGAEGDANAPKTKLKPFFWDKVLANPDNSMVWHQIKSGSFQFNEEMIET 278
LG K G D +APKTKLKPFFWDKV ANP++SMVW+ I+SGSFQFNEEMIE+
Sbjct: 419 LGPKAPRPPSGPADALDDDAPKTKLKPFFWDKVQANPEHSMVWNDIRSGSFQFNEEMIES 478
Query: 279 LFGYXXXXXXXXXXXXXLDTG--PQYIQIIDQKKAQNLSIMLRALNVTLEEVCDALLEGN 336
LFGY PQ++QI++ KK QNLSI+LRALN T EEVCDAL EGN
Sbjct: 479 LFGYAAADKNKNDKKGSSGQAALPQFVQILEPKKGQNLSILLRALNATTEEVCDALREGN 538
Query: 337 ELPAELIQTLLKMAPTAEEELKLRLFNGELSQLGPAERFLKALVDIPFSFKRLEALLFMC 396
ELP E IQTLLKMAPT EEELKLRL+ GE++QLG AERFLKA+VDIPF+FKRLEALLFMC
Sbjct: 539 ELPVEFIQTLLKMAPTPEEELKLRLYCGEIAQLGSAERFLKAVVDIPFAFKRLEALLFMC 598
Query: 397 TLQEEVSATKESFEILEVACKELRNSRLFLKLLEAVLKTGNRMNDGTFRGGAQAFKLDTL 456
TL EE++ KESF+ LEVACKELR SRLFLKLLEAVLKTGNRMNDGTFRGGAQAFKLDTL
Sbjct: 599 TLHEEMAFVKESFQKLEVACKELRGSRLFLKLLEAVLKTGNRMNDGTFRGGAQAFKLDTL 658
Query: 457 LKLSDVKGVDGKTTLLHFVVQEIIXXXXXXXXXXXXXXXXXXXXKTDDLL-EETSKSNET 515
LKL+DVKG DGKTTLLHFVVQEII KT+DLL EETS+ E+
Sbjct: 659 LKLADVKGTDGKTTLLHFVVQEIIRTEGVRAARTIRESQSFSSVKTEDLLVEETSE--ES 716
Query: 516 DEHYRNLGLQAVSHLSSELENVKKAAAIDADSLTGTVSKLGHALLKTRDFLNTDMKNLGE 575
+E+YRNLGL+ VS LSSELE+VKK+A IDAD LTGTV K+GHAL K RDF+N++MK+ GE
Sbjct: 717 EENYRNLGLEKVSGLSSELEHVKKSANIDADGLTGTVLKMGHALSKARDFVNSEMKSSGE 776
Query: 576 NSGFHETLKSFVQNAEGDIMWLLEEEKRIMSLVKSTGDYFHGNAGKDEGLRLFTIVRDFF 635
SGF E L+ F+QNAEG IM +LEEEKRIM+LVKSTGDYFHG AGKDEGLRLF IVRDF
Sbjct: 777 ESGFREALEDFIQNAEGSIMSILEEEKRIMALVKSTGDYFHGKAGKDEGLRLFVIVRDFL 836
Query: 636 IMLDKACKQVKDAPKKSTKSLKKEGXXXXXXXXXXXXX-XXXLRHRLFPAITERRVEDFS 694
I+LDK+CK+V++A + + +K+G R +LFPAITERRV+ S
Sbjct: 837 IILDKSCKEVREARGRPVRMARKQGSTASASSETPRQTPSLDPRQKLFPAITERRVDQSS 896
Query: 695 SDEE 698
SD +
Sbjct: 897 SDSD 900
|
|
| TAIR|locus:2158576 FH6 "formin homolog 6" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2094493 AFH1 "formin homology 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2079807 AT3G05470 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2043989 AT2G43800 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2020568 FH8 "formin 8" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2025981 AT1G59910 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2156248 AT5G48360 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2079711 AT3G07540 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1194490 Diap1 "diaphanous homolog 1 (Drosophila)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 699 | |||
| pfam02181 | 372 | pfam02181, FH2, Formin Homology 2 Domain | 1e-126 | |
| smart00498 | 392 | smart00498, FH2, Formin Homology 2 Domain | 1e-100 | |
| pfam07174 | 297 | pfam07174, FAP, Fibronectin-attachment protein (FA | 1e-15 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 2e-14 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 6e-14 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 4e-13 | |
| pfam07174 | 297 | pfam07174, FAP, Fibronectin-attachment protein (FA | 5e-13 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 8e-13 | |
| PHA03378 | 991 | PHA03378, PHA03378, EBNA-3B; Provisional | 5e-12 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 7e-12 | |
| pfam07174 | 297 | pfam07174, FAP, Fibronectin-attachment protein (FA | 8e-12 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 1e-11 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 3e-11 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 3e-11 | |
| pfam07174 | 297 | pfam07174, FAP, Fibronectin-attachment protein (FA | 4e-11 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 4e-11 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 6e-11 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 1e-10 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 1e-10 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 2e-10 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 2e-10 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 3e-10 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 3e-10 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 3e-10 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 3e-10 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 3e-10 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 4e-10 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 5e-10 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 5e-10 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 6e-10 | |
| PRK14971 | 614 | PRK14971, PRK14971, DNA polymerase III subunits ga | 6e-10 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 8e-10 | |
| PRK11633 | 226 | PRK11633, PRK11633, cell division protein DedD; Pr | 8e-10 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 9e-10 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 1e-09 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 1e-09 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 1e-09 | |
| PHA03201 | 318 | PHA03201, PHA03201, uracil DNA glycosylase; Provis | 2e-09 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 3e-09 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 4e-09 | |
| PRK14959 | 624 | PRK14959, PRK14959, DNA polymerase III subunits ga | 4e-09 | |
| pfam06346 | 160 | pfam06346, Drf_FH1, Formin Homology Region 1 | 4e-09 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 5e-09 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 6e-09 | |
| pfam05518 | 753 | pfam05518, Totivirus_coat, Totivirus coat protein | 7e-09 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 8e-09 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 1e-08 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 1e-08 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 2e-08 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 2e-08 | |
| pfam06346 | 160 | pfam06346, Drf_FH1, Formin Homology Region 1 | 2e-08 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 3e-08 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 3e-08 | |
| PRK14965 | 576 | PRK14965, PRK14965, DNA polymerase III subunits ga | 3e-08 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 5e-08 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 5e-08 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 5e-08 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 5e-08 | |
| pfam07174 | 297 | pfam07174, FAP, Fibronectin-attachment protein (FA | 6e-08 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 6e-08 | |
| TIGR02927 | 579 | TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena | 6e-08 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 7e-08 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 9e-08 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 1e-07 | |
| PHA03378 | 991 | PHA03378, PHA03378, EBNA-3B; Provisional | 1e-07 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 1e-07 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 1e-07 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 1e-07 | |
| PRK14965 | 576 | PRK14965, PRK14965, DNA polymerase III subunits ga | 1e-07 | |
| pfam03276 | 582 | pfam03276, Gag_spuma, Spumavirus gag protein | 1e-07 | |
| PRK10819 | 246 | PRK10819, PRK10819, transport protein TonB; Provis | 1e-07 | |
| pfam12526 | 115 | pfam12526, DUF3729, Protein of unknown function (D | 1e-07 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 1e-07 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 2e-07 | |
| PHA03378 | 991 | PHA03378, PHA03378, EBNA-3B; Provisional | 2e-07 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 2e-07 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 2e-07 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 2e-07 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 2e-07 | |
| PRK14965 | 576 | PRK14965, PRK14965, DNA polymerase III subunits ga | 2e-07 | |
| pfam12526 | 115 | pfam12526, DUF3729, Protein of unknown function (D | 2e-07 | |
| PRK03427 | 333 | PRK03427, PRK03427, cell division protein ZipA; Pr | 2e-07 | |
| PHA03291 | 401 | PHA03291, PHA03291, envelope glycoprotein I; Provi | 2e-07 | |
| PLN02983 | 274 | PLN02983, PLN02983, biotin carboxyl carrier protei | 2e-07 | |
| pfam07223 | 357 | pfam07223, DUF1421, Protein of unknown function (D | 2e-07 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 2e-07 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 3e-07 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 3e-07 | |
| PRK14965 | 576 | PRK14965, PRK14965, DNA polymerase III subunits ga | 3e-07 | |
| TIGR02927 | 579 | TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena | 3e-07 | |
| pfam12526 | 115 | pfam12526, DUF3729, Protein of unknown function (D | 3e-07 | |
| smart00818 | 165 | smart00818, Amelogenin, Amelogenins, cell adhesion | 3e-07 | |
| PHA03264 | 416 | PHA03264, PHA03264, envelope glycoprotein D; Provi | 3e-07 | |
| PRK01297 | 475 | PRK01297, PRK01297, ATP-dependent RNA helicase Rhl | 3e-07 | |
| PHA03378 | 991 | PHA03378, PHA03378, EBNA-3B; Provisional | 4e-07 | |
| PRK14965 | 576 | PRK14965, PRK14965, DNA polymerase III subunits ga | 4e-07 | |
| PRK03427 | 333 | PRK03427, PRK03427, cell division protein ZipA; Pr | 4e-07 | |
| PRK00404 | 141 | PRK00404, tatB, sec-independent translocase; Provi | 4e-07 | |
| pfam10349 | 111 | pfam10349, WWbp, WW-domain ligand protein | 4e-07 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 5e-07 | |
| PHA03291 | 401 | PHA03291, PHA03291, envelope glycoprotein I; Provi | 5e-07 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 5e-07 | |
| pfam10152 | 147 | pfam10152, DUF2360, Predicted coiled-coil domain-c | 6e-07 | |
| pfam12868 | 135 | pfam12868, DUF3824, Domain of unknwon function (DU | 7e-07 | |
| pfam09483 | 185 | pfam09483, HpaP, Type III secretion protein (HpaP) | 8e-07 | |
| PRK10819 | 246 | PRK10819, PRK10819, transport protein TonB; Provis | 9e-07 | |
| pfam13388 | 422 | pfam13388, DUF4106, Protein of unknown function (D | 9e-07 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 1e-06 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 1e-06 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 1e-06 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 1e-06 | |
| pfam05518 | 753 | pfam05518, Totivirus_coat, Totivirus coat protein | 1e-06 | |
| pfam03276 | 582 | pfam03276, Gag_spuma, Spumavirus gag protein | 1e-06 | |
| PLN02983 | 274 | PLN02983, PLN02983, biotin carboxyl carrier protei | 1e-06 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 1e-06 | |
| PRK00404 | 141 | PRK00404, tatB, sec-independent translocase; Provi | 1e-06 | |
| pfam10349 | 111 | pfam10349, WWbp, WW-domain ligand protein | 1e-06 | |
| PRK09111 | 598 | PRK09111, PRK09111, DNA polymerase III subunits ga | 1e-06 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 1e-06 | |
| PRK14963 | 504 | PRK14963, PRK14963, DNA polymerase III subunits ga | 1e-06 | |
| PHA03378 | 991 | PHA03378, PHA03378, EBNA-3B; Provisional | 2e-06 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 2e-06 | |
| PHA03201 | 318 | PHA03201, PHA03201, uracil DNA glycosylase; Provis | 2e-06 | |
| pfam06346 | 160 | pfam06346, Drf_FH1, Formin Homology Region 1 | 2e-06 | |
| PRK14965 | 576 | PRK14965, PRK14965, DNA polymerase III subunits ga | 2e-06 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 2e-06 | |
| PRK01297 | 475 | PRK01297, PRK01297, ATP-dependent RNA helicase Rhl | 2e-06 | |
| PRK01297 | 475 | PRK01297, PRK01297, ATP-dependent RNA helicase Rhl | 2e-06 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 2e-06 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 2e-06 | |
| pfam09849 | 234 | pfam09849, DUF2076, Uncharacterized protein conser | 2e-06 | |
| PRK14086 | 617 | PRK14086, dnaA, chromosomal replication initiation | 2e-06 | |
| PRK14954 | 620 | PRK14954, PRK14954, DNA polymerase III subunits ga | 2e-06 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 2e-06 | |
| PRK01297 | 475 | PRK01297, PRK01297, ATP-dependent RNA helicase Rhl | 3e-06 | |
| pfam12868 | 135 | pfam12868, DUF3824, Domain of unknwon function (DU | 3e-06 | |
| pfam06070 | 777 | pfam06070, Herpes_UL32, Herpesvirus large structur | 3e-06 | |
| PRK11855 | 547 | PRK11855, PRK11855, dihydrolipoamide acetyltransfe | 3e-06 | |
| PRK09111 | 598 | PRK09111, PRK09111, DNA polymerase III subunits ga | 4e-06 | |
| PRK06995 | 484 | PRK06995, flhF, flagellar biosynthesis regulator F | 4e-06 | |
| pfam07777 | 189 | pfam07777, MFMR, G-box binding protein MFMR | 4e-06 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 5e-06 | |
| PRK03427 | 333 | PRK03427, PRK03427, cell division protein ZipA; Pr | 5e-06 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 5e-06 | |
| pfam10152 | 147 | pfam10152, DUF2360, Predicted coiled-coil domain-c | 5e-06 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 5e-06 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 6e-06 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 6e-06 | |
| PRK14086 | 617 | PRK14086, dnaA, chromosomal replication initiation | 6e-06 | |
| PHA02682 | 280 | PHA02682, PHA02682, ORF080 virion core protein; Pr | 6e-06 | |
| PHA03381 | 290 | PHA03381, PHA03381, tegument protein VP22; Provisi | 6e-06 | |
| PRK14952 | 584 | PRK14952, PRK14952, DNA polymerase III subunits ga | 7e-06 | |
| pfam06346 | 160 | pfam06346, Drf_FH1, Formin Homology Region 1 | 8e-06 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 8e-06 | |
| PRK01297 | 475 | PRK01297, PRK01297, ATP-dependent RNA helicase Rhl | 8e-06 | |
| pfam10349 | 111 | pfam10349, WWbp, WW-domain ligand protein | 8e-06 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 8e-06 | |
| PRK06549 | 130 | PRK06549, PRK06549, acetyl-CoA carboxylase biotin | 8e-06 | |
| pfam07174 | 297 | pfam07174, FAP, Fibronectin-attachment protein (FA | 9e-06 | |
| pfam12526 | 115 | pfam12526, DUF3729, Protein of unknown function (D | 9e-06 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 9e-06 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 1e-05 | |
| pfam06346 | 160 | pfam06346, Drf_FH1, Formin Homology Region 1 | 1e-05 | |
| PRK03427 | 333 | PRK03427, PRK03427, cell division protein ZipA; Pr | 1e-05 | |
| PHA03291 | 401 | PHA03291, PHA03291, envelope glycoprotein I; Provi | 1e-05 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 1e-05 | |
| smart00818 | 165 | smart00818, Amelogenin, Amelogenins, cell adhesion | 1e-05 | |
| PRK00404 | 141 | PRK00404, tatB, sec-independent translocase; Provi | 1e-05 | |
| PRK00404 | 141 | PRK00404, tatB, sec-independent translocase; Provi | 1e-05 | |
| PRK14086 | 617 | PRK14086, dnaA, chromosomal replication initiation | 1e-05 | |
| PRK11855 | 547 | PRK11855, PRK11855, dihydrolipoamide acetyltransfe | 1e-05 | |
| pfam03251 | 458 | pfam03251, Tymo_45kd_70kd, Tymovirus 45/70Kd prote | 1e-05 | |
| PHA01732 | 94 | PHA01732, PHA01732, proline-rich protein | 1e-05 | |
| PRK06975 | 656 | PRK06975, PRK06975, bifunctional uroporphyrinogen- | 1e-05 | |
| TIGR01348 | 546 | TIGR01348, PDHac_trf_long, pyruvate dehydrogenase | 1e-05 | |
| pfam07174 | 297 | pfam07174, FAP, Fibronectin-attachment protein (FA | 2e-05 | |
| pfam05518 | 753 | pfam05518, Totivirus_coat, Totivirus coat protein | 2e-05 | |
| pfam10152 | 147 | pfam10152, DUF2360, Predicted coiled-coil domain-c | 2e-05 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 2e-05 | |
| pfam04959 | 211 | pfam04959, ARS2, Arsenite-resistance protein 2 | 2e-05 | |
| pfam04621 | 336 | pfam04621, ETS_PEA3_N, PEA3 subfamily ETS-domain t | 2e-05 | |
| TIGR02557 | 201 | TIGR02557, HpaP, type III secretion protein HpaP | 2e-05 | |
| TIGR00601 | 378 | TIGR00601, rad23, UV excision repair protein Rad23 | 2e-05 | |
| PRK12373 | 400 | PRK12373, PRK12373, NADH dehydrogenase subunit E; | 2e-05 | |
| PRK12373 | 400 | PRK12373, PRK12373, NADH dehydrogenase subunit E; | 2e-05 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 3e-05 | |
| PRK03427 | 333 | PRK03427, PRK03427, cell division protein ZipA; Pr | 3e-05 | |
| PRK03427 | 333 | PRK03427, PRK03427, cell division protein ZipA; Pr | 3e-05 | |
| PLN02983 | 274 | PLN02983, PLN02983, biotin carboxyl carrier protei | 3e-05 | |
| pfam07223 | 357 | pfam07223, DUF1421, Protein of unknown function (D | 3e-05 | |
| PRK06995 | 484 | PRK06995, flhF, flagellar biosynthesis regulator F | 3e-05 | |
| COG2948 | 360 | COG2948, VirB10, Type IV secretory pathway, VirB10 | 3e-05 | |
| PTZ00144 | 418 | PTZ00144, PTZ00144, dihydrolipoamide succinyltrans | 3e-05 | |
| pfam11029 | 136 | pfam11029, DAZAP2, DAZ associated protein 2 (DAZAP | 3e-05 | |
| PRK14723 | 767 | PRK14723, flhF, flagellar biosynthesis regulator F | 3e-05 | |
| PHA03378 | 991 | PHA03378, PHA03378, EBNA-3B; Provisional | 4e-05 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 4e-05 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 4e-05 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 4e-05 | |
| PHA02682 | 280 | PHA02682, PHA02682, ORF080 virion core protein; Pr | 4e-05 | |
| TIGR00601 | 378 | TIGR00601, rad23, UV excision repair protein Rad23 | 4e-05 | |
| PRK11892 | 464 | PRK11892, PRK11892, pyruvate dehydrogenase subunit | 4e-05 | |
| TIGR02031 | 589 | TIGR02031, BchD-ChlD, magnesium chelatase ATPase s | 4e-05 | |
| COG5178 | 2365 | COG5178, PRP8, U5 snRNP spliceosome subunit [RNA p | 4e-05 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 5e-05 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 5e-05 | |
| PRK14963 | 504 | PRK14963, PRK14963, DNA polymerase III subunits ga | 5e-05 | |
| pfam14179 | 110 | pfam14179, YppG, YppG-like protein | 5e-05 | |
| pfam14179 | 110 | pfam14179, YppG, YppG-like protein | 5e-05 | |
| PLN02744 | 539 | PLN02744, PLN02744, dihydrolipoyllysine-residue ac | 5e-05 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 6e-05 | |
| TIGR02927 | 579 | TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena | 6e-05 | |
| PTZ00144 | 418 | PTZ00144, PTZ00144, dihydrolipoamide succinyltrans | 6e-05 | |
| PLN02983 | 274 | PLN02983, PLN02983, biotin carboxyl carrier protei | 7e-05 | |
| PRK00404 | 141 | PRK00404, tatB, sec-independent translocase; Provi | 7e-05 | |
| pfam13388 | 422 | pfam13388, DUF4106, Protein of unknown function (D | 7e-05 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 7e-05 | |
| pfam05887 | 145 | pfam05887, Trypan_PARP, Procyclic acidic repetitiv | 7e-05 | |
| PHA03379 | 935 | PHA03379, PHA03379, EBNA-3A; Provisional | 7e-05 | |
| pfam06346 | 160 | pfam06346, Drf_FH1, Formin Homology Region 1 | 8e-05 | |
| PRK03427 | 333 | PRK03427, PRK03427, cell division protein ZipA; Pr | 8e-05 | |
| PRK11855 | 547 | PRK11855, PRK11855, dihydrolipoamide acetyltransfe | 8e-05 | |
| PRK14723 | 767 | PRK14723, flhF, flagellar biosynthesis regulator F | 8e-05 | |
| PRK11892 | 464 | PRK11892, PRK11892, pyruvate dehydrogenase subunit | 9e-05 | |
| pfam02993 | 238 | pfam02993, MCPVI, Minor capsid protein VI | 9e-05 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 1e-04 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 1e-04 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 1e-04 | |
| pfam05518 | 753 | pfam05518, Totivirus_coat, Totivirus coat protein | 1e-04 | |
| TIGR02927 | 579 | TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena | 1e-04 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 1e-04 | |
| pfam07223 | 357 | pfam07223, DUF1421, Protein of unknown function (D | 1e-04 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 1e-04 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 1e-04 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 1e-04 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 1e-04 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 1e-04 | |
| PRK06995 | 484 | PRK06995, flhF, flagellar biosynthesis regulator F | 1e-04 | |
| PRK14952 | 584 | PRK14952, PRK14952, DNA polymerase III subunits ga | 1e-04 | |
| PRK11892 | 464 | PRK11892, PRK11892, pyruvate dehydrogenase subunit | 1e-04 | |
| PHA03321 | 694 | PHA03321, PHA03321, tegument protein VP11/12; Prov | 1e-04 | |
| PHA03282 | 540 | PHA03282, PHA03282, envelope glycoprotein E; Provi | 1e-04 | |
| pfam05044 | 908 | pfam05044, Prox1, Homeobox prospero-like protein ( | 1e-04 | |
| pfam06003 | 264 | pfam06003, SMN, Survival motor neuron protein (SMN | 1e-04 | |
| PHA03369 | 663 | PHA03369, PHA03369, capsid maturational protease; | 1e-04 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 2e-04 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 2e-04 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 2e-04 | |
| TIGR02927 | 579 | TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena | 2e-04 | |
| pfam03276 | 582 | pfam03276, Gag_spuma, Spumavirus gag protein | 2e-04 | |
| PRK03427 | 333 | PRK03427, PRK03427, cell division protein ZipA; Pr | 2e-04 | |
| pfam07223 | 357 | pfam07223, DUF1421, Protein of unknown function (D | 2e-04 | |
| smart00818 | 165 | smart00818, Amelogenin, Amelogenins, cell adhesion | 2e-04 | |
| PRK14963 | 504 | PRK14963, PRK14963, DNA polymerase III subunits ga | 2e-04 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 2e-04 | |
| PRK06995 | 484 | PRK06995, flhF, flagellar biosynthesis regulator F | 2e-04 | |
| pfam05887 | 145 | pfam05887, Trypan_PARP, Procyclic acidic repetitiv | 2e-04 | |
| pfam05308 | 248 | pfam05308, Mito_fiss_reg, Mitochondrial fission re | 2e-04 | |
| PRK12438 | 991 | PRK12438, PRK12438, hypothetical protein; Provisio | 2e-04 | |
| pfam13908 | 177 | pfam13908, Shisa, Wnt and FGF inhibitory regulator | 2e-04 | |
| pfam04625 | 407 | pfam04625, DEC-1_N, DEC-1 protein, N-terminal regi | 2e-04 | |
| pfam04625 | 407 | pfam04625, DEC-1_N, DEC-1 protein, N-terminal regi | 2e-04 | |
| PTZ00449 | 943 | PTZ00449, PTZ00449, 104 kDa microneme/rhoptry anti | 2e-04 | |
| PRK05641 | 153 | PRK05641, PRK05641, putative acetyl-CoA carboxylas | 2e-04 | |
| PRK09752 | 1250 | PRK09752, PRK09752, adhesin; Provisional | 2e-04 | |
| pfam04487 | 206 | pfam04487, CITED, CITED | 2e-04 | |
| PHA03132 | 580 | PHA03132, PHA03132, thymidine kinase; Provisional | 2e-04 | |
| PRK10819 | 246 | PRK10819, PRK10819, transport protein TonB; Provis | 3e-04 | |
| pfam12526 | 115 | pfam12526, DUF3729, Protein of unknown function (D | 3e-04 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 3e-04 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 3e-04 | |
| pfam09849 | 234 | pfam09849, DUF2076, Uncharacterized protein conser | 3e-04 | |
| PLN02744 | 539 | PLN02744, PLN02744, dihydrolipoyllysine-residue ac | 3e-04 | |
| pfam04554 | 57 | pfam04554, Extensin_2, Extensin-like region | 3e-04 | |
| COG5373 | 931 | COG5373, COG5373, Predicted membrane protein [Func | 3e-04 | |
| COG5373 | 931 | COG5373, COG5373, Predicted membrane protein [Func | 3e-04 | |
| PLN02258 | 590 | PLN02258, PLN02258, 9-cis-epoxycarotenoid dioxygen | 3e-04 | |
| COG3147 | 226 | COG3147, DedD, Uncharacterized protein conserved i | 3e-04 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 4e-04 | |
| pfam09483 | 185 | pfam09483, HpaP, Type III secretion protein (HpaP) | 4e-04 | |
| pfam13388 | 422 | pfam13388, DUF4106, Protein of unknown function (D | 4e-04 | |
| PRK12438 | 991 | PRK12438, PRK12438, hypothetical protein; Provisio | 4e-04 | |
| pfam13254 | 414 | pfam13254, DUF4045, Domain of unknown function (DU | 4e-04 | |
| PRK10263 | 1355 | PRK10263, PRK10263, DNA translocase FtsK; Provisio | 4e-04 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 5e-04 | |
| PRK01297 | 475 | PRK01297, PRK01297, ATP-dependent RNA helicase Rhl | 5e-04 | |
| pfam09483 | 185 | pfam09483, HpaP, Type III secretion protein (HpaP) | 5e-04 | |
| TIGR00601 | 378 | TIGR00601, rad23, UV excision repair protein Rad23 | 5e-04 | |
| TIGR01628 | 562 | TIGR01628, PABP-1234, polyadenylate binding protei | 5e-04 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 6e-04 | |
| pfam10152 | 147 | pfam10152, DUF2360, Predicted coiled-coil domain-c | 6e-04 | |
| PHA02682 | 280 | PHA02682, PHA02682, ORF080 virion core protein; Pr | 6e-04 | |
| PRK06975 | 656 | PRK06975, PRK06975, bifunctional uroporphyrinogen- | 6e-04 | |
| PTZ00144 | 418 | PTZ00144, PTZ00144, dihydrolipoamide succinyltrans | 6e-04 | |
| PRK11892 | 464 | PRK11892, PRK11892, pyruvate dehydrogenase subunit | 6e-04 | |
| pfam14179 | 110 | pfam14179, YppG, YppG-like protein | 6e-04 | |
| pfam14179 | 110 | pfam14179, YppG, YppG-like protein | 6e-04 | |
| PRK09752 | 1250 | PRK09752, PRK09752, adhesin; Provisional | 6e-04 | |
| pfam07271 | 279 | pfam07271, Cytadhesin_P30, Cytadhesin P30/P32 | 6e-04 | |
| pfam07415 | 489 | pfam07415, Herpes_LMP2, Gammaherpesvirus latent me | 6e-04 | |
| TIGR01645 | 612 | TIGR01645, half-pint, poly-U binding splicing fact | 6e-04 | |
| PRK13855 | 376 | PRK13855, PRK13855, type IV secretion system prote | 6e-04 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 7e-04 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 7e-04 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 7e-04 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 7e-04 | |
| PRK14952 | 584 | PRK14952, PRK14952, DNA polymerase III subunits ga | 7e-04 | |
| pfam03153 | 332 | pfam03153, TFIIA, Transcription factor IIA, alpha/ | 7e-04 | |
| cd03784 | 401 | cd03784, GT1_Gtf_like, This family includes the Gt | 7e-04 | |
| PRK13729 | 475 | PRK13729, PRK13729, conjugal transfer pilus assemb | 7e-04 | |
| TIGR02927 | 579 | TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena | 8e-04 | |
| PRK10819 | 246 | PRK10819, PRK10819, transport protein TonB; Provis | 8e-04 | |
| PRK06975 | 656 | PRK06975, PRK06975, bifunctional uroporphyrinogen- | 8e-04 | |
| PRK11892 | 464 | PRK11892, PRK11892, pyruvate dehydrogenase subunit | 8e-04 | |
| PHA03379 | 935 | PHA03379, PHA03379, EBNA-3A; Provisional | 8e-04 | |
| pfam04554 | 57 | pfam04554, Extensin_2, Extensin-like region | 9e-04 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 0.001 | |
| smart00818 | 165 | smart00818, Amelogenin, Amelogenins, cell adhesion | 0.001 | |
| pfam10349 | 111 | pfam10349, WWbp, WW-domain ligand protein | 0.001 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 0.001 | |
| pfam10152 | 147 | pfam10152, DUF2360, Predicted coiled-coil domain-c | 0.001 | |
| PRK09111 | 598 | PRK09111, PRK09111, DNA polymerase III subunits ga | 0.001 | |
| PRK14086 | 617 | PRK14086, dnaA, chromosomal replication initiation | 0.001 | |
| PRK11855 | 547 | PRK11855, PRK11855, dihydrolipoamide acetyltransfe | 0.001 | |
| PHA01732 | 94 | PHA01732, PHA01732, proline-rich protein | 0.001 | |
| TIGR02557 | 201 | TIGR02557, HpaP, type III secretion protein HpaP | 0.001 | |
| PTZ00144 | 418 | PTZ00144, PTZ00144, dihydrolipoamide succinyltrans | 0.001 | |
| PTZ00144 | 418 | PTZ00144, PTZ00144, dihydrolipoamide succinyltrans | 0.001 | |
| PRK14723 | 767 | PRK14723, flhF, flagellar biosynthesis regulator F | 0.001 | |
| TIGR02031 | 589 | TIGR02031, BchD-ChlD, magnesium chelatase ATPase s | 0.001 | |
| pfam14179 | 110 | pfam14179, YppG, YppG-like protein | 0.001 | |
| pfam05887 | 145 | pfam05887, Trypan_PARP, Procyclic acidic repetitiv | 0.001 | |
| pfam02993 | 238 | pfam02993, MCPVI, Minor capsid protein VI | 0.001 | |
| PRK09752 | 1250 | PRK09752, PRK09752, adhesin; Provisional | 0.001 | |
| PRK10263 | 1355 | PRK10263, PRK10263, DNA translocase FtsK; Provisio | 0.001 | |
| PRK10263 | 1355 | PRK10263, PRK10263, DNA translocase FtsK; Provisio | 0.001 | |
| pfam01690 | 460 | pfam01690, PLRV_ORF5, Potato leaf roll virus readt | 0.001 | |
| PHA03301 | 226 | PHA03301, PHA03301, envelope glycoprotein L; Provi | 0.001 | |
| PRK00030 | 292 | PRK00030, minC, septum formation inhibitor; Provis | 0.001 | |
| pfam08549 | 669 | pfam08549, SWI-SNF_Ssr4, Fungal domain of unknown | 0.001 | |
| PRK05306 | 746 | PRK05306, infB, translation initiation factor IF-2 | 0.001 | |
| pfam06482 | 291 | pfam06482, Endostatin, Collagenase NC10 and Endost | 0.001 | |
| PRK09424 | 509 | PRK09424, pntA, NAD(P) transhydrogenase subunit al | 0.001 | |
| pfam11162 | 119 | pfam11162, DUF2946, Protein of unknown function (D | 0.001 | |
| TIGR03921 | 350 | TIGR03921, T7SS_mycosin, type VII secretion-associ | 0.001 | |
| PRK12757 | 256 | PRK12757, PRK12757, cell division protein FtsN; Pr | 0.001 | |
| pfam00716 | 326 | pfam00716, Peptidase_S21, Assemblin (Peptidase fam | 0.001 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 0.002 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 0.002 | |
| PHA03201 | 318 | PHA03201, PHA03201, uracil DNA glycosylase; Provis | 0.002 | |
| pfam12526 | 115 | pfam12526, DUF3729, Protein of unknown function (D | 0.002 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 0.002 | |
| pfam07223 | 357 | pfam07223, DUF1421, Protein of unknown function (D | 0.002 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 0.002 | |
| PRK14963 | 504 | PRK14963, PRK14963, DNA polymerase III subunits ga | 0.002 | |
| pfam09849 | 234 | pfam09849, DUF2076, Uncharacterized protein conser | 0.002 | |
| PRK06995 | 484 | PRK06995, flhF, flagellar biosynthesis regulator F | 0.002 | |
| PRK14952 | 584 | PRK14952, PRK14952, DNA polymerase III subunits ga | 0.002 | |
| PRK06975 | 656 | PRK06975, PRK06975, bifunctional uroporphyrinogen- | 0.002 | |
| PRK14723 | 767 | PRK14723, flhF, flagellar biosynthesis regulator F | 0.002 | |
| TIGR02031 | 589 | TIGR02031, BchD-ChlD, magnesium chelatase ATPase s | 0.002 | |
| COG5178 | 2365 | COG5178, PRP8, U5 snRNP spliceosome subunit [RNA p | 0.002 | |
| PHA03282 | 540 | PHA03282, PHA03282, envelope glycoprotein E; Provi | 0.002 | |
| PRK12438 | 991 | PRK12438, PRK12438, hypothetical protein; Provisio | 0.002 | |
| pfam04554 | 57 | pfam04554, Extensin_2, Extensin-like region | 0.002 | |
| PLN02258 | 590 | PLN02258, PLN02258, 9-cis-epoxycarotenoid dioxygen | 0.002 | |
| pfam03153 | 332 | pfam03153, TFIIA, Transcription factor IIA, alpha/ | 0.002 | |
| COG3921 | 300 | COG3921, COG3921, Uncharacterized protein conserve | 0.002 | |
| PRK13406 | 584 | PRK13406, bchD, magnesium chelatase subunit D; Pro | 0.002 | |
| pfam10138 | 98 | pfam10138, Tellurium_res, Tellurium resistance pro | 0.002 | |
| PRK00575 | 92 | PRK00575, tatA, twin arginine translocase protein | 0.002 | |
| PRK00708 | 209 | PRK00708, PRK00708, sec-independent translocase; P | 0.002 | |
| pfam09483 | 185 | pfam09483, HpaP, Type III secretion protein (HpaP) | 0.003 | |
| pfam09849 | 234 | pfam09849, DUF2076, Uncharacterized protein conser | 0.003 | |
| PRK11855 | 547 | PRK11855, PRK11855, dihydrolipoamide acetyltransfe | 0.003 | |
| PHA03381 | 290 | PHA03381, PHA03381, tegument protein VP22; Provisi | 0.003 | |
| COG5178 | 2365 | COG5178, PRP8, U5 snRNP spliceosome subunit [RNA p | 0.003 | |
| PRK12438 | 991 | PRK12438, PRK12438, hypothetical protein; Provisio | 0.003 | |
| pfam04625 | 407 | pfam04625, DEC-1_N, DEC-1 protein, N-terminal regi | 0.003 | |
| cd03784 | 401 | cd03784, GT1_Gtf_like, This family includes the Gt | 0.003 | |
| PHA03301 | 226 | PHA03301, PHA03301, envelope glycoprotein L; Provi | 0.003 | |
| PRK12757 | 256 | PRK12757, PRK12757, cell division protein FtsN; Pr | 0.003 | |
| PRK12757 | 256 | PRK12757, PRK12757, cell division protein FtsN; Pr | 0.003 | |
| PRK14666 | 694 | PRK14666, uvrC, excinuclease ABC subunit C; Provis | 0.003 | |
| COG3898 | 531 | COG3898, COG3898, Uncharacterized membrane-bound p | 0.003 | |
| PRK05996 | 423 | PRK05996, motB, flagellar motor protein MotB; Vali | 0.003 | |
| PRK06302 | 155 | PRK06302, PRK06302, acetyl-CoA carboxylase biotin | 0.003 | |
| PHA03269 | 566 | PHA03269, PHA03269, envelope glycoprotein C; Provi | 0.003 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 0.004 | |
| PRK06975 | 656 | PRK06975, PRK06975, bifunctional uroporphyrinogen- | 0.004 | |
| TIGR02031 | 589 | TIGR02031, BchD-ChlD, magnesium chelatase ATPase s | 0.004 | |
| PRK09752 | 1250 | PRK09752, PRK09752, adhesin; Provisional | 0.004 | |
| TIGR01649 | 481 | TIGR01649, hnRNP-L_PTB, hnRNP-L/PTB/hephaestus spl | 0.004 |
| >gnl|CDD|216919 pfam02181, FH2, Formin Homology 2 Domain | Back alignment and domain information |
|---|
Score = 377 bits (971), Expect = e-126
Identities = 154/413 (37%), Positives = 208/413 (50%), Gaps = 47/413 (11%)
Query: 233 EGDANAPKTKLKPFFWDKVLANPDNSMVWHQIKSGSFQFNEEMIETLFGYSEKSKNEKKK 292
+ PK KLKP WDKV D VW ++ SF+ + ++ E +S K+K +K K
Sbjct: 1 KKKEPKPKKKLKPLHWDKVNPAQDRGTVWDELDEESFEKDLDLSELEELFSAKAKKKKSK 60
Query: 293 G----SSLDTGPQYIQIIDQKKAQNLSIMLRALNVTLEEVCDALLEGNE--LPAELIQTL 346
SS + I ++D K++QN++I+LR L + EE+ A+LE +E L EL++ L
Sbjct: 61 KSEKKSSSKKKKKEISVLDPKRSQNIAILLRKLKLPPEEIVQAILEMDESVLGLELLENL 120
Query: 347 LKMAPTAEEELKLRLFNGELSQLGPAERFLKALVDIPFSFKRLEALLFMCTLQEEVSATK 406
LKMAPT EE KL+ + G+ S+LG AE+FL L IP +RLEALLF T +EEV K
Sbjct: 121 LKMAPTKEELKKLKEYKGDPSKLGRAEQFLLELSKIPRLEERLEALLFKSTFEEEVEELK 180
Query: 407 ESFEILEVACKELRNSRLFLKLLEAVLKTGNRMNDGTFRGGAQAFKLDTLLKLSDVKGVD 466
S E LE A +ELR SR F KLLE +L GN MN GT RG A+ FKL +LLKLSD K D
Sbjct: 181 PSLETLEAASEELRESRKFKKLLELILALGNYMNSGTRRGNAKGFKLSSLLKLSDTKSTD 240
Query: 467 GKTTLLHFVVQEIIRSEGVRAARRARESRSFSSVKTDDLLEETSKSNETDEHYRNLGLQA 526
KTTLLH++V+ I L
Sbjct: 241 NKTTLLHYLVKIIRE-----------------------------------------KLPD 259
Query: 527 VSHLSSELENVKKAAAIDADSLTGTVSKLGHALLKTRDFLNTDMKNLGENSGFHETLKSF 586
+ SSEL +V+KAA +D + L V +L L K L + + F E +K F
Sbjct: 260 LLDFSSELSHVEKAAKVDLEQLEKDVKELEKGLKKLERELELSALDEHPDDKFVEKMKEF 319
Query: 587 VQNAEGDIMWLLEEEKRIMSLVKSTGDYFHGNAGKDEGLRLFTIVRDFFIMLD 639
++ AE + L K M L K +YF + + F I+RDF M
Sbjct: 320 LEEAEEKLDKLESLLKEAMELFKELTEYFGEDPKETSPEEFFKILRDFLRMFK 372
|
Length = 372 |
| >gnl|CDD|214697 smart00498, FH2, Formin Homology 2 Domain | Back alignment and domain information |
|---|
| >gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165468 PHA03201, PHA03201, uracil DNA glycosylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|148139 pfam06346, Drf_FH1, Formin Homology Region 1 | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|148139 pfam06346, Drf_FH1, Formin Homology Region 1 | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217469 pfam03276, Gag_spuma, Spumavirus gag protein | Back alignment and domain information |
|---|
| >gnl|CDD|236768 PRK10819, PRK10819, transport protein TonB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|152960 pfam12526, DUF3729, Protein of unknown function (DUF3729) | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|152960 pfam12526, DUF3729, Protein of unknown function (DUF3729) | Back alignment and domain information |
|---|
| >gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223033 PHA03291, PHA03291, envelope glycoprotein I; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215533 PLN02983, PLN02983, biotin carboxyl carrier protein of acetyl-CoA carboxylase | Back alignment and domain information |
|---|
| >gnl|CDD|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421) | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|152960 pfam12526, DUF3729, Protein of unknown function (DUF3729) | Back alignment and domain information |
|---|
| >gnl|CDD|197891 smart00818, Amelogenin, Amelogenins, cell adhesion proteins, play a role in the biomineralisation of teeth | Back alignment and domain information |
|---|
| >gnl|CDD|223029 PHA03264, PHA03264, envelope glycoprotein D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|166942 PRK00404, tatB, sec-independent translocase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220708 pfam10349, WWbp, WW-domain ligand protein | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223033 PHA03291, PHA03291, envelope glycoprotein I; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|220603 pfam10152, DUF2360, Predicted coiled-coil domain-containing protein (DUF2360) | Back alignment and domain information |
|---|
| >gnl|CDD|221818 pfam12868, DUF3824, Domain of unknwon function (DUF3824) | Back alignment and domain information |
|---|
| >gnl|CDD|220260 pfam09483, HpaP, Type III secretion protein (HpaP) | Back alignment and domain information |
|---|
| >gnl|CDD|236768 PRK10819, PRK10819, transport protein TonB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein | Back alignment and domain information |
|---|
| >gnl|CDD|217469 pfam03276, Gag_spuma, Spumavirus gag protein | Back alignment and domain information |
|---|
| >gnl|CDD|215533 PLN02983, PLN02983, biotin carboxyl carrier protein of acetyl-CoA carboxylase | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|166942 PRK00404, tatB, sec-independent translocase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220708 pfam10349, WWbp, WW-domain ligand protein | Back alignment and domain information |
|---|
| >gnl|CDD|236382 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|184927 PRK14963, PRK14963, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|165468 PHA03201, PHA03201, uracil DNA glycosylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|148139 pfam06346, Drf_FH1, Formin Homology Region 1 | Back alignment and domain information |
|---|
| >gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|220441 pfam09849, DUF2076, Uncharacterized protein conserved in bacteria (DUF2076) | Back alignment and domain information |
|---|
| >gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221818 pfam12868, DUF3824, Domain of unknwon function (DUF3824) | Back alignment and domain information |
|---|
| >gnl|CDD|218881 pfam06070, Herpes_UL32, Herpesvirus large structural phosphoprotein UL32 | Back alignment and domain information |
|---|
| >gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236382 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|219569 pfam07777, MFMR, G-box binding protein MFMR | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220603 pfam10152, DUF2360, Predicted coiled-coil domain-containing protein (DUF2360) | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|177464 PHA02682, PHA02682, ORF080 virion core protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|177618 PHA03381, PHA03381, tegument protein VP22; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237866 PRK14952, PRK14952, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|148139 pfam06346, Drf_FH1, Formin Homology Region 1 | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220708 pfam10349, WWbp, WW-domain ligand protein | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235826 PRK06549, PRK06549, acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) | Back alignment and domain information |
|---|
| >gnl|CDD|152960 pfam12526, DUF3729, Protein of unknown function (DUF3729) | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|148139 pfam06346, Drf_FH1, Formin Homology Region 1 | Back alignment and domain information |
|---|
| >gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223033 PHA03291, PHA03291, envelope glycoprotein I; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|197891 smart00818, Amelogenin, Amelogenins, cell adhesion proteins, play a role in the biomineralisation of teeth | Back alignment and domain information |
|---|
| >gnl|CDD|166942 PRK00404, tatB, sec-independent translocase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|166942 PRK00404, tatB, sec-independent translocase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|217453 pfam03251, Tymo_45kd_70kd, Tymovirus 45/70Kd protein | Back alignment and domain information |
|---|
| >gnl|CDD|222828 PHA01732, PHA01732, proline-rich protein | Back alignment and domain information |
|---|
| >gnl|CDD|235899 PRK06975, PRK06975, bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233366 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form | Back alignment and domain information |
|---|
| >gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) | Back alignment and domain information |
|---|
| >gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein | Back alignment and domain information |
|---|
| >gnl|CDD|220603 pfam10152, DUF2360, Predicted coiled-coil domain-containing protein (DUF2360) | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|218350 pfam04959, ARS2, Arsenite-resistance protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|218181 pfam04621, ETS_PEA3_N, PEA3 subfamily ETS-domain transcription factor N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|233927 TIGR02557, HpaP, type III secretion protein HpaP | Back alignment and domain information |
|---|
| >gnl|CDD|233045 TIGR00601, rad23, UV excision repair protein Rad23 | Back alignment and domain information |
|---|
| >gnl|CDD|237082 PRK12373, PRK12373, NADH dehydrogenase subunit E; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237082 PRK12373, PRK12373, NADH dehydrogenase subunit E; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215533 PLN02983, PLN02983, biotin carboxyl carrier protein of acetyl-CoA carboxylase | Back alignment and domain information |
|---|
| >gnl|CDD|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421) | Back alignment and domain information |
|---|
| >gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|225499 COG2948, VirB10, Type IV secretory pathway, VirB10 components [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220950 pfam11029, DAZAP2, DAZ associated protein 2 (DAZAP2) | Back alignment and domain information |
|---|
| >gnl|CDD|237802 PRK14723, flhF, flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|177464 PHA02682, PHA02682, ORF080 virion core protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233045 TIGR00601, rad23, UV excision repair protein Rad23 | Back alignment and domain information |
|---|
| >gnl|CDD|237011 PRK11892, PRK11892, pyruvate dehydrogenase subunit beta; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233692 TIGR02031, BchD-ChlD, magnesium chelatase ATPase subunit D | Back alignment and domain information |
|---|
| >gnl|CDD|227505 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|184927 PRK14963, PRK14963, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222579 pfam14179, YppG, YppG-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|222579 pfam14179, YppG, YppG-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|215397 PLN02744, PLN02744, dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215533 PLN02983, PLN02983, biotin carboxyl carrier protein of acetyl-CoA carboxylase | Back alignment and domain information |
|---|
| >gnl|CDD|166942 PRK00404, tatB, sec-independent translocase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|114603 pfam05887, Trypan_PARP, Procyclic acidic repetitive protein (PARP) | Back alignment and domain information |
|---|
| >gnl|CDD|223066 PHA03379, PHA03379, EBNA-3A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|148139 pfam06346, Drf_FH1, Formin Homology Region 1 | Back alignment and domain information |
|---|
| >gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237802 PRK14723, flhF, flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237011 PRK11892, PRK11892, pyruvate dehydrogenase subunit beta; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217310 pfam02993, MCPVI, Minor capsid protein VI | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218621 pfam05518, Totivirus_coat, Totivirus coat protein | Back alignment and domain information |
|---|
| >gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421) | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237866 PRK14952, PRK14952, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237011 PRK11892, PRK11892, pyruvate dehydrogenase subunit beta; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223041 PHA03321, PHA03321, tegument protein VP11/12; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165539 PHA03282, PHA03282, envelope glycoprotein E; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218397 pfam05044, Prox1, Homeobox prospero-like protein (PROX1) | Back alignment and domain information |
|---|
| >gnl|CDD|114709 pfam06003, SMN, Survival motor neuron protein (SMN) | Back alignment and domain information |
|---|
| >gnl|CDD|223061 PHA03369, PHA03369, capsid maturational protease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|217469 pfam03276, Gag_spuma, Spumavirus gag protein | Back alignment and domain information |
|---|
| >gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421) | Back alignment and domain information |
|---|
| >gnl|CDD|197891 smart00818, Amelogenin, Amelogenins, cell adhesion proteins, play a role in the biomineralisation of teeth | Back alignment and domain information |
|---|
| >gnl|CDD|184927 PRK14963, PRK14963, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|114603 pfam05887, Trypan_PARP, Procyclic acidic repetitive protein (PARP) | Back alignment and domain information |
|---|
| >gnl|CDD|218549 pfam05308, Mito_fiss_reg, Mitochondrial fission regulator | Back alignment and domain information |
|---|
| >gnl|CDD|171499 PRK12438, PRK12438, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222449 pfam13908, Shisa, Wnt and FGF inhibitory regulator | Back alignment and domain information |
|---|
| >gnl|CDD|113398 pfam04625, DEC-1_N, DEC-1 protein, N-terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|113398 pfam04625, DEC-1_N, DEC-1 protein, N-terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|185628 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235540 PRK05641, PRK05641, putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|182059 PRK09752, PRK09752, adhesin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218108 pfam04487, CITED, CITED | Back alignment and domain information |
|---|
| >gnl|CDD|222997 PHA03132, PHA03132, thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236768 PRK10819, PRK10819, transport protein TonB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|152960 pfam12526, DUF3729, Protein of unknown function (DUF3729) | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220441 pfam09849, DUF2076, Uncharacterized protein conserved in bacteria (DUF2076) | Back alignment and domain information |
|---|
| >gnl|CDD|215397 PLN02744, PLN02744, dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex | Back alignment and domain information |
|---|
| >gnl|CDD|218146 pfam04554, Extensin_2, Extensin-like region | Back alignment and domain information |
|---|
| >gnl|CDD|227665 COG5373, COG5373, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|227665 COG5373, COG5373, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|215145 PLN02258, PLN02258, 9-cis-epoxycarotenoid dioxygenase NCED | Back alignment and domain information |
|---|
| >gnl|CDD|225689 COG3147, DedD, Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|220260 pfam09483, HpaP, Type III secretion protein (HpaP) | Back alignment and domain information |
|---|
| >gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) | Back alignment and domain information |
|---|
| >gnl|CDD|171499 PRK12438, PRK12438, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222010 pfam13254, DUF4045, Domain of unknown function (DUF4045) | Back alignment and domain information |
|---|
| >gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220260 pfam09483, HpaP, Type III secretion protein (HpaP) | Back alignment and domain information |
|---|
| >gnl|CDD|233045 TIGR00601, rad23, UV excision repair protein Rad23 | Back alignment and domain information |
|---|
| >gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|220603 pfam10152, DUF2360, Predicted coiled-coil domain-containing protein (DUF2360) | Back alignment and domain information |
|---|
| >gnl|CDD|177464 PHA02682, PHA02682, ORF080 virion core protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235899 PRK06975, PRK06975, bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237011 PRK11892, PRK11892, pyruvate dehydrogenase subunit beta; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222579 pfam14179, YppG, YppG-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|222579 pfam14179, YppG, YppG-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|182059 PRK09752, PRK09752, adhesin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219358 pfam07271, Cytadhesin_P30, Cytadhesin P30/P32 | Back alignment and domain information |
|---|
| >gnl|CDD|219404 pfam07415, Herpes_LMP2, Gammaherpesvirus latent membrane protein (LMP2) protein | Back alignment and domain information |
|---|
| >gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family | Back alignment and domain information |
|---|
| >gnl|CDD|172376 PRK13855, PRK13855, type IV secretion system protein VirB10; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237866 PRK14952, PRK14952, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|99960 cd03784, GT1_Gtf_like, This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin | Back alignment and domain information |
|---|
| >gnl|CDD|184281 PRK13729, PRK13729, conjugal transfer pilus assembly protein TraB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|236768 PRK10819, PRK10819, transport protein TonB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235899 PRK06975, PRK06975, bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237011 PRK11892, PRK11892, pyruvate dehydrogenase subunit beta; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223066 PHA03379, PHA03379, EBNA-3A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218146 pfam04554, Extensin_2, Extensin-like region | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|197891 smart00818, Amelogenin, Amelogenins, cell adhesion proteins, play a role in the biomineralisation of teeth | Back alignment and domain information |
|---|
| >gnl|CDD|220708 pfam10349, WWbp, WW-domain ligand protein | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|220603 pfam10152, DUF2360, Predicted coiled-coil domain-containing protein (DUF2360) | Back alignment and domain information |
|---|
| >gnl|CDD|236382 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|222828 PHA01732, PHA01732, proline-rich protein | Back alignment and domain information |
|---|
| >gnl|CDD|233927 TIGR02557, HpaP, type III secretion protein HpaP | Back alignment and domain information |
|---|
| >gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237802 PRK14723, flhF, flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233692 TIGR02031, BchD-ChlD, magnesium chelatase ATPase subunit D | Back alignment and domain information |
|---|
| >gnl|CDD|222579 pfam14179, YppG, YppG-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|114603 pfam05887, Trypan_PARP, Procyclic acidic repetitive protein (PARP) | Back alignment and domain information |
|---|
| >gnl|CDD|217310 pfam02993, MCPVI, Minor capsid protein VI | Back alignment and domain information |
|---|
| >gnl|CDD|182059 PRK09752, PRK09752, adhesin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216648 pfam01690, PLRV_ORF5, Potato leaf roll virus readthrough protein | Back alignment and domain information |
|---|
| >gnl|CDD|223037 PHA03301, PHA03301, envelope glycoprotein L; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178806 PRK00030, minC, septum formation inhibitor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219897 pfam08549, SWI-SNF_Ssr4, Fungal domain of unknown function (DUF1750) | Back alignment and domain information |
|---|
| >gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|219053 pfam06482, Endostatin, Collagenase NC10 and Endostatin | Back alignment and domain information |
|---|
| >gnl|CDD|236507 PRK09424, pntA, NAD(P) transhydrogenase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221009 pfam11162, DUF2946, Protein of unknown function (DUF2946) | Back alignment and domain information |
|---|
| >gnl|CDD|234398 TIGR03921, T7SS_mycosin, type VII secretion-associated serine protease mycosin | Back alignment and domain information |
|---|
| >gnl|CDD|237191 PRK12757, PRK12757, cell division protein FtsN; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216078 pfam00716, Peptidase_S21, Assemblin (Peptidase family S21) | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165468 PHA03201, PHA03201, uracil DNA glycosylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|152960 pfam12526, DUF3729, Protein of unknown function (DUF3729) | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421) | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184927 PRK14963, PRK14963, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220441 pfam09849, DUF2076, Uncharacterized protein conserved in bacteria (DUF2076) | Back alignment and domain information |
|---|
| >gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237866 PRK14952, PRK14952, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235899 PRK06975, PRK06975, bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237802 PRK14723, flhF, flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233692 TIGR02031, BchD-ChlD, magnesium chelatase ATPase subunit D | Back alignment and domain information |
|---|
| >gnl|CDD|227505 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >gnl|CDD|165539 PHA03282, PHA03282, envelope glycoprotein E; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|171499 PRK12438, PRK12438, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218146 pfam04554, Extensin_2, Extensin-like region | Back alignment and domain information |
|---|
| >gnl|CDD|215145 PLN02258, PLN02258, 9-cis-epoxycarotenoid dioxygenase NCED | Back alignment and domain information |
|---|
| >gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|226435 COG3921, COG3921, Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220596 pfam10138, Tellurium_res, Tellurium resistance protein | Back alignment and domain information |
|---|
| >gnl|CDD|234797 PRK00575, tatA, twin arginine translocase protein A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234818 PRK00708, PRK00708, sec-independent translocase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220260 pfam09483, HpaP, Type III secretion protein (HpaP) | Back alignment and domain information |
|---|
| >gnl|CDD|220441 pfam09849, DUF2076, Uncharacterized protein conserved in bacteria (DUF2076) | Back alignment and domain information |
|---|
| >gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|177618 PHA03381, PHA03381, tegument protein VP22; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227505 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >gnl|CDD|171499 PRK12438, PRK12438, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|113398 pfam04625, DEC-1_N, DEC-1 protein, N-terminal region | Back alignment and domain information |
|---|
| >gnl|CDD|99960 cd03784, GT1_Gtf_like, This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin | Back alignment and domain information |
|---|
| >gnl|CDD|223037 PHA03301, PHA03301, envelope glycoprotein L; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237191 PRK12757, PRK12757, cell division protein FtsN; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237191 PRK12757, PRK12757, cell division protein FtsN; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237782 PRK14666, uvrC, excinuclease ABC subunit C; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226414 COG3898, COG3898, Uncharacterized membrane-bound protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|235665 PRK05996, motB, flagellar motor protein MotB; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235777 PRK06302, PRK06302, acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|165527 PHA03269, PHA03269, envelope glycoprotein C; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235899 PRK06975, PRK06975, bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233692 TIGR02031, BchD-ChlD, magnesium chelatase ATPase subunit D | Back alignment and domain information |
|---|
| >gnl|CDD|182059 PRK09752, PRK09752, adhesin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233508 TIGR01649, hnRNP-L_PTB, hnRNP-L/PTB/hephaestus splicing factor family | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 699 | |||
| KOG1924 | 1102 | consensus RhoA GTPase effector DIA/Diaphanous [Sig | 100.0 | |
| smart00498 | 432 | FH2 Formin Homology 2 Domain. FH proteins control | 100.0 | |
| PF02181 | 370 | FH2: Formin Homology 2 Domain; InterPro: IPR015425 | 100.0 | |
| KOG1922 | 833 | consensus Rho GTPase effector BNI1 and related for | 100.0 | |
| KOG1923 | 830 | consensus Rac1 GTPase effector FRL [Signal transdu | 100.0 | |
| KOG1925 | 817 | consensus Rac1 GTPase effector FHOS [Signal transd | 100.0 | |
| KOG3671 | 569 | consensus Actin regulatory protein (Wiskott-Aldric | 99.33 | |
| KOG1924 | 1102 | consensus RhoA GTPase effector DIA/Diaphanous [Sig | 99.11 | |
| smart00498 | 432 | FH2 Formin Homology 2 Domain. FH proteins control | 98.08 | |
| PHA03247 | 3151 | large tegument protein UL36; Provisional | 97.98 | |
| PHA03247 | 3151 | large tegument protein UL36; Provisional | 97.94 | |
| KOG3671 | 569 | consensus Actin regulatory protein (Wiskott-Aldric | 97.87 | |
| KOG1830 | 518 | consensus Wiskott Aldrich syndrome proteins [Cytos | 97.09 | |
| KOG1923 | 830 | consensus Rac1 GTPase effector FRL [Signal transdu | 94.59 | |
| KOG1830 | 518 | consensus Wiskott Aldrich syndrome proteins [Cytos | 94.56 | |
| cd00132 | 42 | CRIB PAK (p21 activated kinase) Binding Domain (PB | 94.13 | |
| PHA03378 | 991 | EBNA-3B; Provisional | 92.07 | |
| PHA03378 | 991 | EBNA-3B; Provisional | 91.74 | |
| KOG1922 | 833 | consensus Rho GTPase effector BNI1 and related for | 89.17 | |
| PF00786 | 59 | PBD: P21-Rho-binding domain; InterPro: IPR000095 T | 88.15 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 87.61 | |
| KOG4672 | 487 | consensus Uncharacterized conserved low complexity | 87.27 | |
| smart00285 | 36 | PBD P21-Rho-binding domain. Small domains that bin | 86.95 | |
| KOG4849 | 498 | consensus mRNA cleavage factor I subunit/CPSF subu | 84.73 |
| >KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.8e-72 Score=613.67 Aligned_cols=382 Identities=28% Similarity=0.413 Sum_probs=338.5
Q ss_pred CCCCCCCCCCCCCcccccccccCC-CCcccccccccCccccc--HHHHHHHhcccccccccc----ccCCCCCCCCccee
Q 005376 232 AEGDANAPKTKLKPFFWDKVLANP-DNSMVWHQIKSGSFQFN--EEMIETLFGYSEKSKNEK----KKGSSLDTGPQYIQ 304 (699)
Q Consensus 232 ~~~~~~~Pk~klK~l~W~ki~~~~-~~~TiW~~i~~~~~~~d--~~~lE~lF~~~~~~k~~~----kk~~~~~~~~~~v~ 304 (699)
..++...|...||+++|.+|.+.. .++.+|-.++++.+.-| +..|..-|+.+...+.+. -|.+..+++.+...
T Consensus 615 kpKK~~k~e~~Mrr~nW~kI~p~d~s~~cFWvkv~Edk~en~dlfakL~~~Fatq~k~~k~~e~~eekkt~~kKk~kel~ 694 (1102)
T KOG1924|consen 615 KPKKVYKPEVPMRRFNWSKIVPRDLSENCFWVKVNEDKLENDDLFAKLALKFATQPKVKKEQEGGEEKKTGTKKKVKELR 694 (1102)
T ss_pred CccccCCCCCccccCCccccCccccCccceeeecchhhccchHHHHHHHHHhhccccccccccccccccchhhhhhhhhe
Confidence 345667788999999999997654 57899999998877633 245667798874433321 11122456788899
Q ss_pred ecChHHHhhHHHHHHhcCCCHHHHHHHhhcCC--CCcHHHHHHHHhcCCCHHHHHHHHhhccccccCChHHHHHHHHcCC
Q 005376 305 IIDQKKAQNLSIMLRALNVTLEEVCDALLEGN--ELPAELIQTLLKMAPTAEEELKLRLFNGELSQLGPAERFLKALVDI 382 (699)
Q Consensus 305 iLd~kraqni~I~L~~l~~s~~ei~~al~~~~--~L~~e~l~~Ll~~~Pt~eE~~~l~~~~~d~~~L~~aE~Fl~~l~~I 382 (699)
|||.|.|||++|+|..|+++++||+.+|++.| .|+...|++|++.+|..|-+.+|+++....+.|.+.|||...|..|
T Consensus 695 ilDsKtaQnLsIflgS~rmpyeeik~~ILevne~vLse~~iqnLik~lPe~E~l~~L~e~Kaeye~l~e~EQF~vvm~~v 774 (1102)
T KOG1924|consen 695 ILDSKTAQNLSIFLGSFRMPYEEIKNVILEVNEDVLSESMIQNLIKHLPEQEQLNKLSELKAEYEDLPEPEQFVVVMSQV 774 (1102)
T ss_pred ecchHHHHHHHHHHhhccCCHHHHHHHHhhccHHHHHHHHHHHHHHhCCCHHHHHHHHHHHHhccCCCCHHHHhHHHhhc
Confidence 99999999999999999999999999999987 4999999999999999999999999988889999999999999999
Q ss_pred cChHHHHHHHHHhhhhHHHHHHHHHHHHHHHHHHHHHhhcHHHHHHHHHHHHhcccccCCCCCcceeeeecccccccccc
Q 005376 383 PFSFKRLEALLFMCTLQEEVSATKESFEILEVACKELRNSRLFLKLLEAVLKTGNRMNDGTFRGGAQAFKLDTLLKLSDV 462 (699)
Q Consensus 383 p~~~~Rl~~l~f~~~f~~~~~~l~~~l~~l~~A~~~l~~S~~~~~lL~~vL~~GN~lN~gt~rg~A~GFkL~sL~KL~d~ 462 (699)
.++.-||.+++|+.+|.+.+++|++.|..+..||++||+|+.|.+||++||.+|||||+|+...+|+||.|++|.||.||
T Consensus 775 krL~pRL~~ilFKl~fse~vnniKP~i~avt~ACEE~rkSesFs~lLeLvLl~GNyMn~gSrNa~afgF~is~L~kL~dT 854 (1102)
T KOG1924|consen 775 KRLRPRLSAILFKLTFSEQVNNIKPDIVAVTAACEELRKSESFSKLLELVLLVGNYMNSGSRNAQAFGFNISFLCKLRDT 854 (1102)
T ss_pred cccChhHHHHHHHhhHHHHHhhcChHHHHHHHHHHHHHhhhhHHHHHHHHHHHhcccccccccchhhccchHHHHhhccc
Confidence 99999999999999999999999999999999999999999999999999999999999998899999999999999999
Q ss_pred ccCCCCccHHHHHHHHHHhhhhhhHHhhhhcccccccccchhhHhhhcCCccchHHHHhhhhhhhcchhhhHHHHHHHhh
Q 005376 463 KGVDGKTTLLHFVVQEIIRSEGVRAARRARESRSFSSVKTDDLLEETSKSNETDEHYRNLGLQAVSHLSSELENVKKAAA 542 (699)
Q Consensus 463 Ks~d~k~tLLh~lv~~i~~~~~~~~~~~~~e~~s~~~~~~~~ll~~~~~~~~~~e~~~~lgl~~v~~l~~eL~~V~kAa~ 542 (699)
|++|+|+||||||++.+. +.|++ +..|.+||++|.+|++
T Consensus 855 KsaDqk~TLLHfLae~~e------------------------------------~kypd-----~l~F~ddl~hv~kaSr 893 (1102)
T KOG1924|consen 855 KSADQKTTLLHFLAEICE------------------------------------EKYPD-----ILKFPDDLEHVEKASR 893 (1102)
T ss_pred cccchhhHHHHHHHHHHH------------------------------------HhChh-----hhcchhhHHHHHhhcc
Confidence 999999999999997442 33433 4578899999999999
Q ss_pred hcHHHHHHHHHHHHHHHHHHHHHhhhhccccCCCcchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcccccCCCCcc
Q 005376 543 IDADSLTGTVSKLGHALLKTRDFLNTDMKNLGENSGFHETLKSFVQNAEGDIMWLLEEEKRIMSLVKSTGDYFHGNAGKD 622 (699)
Q Consensus 543 vd~d~L~~~v~~L~~~l~~~~~~l~~~~~~~~~~~~F~~~m~~Fl~~Ae~~i~~L~e~~~~~~~~~k~l~~YFged~~k~ 622 (699)
|++|.|.+.+..++..+.+.+..+....-.-.++|.|.++|..|.+.|.+++..|..+..+|+.+|+++.+||.-|++|.
T Consensus 894 vnad~ikK~~~~m~~~ik~Le~dlk~~~~~~~e~dkF~ekM~~F~e~a~eq~~~ls~M~~~M~~lye~L~eYyaFd~kky 973 (1102)
T KOG1924|consen 894 VNADEIKKNLQQMENQIKKLERDLKNFKIAGNEHDKFVEKMTSFHEKAREQYSKLSSMHGNMEKLYESLGEYYAFDPKKY 973 (1102)
T ss_pred ccHHHHHHHHHHHHHHHHHHHHHHHhcCCCCcchhhHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHeecCcccC
Confidence 99999999999999999998887754333334678999999999999999999999999999999999999999999999
Q ss_pred chhhhcHHHHHHHHHHHHHHHHHHhhhhhhhh
Q 005376 623 EGLRLFTIVRDFFIMLDKACKQVKDAPKKSTK 654 (699)
Q Consensus 623 e~~~fF~iv~dFl~~l~ka~kEv~~~~kr~~k 654 (699)
..++||+.+++|-..|..|.+|+.+.|+.++|
T Consensus 974 smEEFFaDi~tFrnaf~ea~~en~krRee~Ek 1005 (1102)
T KOG1924|consen 974 SMEEFFADIRTFRNAFLEAVAENEKRREEEEK 1005 (1102)
T ss_pred cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 99999999999999999999999888776654
|
|
| >smart00498 FH2 Formin Homology 2 Domain | Back alignment and domain information |
|---|
| >PF02181 FH2: Formin Homology 2 Domain; InterPro: IPR015425 Formin homology (FH) proteins play a crucial role in the reorganisation of the actin cytoskeleton, which mediates various functions of the cell cortex including motility, adhesion, and cytokinesis [] | Back alignment and domain information |
|---|
| >KOG1922 consensus Rho GTPase effector BNI1 and related formins [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1923 consensus Rac1 GTPase effector FRL [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1925 consensus Rac1 GTPase effector FHOS [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG3671 consensus Actin regulatory protein (Wiskott-Aldrich syndrome protein) [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >smart00498 FH2 Formin Homology 2 Domain | Back alignment and domain information |
|---|
| >PHA03247 large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >PHA03247 large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >KOG3671 consensus Actin regulatory protein (Wiskott-Aldrich syndrome protein) [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1830 consensus Wiskott Aldrich syndrome proteins [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1923 consensus Rac1 GTPase effector FRL [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1830 consensus Wiskott Aldrich syndrome proteins [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd00132 CRIB PAK (p21 activated kinase) Binding Domain (PBD), binds Cdc42p- and/or Rho-like small GTPases; also known as the Cdc42/Rac interactive binding (CRIB) motif; has been shown to inhibit transcriptional activation and cell transformation mediated by the Ras-Rac pathway | Back alignment and domain information |
|---|
| >PHA03378 EBNA-3B; Provisional | Back alignment and domain information |
|---|
| >PHA03378 EBNA-3B; Provisional | Back alignment and domain information |
|---|
| >KOG1922 consensus Rho GTPase effector BNI1 and related formins [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF00786 PBD: P21-Rho-binding domain; InterPro: IPR000095 The molecular bases of the versatile functions of Rho-like GTPases are still unknown | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG4672 consensus Uncharacterized conserved low complexity protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00285 PBD P21-Rho-binding domain | Back alignment and domain information |
|---|
| >KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 699 | ||||
| 3o4x_E | 467 | Crystal Structure Of Complex Between Amino And Carb | 7e-24 | ||
| 3obv_E | 457 | Autoinhibited Formin Mdia1 Structure Length = 457 | 2e-23 | ||
| 1v9d_A | 340 | Crystal Structure Of The Core Fh2 Domain Of Mouse M | 2e-23 | ||
| 2j1d_G | 483 | Crystallization Of Hdaam1 C-Terminal Fragment Lengt | 4e-19 | ||
| 2z6e_A | 419 | Crystal Structure Of Human Daam1 Fh2 Length = 419 | 5e-19 | ||
| 4eah_A | 402 | Crystal Structure Of The Formin Homology 2 Domain O | 5e-15 |
| >pdb|3O4X|E Chain E, Crystal Structure Of Complex Between Amino And Carboxy Terminal Fragments Of Mdia1 Length = 467 | Back alignment and structure |
|
| >pdb|3OBV|E Chain E, Autoinhibited Formin Mdia1 Structure Length = 457 | Back alignment and structure |
| >pdb|1V9D|A Chain A, Crystal Structure Of The Core Fh2 Domain Of Mouse Mdia1 Length = 340 | Back alignment and structure |
| >pdb|2J1D|G Chain G, Crystallization Of Hdaam1 C-Terminal Fragment Length = 483 | Back alignment and structure |
| >pdb|2Z6E|A Chain A, Crystal Structure Of Human Daam1 Fh2 Length = 419 | Back alignment and structure |
| >pdb|4EAH|A Chain A, Crystal Structure Of The Formin Homology 2 Domain Of Fmnl3 Bound To Actin Length = 402 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 699 | |||
| 3obv_E | 457 | Protein diaphanous homolog 1; autoinhibition, acti | 1e-114 | |
| 2j1d_G | 483 | DAAM1, disheveled-associated activator of morphoge | 1e-107 | |
| 1v9d_A | 340 | Diaphanous protein homolog 1; helix bundle, protei | 1e-103 | |
| 1ux5_A | 411 | BNI1 protein; structural protein, FH2 actin cytosk | 1e-83 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 3e-16 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 7e-16 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 5e-11 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 1e-06 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 4e-14 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 5e-14 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 1e-13 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 3e-12 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 1e-11 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 2e-11 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 2e-11 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 2e-10 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 1e-09 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 1e-09 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 2e-07 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 2e-12 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 3e-11 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 4e-11 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 2e-10 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 2e-09 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 1e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-12 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-11 | |
| 2grx_C | 229 | Protein TONB; beta barrel, outer membrane, heteroc | 4e-12 | |
| 2grx_C | 229 | Protein TONB; beta barrel, outer membrane, heteroc | 2e-11 | |
| 2grx_C | 229 | Protein TONB; beta barrel, outer membrane, heteroc | 2e-11 | |
| 2grx_C | 229 | Protein TONB; beta barrel, outer membrane, heteroc | 5e-11 | |
| 2grx_C | 229 | Protein TONB; beta barrel, outer membrane, heteroc | 3e-10 | |
| 2grx_C | 229 | Protein TONB; beta barrel, outer membrane, heteroc | 6e-09 | |
| 2grx_C | 229 | Protein TONB; beta barrel, outer membrane, heteroc | 1e-08 | |
| 2grx_C | 229 | Protein TONB; beta barrel, outer membrane, heteroc | 3e-08 | |
| 2grx_C | 229 | Protein TONB; beta barrel, outer membrane, heteroc | 1e-06 | |
| 2grx_C | 229 | Protein TONB; beta barrel, outer membrane, heteroc | 5e-05 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 1e-11 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 2e-10 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 8e-10 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 2e-09 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 7e-09 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 5e-06 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 6e-06 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 6e-06 | |
| 1dx0_A | 219 | Prion protein; brain, repeat; NMR {Bos taurus} SCO | 3e-11 | |
| 1dx0_A | 219 | Prion protein; brain, repeat; NMR {Bos taurus} SCO | 1e-10 | |
| 1dx0_A | 219 | Prion protein; brain, repeat; NMR {Bos taurus} SCO | 1e-08 | |
| 1dx0_A | 219 | Prion protein; brain, repeat; NMR {Bos taurus} SCO | 3e-06 | |
| 1dx0_A | 219 | Prion protein; brain, repeat; NMR {Bos taurus} SCO | 3e-06 | |
| 3oun_A | 157 | Putative uncharacterized protein TB39.8; peptidogl | 7e-10 | |
| 3oun_A | 157 | Putative uncharacterized protein TB39.8; peptidogl | 1e-07 | |
| 3oun_A | 157 | Putative uncharacterized protein TB39.8; peptidogl | 1e-06 | |
| 3oun_A | 157 | Putative uncharacterized protein TB39.8; peptidogl | 5e-06 | |
| 3oun_A | 157 | Putative uncharacterized protein TB39.8; peptidogl | 9e-06 | |
| 3oun_A | 157 | Putative uncharacterized protein TB39.8; peptidogl | 1e-05 | |
| 3oun_A | 157 | Putative uncharacterized protein TB39.8; peptidogl | 2e-05 | |
| 3oun_A | 157 | Putative uncharacterized protein TB39.8; peptidogl | 1e-04 | |
| 2yew_A | 253 | Capsid protein, coat protein; alphavirus, molecula | 1e-09 | |
| 2yew_A | 253 | Capsid protein, coat protein; alphavirus, molecula | 8e-09 | |
| 2yew_A | 253 | Capsid protein, coat protein; alphavirus, molecula | 7e-08 | |
| 2yew_A | 253 | Capsid protein, coat protein; alphavirus, molecula | 4e-07 | |
| 2yew_A | 253 | Capsid protein, coat protein; alphavirus, molecula | 1e-05 | |
| 2yew_A | 253 | Capsid protein, coat protein; alphavirus, molecula | 1e-04 | |
| 1pk8_A | 422 | RAT synapsin I; ATP binding, ATP grAsp, calcium (I | 4e-09 | |
| 1pk8_A | 422 | RAT synapsin I; ATP binding, ATP grAsp, calcium (I | 4e-07 | |
| 1pk8_A | 422 | RAT synapsin I; ATP binding, ATP grAsp, calcium (I | 1e-04 | |
| 1pk8_A | 422 | RAT synapsin I; ATP binding, ATP grAsp, calcium (I | 1e-04 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 1e-08 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 2e-08 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 2e-08 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 2e-07 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 2e-07 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 3e-06 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 9e-05 | |
| 3q2s_C | 229 | Cleavage and polyadenylation specificity factor S; | 2e-08 | |
| 3q2s_C | 229 | Cleavage and polyadenylation specificity factor S; | 2e-08 | |
| 3q2s_C | 229 | Cleavage and polyadenylation specificity factor S; | 9e-07 | |
| 3q2s_C | 229 | Cleavage and polyadenylation specificity factor S; | 5e-05 | |
| 3q2s_C | 229 | Cleavage and polyadenylation specificity factor S; | 4e-04 | |
| 3q2s_C | 229 | Cleavage and polyadenylation specificity factor S; | 7e-04 | |
| 3q2s_C | 229 | Cleavage and polyadenylation specificity factor S; | 7e-04 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 4e-08 | |
| 2z73_A | 448 | Rhodopsin; visual pigment, GQ-type, G-protein coup | 6e-08 | |
| 2z73_A | 448 | Rhodopsin; visual pigment, GQ-type, G-protein coup | 1e-07 | |
| 2z73_A | 448 | Rhodopsin; visual pigment, GQ-type, G-protein coup | 1e-06 | |
| 2z73_A | 448 | Rhodopsin; visual pigment, GQ-type, G-protein coup | 5e-06 | |
| 2vg3_A | 284 | Undecaprenyl pyrophosphate synthetase; transferase | 9e-08 | |
| 2vg3_A | 284 | Undecaprenyl pyrophosphate synthetase; transferase | 3e-05 | |
| 3nwa_A | 703 | GB, GB-1, GB1, envelope glycoprotein B; coiled-coi | 1e-07 | |
| 3nwa_A | 703 | GB, GB-1, GB1, envelope glycoprotein B; coiled-coi | 2e-07 | |
| 3nwa_A | 703 | GB, GB-1, GB1, envelope glycoprotein B; coiled-coi | 4e-07 | |
| 3nwa_A | 703 | GB, GB-1, GB1, envelope glycoprotein B; coiled-coi | 2e-06 | |
| 3nwa_A | 703 | GB, GB-1, GB1, envelope glycoprotein B; coiled-coi | 3e-06 | |
| 3nwa_A | 703 | GB, GB-1, GB1, envelope glycoprotein B; coiled-coi | 4e-06 | |
| 3nwa_A | 703 | GB, GB-1, GB1, envelope glycoprotein B; coiled-coi | 6e-06 | |
| 3nwa_A | 703 | GB, GB-1, GB1, envelope glycoprotein B; coiled-coi | 1e-05 | |
| 1mv3_A | 213 | MYC box dependent interacting protein 1; tumor sup | 2e-07 | |
| 1mv3_A | 213 | MYC box dependent interacting protein 1; tumor sup | 2e-07 | |
| 1mv3_A | 213 | MYC box dependent interacting protein 1; tumor sup | 4e-05 | |
| 1kxf_A | 264 | Sindbis virus capsid protein; chymotrypsin-like se | 2e-07 | |
| 1kxf_A | 264 | Sindbis virus capsid protein; chymotrypsin-like se | 4e-06 | |
| 1kxf_A | 264 | Sindbis virus capsid protein; chymotrypsin-like se | 1e-05 | |
| 1kxf_A | 264 | Sindbis virus capsid protein; chymotrypsin-like se | 1e-05 | |
| 3a58_A | 320 | Exocyst complex component SEC3; protein complex, P | 2e-07 | |
| 3a58_A | 320 | Exocyst complex component SEC3; protein complex, P | 3e-07 | |
| 3a58_A | 320 | Exocyst complex component SEC3; protein complex, P | 6e-07 | |
| 3a58_A | 320 | Exocyst complex component SEC3; protein complex, P | 9e-07 | |
| 3a58_A | 320 | Exocyst complex component SEC3; protein complex, P | 1e-06 | |
| 3a58_A | 320 | Exocyst complex component SEC3; protein complex, P | 7e-06 | |
| 3a58_A | 320 | Exocyst complex component SEC3; protein complex, P | 5e-05 | |
| 1eys_C | 382 | Photosynthetic reaction center; membrane protein c | 3e-07 | |
| 1eys_C | 382 | Photosynthetic reaction center; membrane protein c | 2e-05 | |
| 1eys_C | 382 | Photosynthetic reaction center; membrane protein c | 1e-04 | |
| 1eys_C | 382 | Photosynthetic reaction center; membrane protein c | 1e-04 | |
| 2wvr_C | 546 | DNA replication factor CDT1; DNA replication licen | 3e-07 | |
| 2wvr_C | 546 | DNA replication factor CDT1; DNA replication licen | 2e-05 | |
| 2wvr_C | 546 | DNA replication factor CDT1; DNA replication licen | 3e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 4e-07 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 5e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 7e-06 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 2e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 3e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 7e-05 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-04 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 1e-04 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 4e-04 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 4e-04 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 7e-04 | |
| 1y0f_A | 1054 | Collagen I alpha 1; native, in SITU, triple-helix, | 8e-04 | |
| 3tx7_B | 352 | Nuclear receptor subfamily 5 group A member 2; LRH | 4e-07 | |
| 3tx7_B | 352 | Nuclear receptor subfamily 5 group A member 2; LRH | 1e-06 | |
| 3tx7_B | 352 | Nuclear receptor subfamily 5 group A member 2; LRH | 4e-05 | |
| 3iox_A | 497 | AGI/II, PA; alpha helix, PPII helix, supersandwich | 5e-07 | |
| 3iox_A | 497 | AGI/II, PA; alpha helix, PPII helix, supersandwich | 2e-06 | |
| 3iox_A | 497 | AGI/II, PA; alpha helix, PPII helix, supersandwich | 8e-06 | |
| 3iox_A | 497 | AGI/II, PA; alpha helix, PPII helix, supersandwich | 1e-05 | |
| 3iox_A | 497 | AGI/II, PA; alpha helix, PPII helix, supersandwich | 2e-04 | |
| 2kpy_A | 108 | Major pollen allergen ART V 1; defensin-like, poly | 2e-06 | |
| 2kpy_A | 108 | Major pollen allergen ART V 1; defensin-like, poly | 5e-06 | |
| 2kpy_A | 108 | Major pollen allergen ART V 1; defensin-like, poly | 4e-05 | |
| 2uv9_A | 1878 | Fatty acid synthase alpha subunits; fungal, dehydr | 3e-06 | |
| 2uv9_A | 1878 | Fatty acid synthase alpha subunits; fungal, dehydr | 6e-06 | |
| 2uv9_A | 1878 | Fatty acid synthase alpha subunits; fungal, dehydr | 9e-06 | |
| 2uv9_A | 1878 | Fatty acid synthase alpha subunits; fungal, dehydr | 1e-05 | |
| 2uv9_A | 1878 | Fatty acid synthase alpha subunits; fungal, dehydr | 1e-05 | |
| 2uv9_A | 1878 | Fatty acid synthase alpha subunits; fungal, dehydr | 1e-05 | |
| 2uv9_A | 1878 | Fatty acid synthase alpha subunits; fungal, dehydr | 1e-05 | |
| 2uv9_A | 1878 | Fatty acid synthase alpha subunits; fungal, dehydr | 2e-04 | |
| 2uv9_A | 1878 | Fatty acid synthase alpha subunits; fungal, dehydr | 2e-04 | |
| 2uv9_A | 1878 | Fatty acid synthase alpha subunits; fungal, dehydr | 2e-04 | |
| 2uv9_A | 1878 | Fatty acid synthase alpha subunits; fungal, dehydr | 3e-04 | |
| 2uv8_A | 1887 | Fatty acid synthase subunit alpha (FAS2); fatty ac | 4e-06 | |
| 2uv8_A | 1887 | Fatty acid synthase subunit alpha (FAS2); fatty ac | 5e-06 | |
| 2uv8_A | 1887 | Fatty acid synthase subunit alpha (FAS2); fatty ac | 5e-06 | |
| 2uv8_A | 1887 | Fatty acid synthase subunit alpha (FAS2); fatty ac | 5e-06 | |
| 2uv8_A | 1887 | Fatty acid synthase subunit alpha (FAS2); fatty ac | 1e-05 | |
| 2uv8_A | 1887 | Fatty acid synthase subunit alpha (FAS2); fatty ac | 3e-05 | |
| 2uv8_A | 1887 | Fatty acid synthase subunit alpha (FAS2); fatty ac | 4e-05 | |
| 2uv8_A | 1887 | Fatty acid synthase subunit alpha (FAS2); fatty ac | 5e-04 | |
| 2uv8_A | 1887 | Fatty acid synthase subunit alpha (FAS2); fatty ac | 5e-04 | |
| 2uv8_A | 1887 | Fatty acid synthase subunit alpha (FAS2); fatty ac | 7e-04 | |
| 3i2d_A | 371 | E3 SUMO-protein ligase SIZ1; signal transduction, | 4e-06 | |
| 3i2d_A | 371 | E3 SUMO-protein ligase SIZ1; signal transduction, | 2e-05 | |
| 3i2d_A | 371 | E3 SUMO-protein ligase SIZ1; signal transduction, | 2e-05 | |
| 3i2d_A | 371 | E3 SUMO-protein ligase SIZ1; signal transduction, | 7e-05 | |
| 3i2d_A | 371 | E3 SUMO-protein ligase SIZ1; signal transduction, | 4e-04 | |
| 3i2d_A | 371 | E3 SUMO-protein ligase SIZ1; signal transduction, | 5e-04 | |
| 3dva_I | 428 | Dihydrolipoyllysine-residue acetyltransferase comp | 5e-06 | |
| 3dva_I | 428 | Dihydrolipoyllysine-residue acetyltransferase comp | 3e-05 | |
| 3dva_I | 428 | Dihydrolipoyllysine-residue acetyltransferase comp | 5e-04 | |
| 3oti_A | 398 | CALG3; calicheamicin, TDP, structural genomics, PS | 1e-05 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 2e-05 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 4e-05 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 5e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 2e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 6e-05 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 3e-04 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 6e-04 | |
| 1y0f_B | 1026 | Collagen I alpha 2; native, in SITU, triple-helix, | 7e-04 | |
| 2ff4_A | 388 | Probable regulatory protein EMBR; winged-helix, te | 4e-05 | |
| 2ff4_A | 388 | Probable regulatory protein EMBR; winged-helix, te | 8e-05 | |
| 2ff4_A | 388 | Probable regulatory protein EMBR; winged-helix, te | 2e-04 | |
| 2ff4_A | 388 | Probable regulatory protein EMBR; winged-helix, te | 3e-04 | |
| 1jer_A | 138 | Cucumber stellacyanin; electron transport, copper, | 4e-05 | |
| 1x9d_A | 538 | Endoplasmic reticulum mannosyl-oligosaccharide 1, | 5e-05 | |
| 1x9d_A | 538 | Endoplasmic reticulum mannosyl-oligosaccharide 1, | 6e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 5e-05 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 1e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 2e-04 | |
| 2yjn_A | 441 | ERYCIII, glycosyltransferase; transferase, cytochr | 6e-05 | |
| 1pcx_A | 810 | Protein transport protein SEC24; 2.50A {Saccharomy | 8e-05 | |
| 4f6o_A | 350 | Metacaspase-1; rossmann fold, hydrolase; HET: DFH; | 1e-04 | |
| 3tsa_A | 391 | SPNG, NDP-rhamnosyltransferase; glycosyltransferas | 2e-04 | |
| 1g9l_A | 144 | Polyadenylate-binding protein 1; all-helical domai | 2e-04 | |
| 1g9l_A | 144 | Polyadenylate-binding protein 1; all-helical domai | 8e-04 | |
| 3ttv_A | 753 | Catalase HPII; heme orientation, oxidoreductase; H | 3e-04 | |
| 3pgw_A | 282 | U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c | 3e-04 | |
| 4af8_A | 367 | Metacaspase MCA2; hydrolase, cysteine peptidase, c | 3e-04 | |
| 4af8_A | 367 | Metacaspase MCA2; hydrolase, cysteine peptidase, c | 6e-04 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 4e-04 | |
| 1t9b_A | 677 | Acetolactate synthase, mitochondrial; acetohydroxy | 5e-04 | |
| 3aqq_A | 147 | Calcium-regulated heat stable protein 1; compact b | 7e-04 | |
| 3m1c_B | 204 | GL, envelope glycoprotein L; glycoprotein H, GH/GL | 7e-04 | |
| 1jvr_A | 137 | HTLV-II MA, MA, human T-cell leukemia virus type I | 8e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 8e-04 |
| >3obv_E Protein diaphanous homolog 1; autoinhibition, actin, nucleation, cytoskeleton, structural; HET: SUC; 2.75A {Mus musculus} PDB: 3o4x_E 2bap_D Length = 457 | Back alignment and structure |
|---|
Score = 349 bits (898), Expect = e-114
Identities = 108/448 (24%), Positives = 179/448 (39%), Gaps = 53/448 (11%)
Query: 239 PKTKLKPFFWDKVLAN-PDNSMVWHQIKSGSFQFNEEM--IETLFGYSEKSKNEKKKGSS 295
P+ +L+ W K +A W ++K F+ NE + F K+ KK
Sbjct: 6 PEVQLRRPNWSKFVAEDLSQDCFWTKVKEDRFENNELFAKLTLAFSAQTKTSKAKKDQEG 65
Query: 296 LDTG-------PQYIQIIDQKKAQNLSIMLRALNVTLEEVCDALLEGNE--LPAELIQTL 346
+ + ++++D K AQNLSI L + + +E+ + +LE NE L +IQ L
Sbjct: 66 GEEKKSVQKKKVKELKVLDSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNL 125
Query: 347 LKMAPTAEEELKLRLFNGELSQLGPAERFLKALVDIPFSFKRLEALLFMCTLQEEVSATK 406
+K P E+ L E L +E+F + +P RL A+LF E+V K
Sbjct: 126 IKQMPEPEQLKMLSELKEEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIK 185
Query: 407 ESFEILEVACKELRNSRLFLKLLEAVLKTGNRMNDGTFRGGAQAFKLDTLLKLSDVKGVD 466
+ AC+ELR S F LLE L GN MN G+ GA F + L KL D K D
Sbjct: 186 PEIVSVTAACEELRKSENFSSLLELTLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSAD 245
Query: 467 GKTTLLHFVVQEIIRSEGVRAARRARESRSFSSVKTDDLLEETSKSNETDEHYRNLGLQA 526
K TLLHF+ + + + +
Sbjct: 246 QKMTLLHFLAELC------------------------------------ENDHPEV---- 265
Query: 527 VSHLSSELENVKKAAAIDADSLTGTVSKLGHALLKTRDFLNTDMKNLGENSGFHETLKSF 586
EL +V+KA+ + A++L ++ ++ + + E F E + SF
Sbjct: 266 -LKFPDELAHVEKASRVSAENLQKSLDQMKKQIADVERDVQNFPAATDEKDKFVEKMTSF 324
Query: 587 VQNAEGDIMWLLEEEKRIMSLVKSTGDYFHGNAGKDEGLRLFTIVRDFFIMLDKACKQVK 646
V++A+ L + +L K GDYF + K F + +F M +A K+ +
Sbjct: 325 VKDAQEQYNKLRMMHSNMETLYKELGDYFVFDPKKLSVEEFFMDLHNFRNMFLQAVKENQ 384
Query: 647 DAPKKSTKSLKKEGSTASSSSDTPQQPS 674
+ K + + + + + ++
Sbjct: 385 KRRETEEKMRRAKLAKEKAEKERLEKQQ 412
|
| >2j1d_G DAAM1, disheveled-associated activator of morphogenesis; actin assembly, protein binding; 2.55A {Homo sapiens} PDB: 2z6e_A Length = 483 | Back alignment and structure |
|---|
| >1v9d_A Diaphanous protein homolog 1; helix bundle, protein binding; 2.60A {Mus musculus} SCOP: a.207.1.1 Length = 340 | Back alignment and structure |
|---|
| >1ux5_A BNI1 protein; structural protein, FH2 actin cytoskeleton; 2.5A {Saccharomyces cerevisiae} SCOP: a.207.1.1 PDB: 1y64_B* 1ux4_A Length = 411 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 | Back alignment and structure |
|---|
| >2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 | Back alignment and structure |
|---|
| >2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 | Back alignment and structure |
|---|
| >2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 | Back alignment and structure |
|---|
| >2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 | Back alignment and structure |
|---|
| >2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 | Back alignment and structure |
|---|
| >2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 | Back alignment and structure |
|---|
| >2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 | Back alignment and structure |
|---|
| >2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 | Back alignment and structure |
|---|
| >2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 | Back alignment and structure |
|---|
| >1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Length = 219 | Back alignment and structure |
|---|
| >1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Length = 219 | Back alignment and structure |
|---|
| >1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Length = 219 | Back alignment and structure |
|---|
| >1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Length = 219 | Back alignment and structure |
|---|
| >1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Length = 219 | Back alignment and structure |
|---|
| >3oun_A Putative uncharacterized protein TB39.8; peptidoglycan, Ser/Thr kinase, pseudokinase, FHA domain, REG phosphorylation; HET: TPO; 2.71A {Mycobacterium tuberculosis} Length = 157 | Back alignment and structure |
|---|
| >3oun_A Putative uncharacterized protein TB39.8; peptidoglycan, Ser/Thr kinase, pseudokinase, FHA domain, REG phosphorylation; HET: TPO; 2.71A {Mycobacterium tuberculosis} Length = 157 | Back alignment and structure |
|---|
| >3oun_A Putative uncharacterized protein TB39.8; peptidoglycan, Ser/Thr kinase, pseudokinase, FHA domain, REG phosphorylation; HET: TPO; 2.71A {Mycobacterium tuberculosis} Length = 157 | Back alignment and structure |
|---|
| >3oun_A Putative uncharacterized protein TB39.8; peptidoglycan, Ser/Thr kinase, pseudokinase, FHA domain, REG phosphorylation; HET: TPO; 2.71A {Mycobacterium tuberculosis} Length = 157 | Back alignment and structure |
|---|
| >3oun_A Putative uncharacterized protein TB39.8; peptidoglycan, Ser/Thr kinase, pseudokinase, FHA domain, REG phosphorylation; HET: TPO; 2.71A {Mycobacterium tuberculosis} Length = 157 | Back alignment and structure |
|---|
| >3oun_A Putative uncharacterized protein TB39.8; peptidoglycan, Ser/Thr kinase, pseudokinase, FHA domain, REG phosphorylation; HET: TPO; 2.71A {Mycobacterium tuberculosis} Length = 157 | Back alignment and structure |
|---|
| >3oun_A Putative uncharacterized protein TB39.8; peptidoglycan, Ser/Thr kinase, pseudokinase, FHA domain, REG phosphorylation; HET: TPO; 2.71A {Mycobacterium tuberculosis} Length = 157 | Back alignment and structure |
|---|
| >3oun_A Putative uncharacterized protein TB39.8; peptidoglycan, Ser/Thr kinase, pseudokinase, FHA domain, REG phosphorylation; HET: TPO; 2.71A {Mycobacterium tuberculosis} Length = 157 | Back alignment and structure |
|---|
| >2yew_A Capsid protein, coat protein; alphavirus, molecular dynamics; 5.00A {Barmah forest virus} Length = 253 | Back alignment and structure |
|---|
| >2yew_A Capsid protein, coat protein; alphavirus, molecular dynamics; 5.00A {Barmah forest virus} Length = 253 | Back alignment and structure |
|---|
| >2yew_A Capsid protein, coat protein; alphavirus, molecular dynamics; 5.00A {Barmah forest virus} Length = 253 | Back alignment and structure |
|---|
| >2yew_A Capsid protein, coat protein; alphavirus, molecular dynamics; 5.00A {Barmah forest virus} Length = 253 | Back alignment and structure |
|---|
| >2yew_A Capsid protein, coat protein; alphavirus, molecular dynamics; 5.00A {Barmah forest virus} Length = 253 | Back alignment and structure |
|---|
| >2yew_A Capsid protein, coat protein; alphavirus, molecular dynamics; 5.00A {Barmah forest virus} Length = 253 | Back alignment and structure |
|---|
| >1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 | Back alignment and structure |
|---|
| >1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 | Back alignment and structure |
|---|
| >1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 | Back alignment and structure |
|---|
| >1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 | Back alignment and structure |
|---|
| >3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 | Back alignment and structure |
|---|
| >3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 | Back alignment and structure |
|---|
| >3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 | Back alignment and structure |
|---|
| >3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 | Back alignment and structure |
|---|
| >3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 | Back alignment and structure |
|---|
| >3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 | Back alignment and structure |
|---|
| >2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 | Back alignment and structure |
|---|
| >2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 | Back alignment and structure |
|---|
| >2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 | Back alignment and structure |
|---|
| >2z73_A Rhodopsin; visual pigment, GQ-type, G-protein coupled receptor, chromophore, glycoprotein, lipoprotein, membrane, palmitate phosphorylation; HET: BOG RET PLM TWT PC1; 2.50A {Todarodes pacificus} PDB: 3aym_A* 3ayn_A* 2ziy_A* Length = 448 | Back alignment and structure |
|---|
| >2vg3_A Undecaprenyl pyrophosphate synthetase; transferase, cell WALL biogenesis/degradation, cell cycle, P transferase; HET: GPP; 1.8A {Mycobacterium tuberculosis} PDB: 2vg2_A* 2vg4_A Length = 284 | Back alignment and structure |
|---|
| >2vg3_A Undecaprenyl pyrophosphate synthetase; transferase, cell WALL biogenesis/degradation, cell cycle, P transferase; HET: GPP; 1.8A {Mycobacterium tuberculosis} PDB: 2vg2_A* 2vg4_A Length = 284 | Back alignment and structure |
|---|
| >3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 | Back alignment and structure |
|---|
| >3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 | Back alignment and structure |
|---|
| >3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 | Back alignment and structure |
|---|
| >3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 | Back alignment and structure |
|---|
| >3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 | Back alignment and structure |
|---|
| >3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 | Back alignment and structure |
|---|
| >3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 | Back alignment and structure |
|---|
| >3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703 | Back alignment and structure |
|---|
| >1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 213 | Back alignment and structure |
|---|
| >1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 213 | Back alignment and structure |
|---|
| >1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 213 | Back alignment and structure |
|---|
| >1kxf_A Sindbis virus capsid protein; chymotrypsin-like serine proteinase, wild type, viral protein; 2.38A {Sindbis virus} SCOP: b.47.1.3 PDB: 1ld4_A 3j0f_A Length = 264 | Back alignment and structure |
|---|
| >1kxf_A Sindbis virus capsid protein; chymotrypsin-like serine proteinase, wild type, viral protein; 2.38A {Sindbis virus} SCOP: b.47.1.3 PDB: 1ld4_A 3j0f_A Length = 264 | Back alignment and structure |
|---|
| >1kxf_A Sindbis virus capsid protein; chymotrypsin-like serine proteinase, wild type, viral protein; 2.38A {Sindbis virus} SCOP: b.47.1.3 PDB: 1ld4_A 3j0f_A Length = 264 | Back alignment and structure |
|---|
| >1kxf_A Sindbis virus capsid protein; chymotrypsin-like serine proteinase, wild type, viral protein; 2.38A {Sindbis virus} SCOP: b.47.1.3 PDB: 1ld4_A 3j0f_A Length = 264 | Back alignment and structure |
|---|
| >3a58_A Exocyst complex component SEC3; protein complex, PH domain, GTPase, membrane traffic, coiled coil, exocytosis, phosphoprotein; HET: GNP; 2.60A {Saccharomyces cerevisiae} Length = 320 | Back alignment and structure |
|---|
| >3a58_A Exocyst complex component SEC3; protein complex, PH domain, GTPase, membrane traffic, coiled coil, exocytosis, phosphoprotein; HET: GNP; 2.60A {Saccharomyces cerevisiae} Length = 320 | Back alignment and structure |
|---|
| >3a58_A Exocyst complex component SEC3; protein complex, PH domain, GTPase, membrane traffic, coiled coil, exocytosis, phosphoprotein; HET: GNP; 2.60A {Saccharomyces cerevisiae} Length = 320 | Back alignment and structure |
|---|
| >3a58_A Exocyst complex component SEC3; protein complex, PH domain, GTPase, membrane traffic, coiled coil, exocytosis, phosphoprotein; HET: GNP; 2.60A {Saccharomyces cerevisiae} Length = 320 | Back alignment and structure |
|---|
| >3a58_A Exocyst complex component SEC3; protein complex, PH domain, GTPase, membrane traffic, coiled coil, exocytosis, phosphoprotein; HET: GNP; 2.60A {Saccharomyces cerevisiae} Length = 320 | Back alignment and structure |
|---|
| >3a58_A Exocyst complex component SEC3; protein complex, PH domain, GTPase, membrane traffic, coiled coil, exocytosis, phosphoprotein; HET: GNP; 2.60A {Saccharomyces cerevisiae} Length = 320 | Back alignment and structure |
|---|
| >3a58_A Exocyst complex component SEC3; protein complex, PH domain, GTPase, membrane traffic, coiled coil, exocytosis, phosphoprotein; HET: GNP; 2.60A {Saccharomyces cerevisiae} Length = 320 | Back alignment and structure |
|---|
| >1eys_C Photosynthetic reaction center; membrane protein complex, electron transport; HET: BGL BCL BPH MQ8 HEM CRT LDA PEF; 2.20A {Thermochromatium tepidum} SCOP: a.138.1.2 Length = 382 | Back alignment and structure |
|---|
| >1eys_C Photosynthetic reaction center; membrane protein complex, electron transport; HET: BGL BCL BPH MQ8 HEM CRT LDA PEF; 2.20A {Thermochromatium tepidum} SCOP: a.138.1.2 Length = 382 | Back alignment and structure |
|---|
| >1eys_C Photosynthetic reaction center; membrane protein complex, electron transport; HET: BGL BCL BPH MQ8 HEM CRT LDA PEF; 2.20A {Thermochromatium tepidum} SCOP: a.138.1.2 Length = 382 | Back alignment and structure |
|---|
| >1eys_C Photosynthetic reaction center; membrane protein complex, electron transport; HET: BGL BCL BPH MQ8 HEM CRT LDA PEF; 2.20A {Thermochromatium tepidum} SCOP: a.138.1.2 Length = 382 | Back alignment and structure |
|---|
| >2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 | Back alignment and structure |
|---|
| >2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 | Back alignment and structure |
|---|
| >2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >1y0f_A Collagen I alpha 1; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_A 3hqv_A 3hr2_A Length = 1054 | Back alignment and structure |
|---|
| >3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 | Back alignment and structure |
|---|
| >3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 | Back alignment and structure |
|---|
| >3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497 | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497 | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497 | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497 | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497 | Back alignment and structure |
|---|
| >2kpy_A Major pollen allergen ART V 1; defensin-like, poly-proline; NMR {Artemisia vulgaris} Length = 108 | Back alignment and structure |
|---|
| >2kpy_A Major pollen allergen ART V 1; defensin-like, poly-proline; NMR {Artemisia vulgaris} Length = 108 | Back alignment and structure |
|---|
| >2kpy_A Major pollen allergen ART V 1; defensin-like, poly-proline; NMR {Artemisia vulgaris} Length = 108 | Back alignment and structure |
|---|
| >2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 | Back alignment and structure |
|---|
| >2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 | Back alignment and structure |
|---|
| >2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 | Back alignment and structure |
|---|
| >2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 | Back alignment and structure |
|---|
| >2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 | Back alignment and structure |
|---|
| >2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 | Back alignment and structure |
|---|
| >2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 | Back alignment and structure |
|---|
| >2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 | Back alignment and structure |
|---|
| >2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 | Back alignment and structure |
|---|
| >2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 | Back alignment and structure |
|---|
| >2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 | Back alignment and structure |
|---|
| >2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 | Back alignment and structure |
|---|
| >2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 | Back alignment and structure |
|---|
| >2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 | Back alignment and structure |
|---|
| >2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 | Back alignment and structure |
|---|
| >2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 | Back alignment and structure |
|---|
| >2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 | Back alignment and structure |
|---|
| >2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 | Back alignment and structure |
|---|
| >2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 | Back alignment and structure |
|---|
| >2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 | Back alignment and structure |
|---|
| >2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 | Back alignment and structure |
|---|
| >3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Length = 371 | Back alignment and structure |
|---|
| >3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Length = 371 | Back alignment and structure |
|---|
| >3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Length = 371 | Back alignment and structure |
|---|
| >3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Length = 371 | Back alignment and structure |
|---|
| >3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Length = 371 | Back alignment and structure |
|---|
| >3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Length = 371 | Back alignment and structure |
|---|
| >3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Length = 428 | Back alignment and structure |
|---|
| >3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Length = 428 | Back alignment and structure |
|---|
| >3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Length = 428 | Back alignment and structure |
|---|
| >3oti_A CALG3; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD C0T; 1.60A {Micromonospora echinospora} PDB: 3d0q_A* 3d0r_A* Length = 398 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >1y0f_B Collagen I alpha 2; native, in SITU, triple-helix, supermolecular, packing structure; 5.16A {Rattus norvegicus} SCOP: i.25.1.1 PDB: 1ygv_B 3hqv_B 3hr2_B Length = 1026 | Back alignment and structure |
|---|
| >2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Length = 388 | Back alignment and structure |
|---|
| >2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Length = 388 | Back alignment and structure |
|---|
| >2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Length = 388 | Back alignment and structure |
|---|
| >2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Length = 388 | Back alignment and structure |
|---|
| >1jer_A Cucumber stellacyanin; electron transport, copper, glycoprotein, hydroxylation; 1.60A {Cucumis sativus} SCOP: b.6.1.1 Length = 138 | Back alignment and structure |
|---|
| >1x9d_A Endoplasmic reticulum mannosyl-oligosaccharide 1, 2-alpha-mannosidase; substrate analogue, glycosyl hydrolase; HET: SMD; 1.41A {Homo sapiens} SCOP: a.102.2.1 PDB: 1fo3_A* 1fo2_A* 1fmi_A Length = 538 | Back alignment and structure |
|---|
| >1x9d_A Endoplasmic reticulum mannosyl-oligosaccharide 1, 2-alpha-mannosidase; substrate analogue, glycosyl hydrolase; HET: SMD; 1.41A {Homo sapiens} SCOP: a.102.2.1 PDB: 1fo3_A* 1fo2_A* 1fmi_A Length = 538 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >2yjn_A ERYCIII, glycosyltransferase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Length = 441 | Back alignment and structure |
|---|
| >1pcx_A Protein transport protein SEC24; 2.50A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 PDB: 1pd0_A 1pd1_A Length = 810 | Back alignment and structure |
|---|
| >4f6o_A Metacaspase-1; rossmann fold, hydrolase; HET: DFH; 1.68A {Saccharomyces cerevisiae} Length = 350 | Back alignment and structure |
|---|
| >3tsa_A SPNG, NDP-rhamnosyltransferase; glycosyltransferase; HET: GLC; 1.70A {Saccharopolyspora spinosa} PDB: 3uyk_A* 3uyl_A* Length = 391 | Back alignment and structure |
|---|
| >1g9l_A Polyadenylate-binding protein 1; all-helical domain, RNA binding protein; NMR {Homo sapiens} SCOP: a.144.1.1 PDB: 1jgn_A 1jh4_A Length = 144 | Back alignment and structure |
|---|
| >1g9l_A Polyadenylate-binding protein 1; all-helical domain, RNA binding protein; NMR {Homo sapiens} SCOP: a.144.1.1 PDB: 1jgn_A 1jh4_A Length = 144 | Back alignment and structure |
|---|
| >3ttv_A Catalase HPII; heme orientation, oxidoreductase; HET: HEM; 1.45A {Escherichia coli} PDB: 3ttt_A* 1gge_A* 1iph_A* 4ens_A* 3ttu_A* 3p9p_A* 4enq_A* 1p81_A* 3ttx_A* 4enw_A* 3ttw_A* 4ent_A* 1qws_A* 1cf9_A* 1p80_A* 1qf7_A* 4enu_A* 4enp_A* 1gg9_A* 1ggf_A* ... Length = 753 | Back alignment and structure |
|---|
| >3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 | Back alignment and structure |
|---|
| >4af8_A Metacaspase MCA2; hydrolase, cysteine peptidase, caspase/hemoglobin fold; 1.40A {Trypanosoma brucei} PDB: 4afp_A 4afv_A 4afr_A Length = 367 | Back alignment and structure |
|---|
| >4af8_A Metacaspase MCA2; hydrolase, cysteine peptidase, caspase/hemoglobin fold; 1.40A {Trypanosoma brucei} PDB: 4afp_A 4afv_A 4afr_A Length = 367 | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 | Back alignment and structure |
|---|
| >1t9b_A Acetolactate synthase, mitochondrial; acetohydroxyacid synthase, herbicide, sulfonylurea, thiamin diphosphate, FAD, inhibitor; HET: 1CS P25 FAD NSP P22 YF3; 2.20A {Saccharomyces cerevisiae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1n0h_A* 1t9a_A* 1t9c_A* 1t9d_A* 1jsc_A* Length = 677 | Back alignment and structure |
|---|
| >3aqq_A Calcium-regulated heat stable protein 1; compact beta-barrel, cold shock domain, ssDNA binding, DNA B protein; 2.80A {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >3m1c_B GL, envelope glycoprotein L; glycoprotein H, GH/GL, envelope protein, HER simplex virus, disulfide bond, HOST cell MEMB HOST endosome; HET: NAG XYL; 3.00A {Human herpesvirus 2} Length = 204 | Back alignment and structure |
|---|
| >1jvr_A HTLV-II MA, MA, human T-cell leukemia virus type II matrix protein; HTLV-II matrix protein, retroviral matrix protein; NMR {Human t-lymphotropic virus 2} SCOP: a.61.1.2 Length = 137 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 699 | |||
| 2j1d_G | 483 | DAAM1, disheveled-associated activator of morphoge | 100.0 | |
| 3obv_E | 457 | Protein diaphanous homolog 1; autoinhibition, acti | 100.0 | |
| 4eah_A | 402 | Formin-like protein 3, actin, alpha skeletal muscl | 100.0 | |
| 1ux5_A | 411 | BNI1 protein; structural protein, FH2 actin cytosk | 100.0 | |
| 1v9d_A | 340 | Diaphanous protein homolog 1; helix bundle, protei | 100.0 | |
| 1cee_B | 59 | Wiskott-aldrich syndrome protein WAsp; CDC42 actin | 97.17 | |
| 2qme_I | 36 | CRIB domain of the serine/threonine-protein kinas; | 93.07 | |
| 2lnh_A | 65 | N-WAsp, neural wiskott-aldrich syndrome protein; p | 92.46 | |
| 2odb_B | 35 | Serine/threonine-protein kinase PAK 6; small GTPas | 90.88 | |
| 1ej5_A | 107 | WAsp, wiskott-aldrich syndrome protein; alpha heli | 89.93 | |
| 1f3m_A | 80 | Serine/threonine-protein kinase PAK-alpha; kinase | 89.92 | |
| 2ov2_I | 35 | Serine/threonine-protein kinase PAK 4; GTPase RAC3 | 89.61 |
| >2j1d_G DAAM1, disheveled-associated activator of morphogenesis; actin assembly, protein binding; 2.55A {Homo sapiens} PDB: 2z6e_A | Back alignment and structure |
|---|
Probab=100.00 E-value=7.6e-71 Score=619.58 Aligned_cols=375 Identities=26% Similarity=0.386 Sum_probs=331.4
Q ss_pred CCCCCCCCCCCcccccccccCCCCcccccccccCcc--cccHHHHHHHhcccccccc------ccccC-C------CCCC
Q 005376 234 GDANAPKTKLKPFFWDKVLANPDNSMVWHQIKSGSF--QFNEEMIETLFGYSEKSKN------EKKKG-S------SLDT 298 (699)
Q Consensus 234 ~~~~~Pk~klK~l~W~ki~~~~~~~TiW~~i~~~~~--~~d~~~lE~lF~~~~~~k~------~~kk~-~------~~~~ 298 (699)
+....|+.+||+|||++|..+.+++|||+++++..+ .+|+++||++|+.+..... .+++. . ...+
T Consensus 6 K~~~~P~~klK~l~W~ki~~~~~~~TiW~~~~~~~~~~~ld~~~lE~lF~~~~~~~~~~~~~~~~~k~~~s~~~~~~~~k 85 (483)
T 2j1d_G 6 KSIPQPTNALKSFNWSKLPENKLEGTVWTEIDDTKVFKILDLEDLERTFSAYQRQQDFFVNSNSKQKEADAIDDTLSSKL 85 (483)
T ss_dssp CCCCCCSSCBCCCCCCCCCGGGCSSSGGGGCCGGGHHHHSCHHHHHHHTBSBC---------------------------
T ss_pred CCCCCCCCCCCCcCceECCcccccCCccCcCCchhhccccCHHHHHHHHhhhcccccccccccccccccccccccccccc
Confidence 556679999999999999888899999999988753 5899999999997643221 01111 0 1223
Q ss_pred CCcceeecChHHHhhHHHHHHhcCCCHHHHHHHhhcCC---CCcHHHHHHHHhcCCCHHHHHHHHhhccccccCChHHHH
Q 005376 299 GPQYIQIIDQKKAQNLSIMLRALNVTLEEVCDALLEGN---ELPAELIQTLLKMAPTAEEELKLRLFNGELSQLGPAERF 375 (699)
Q Consensus 299 ~~~~v~iLd~kraqni~I~L~~l~~s~~ei~~al~~~~---~L~~e~l~~Ll~~~Pt~eE~~~l~~~~~d~~~L~~aE~F 375 (699)
+++.|+|||+||+|||+|+|++|++++++|++||+++| .|+.|.|+.|++++||.||+..|+.|.||.+.|+++|||
T Consensus 86 k~~~v~lLD~kRaqNi~I~L~~lk~~~~ei~~aIl~~D~~~~L~~e~l~~Ll~~~Pt~eE~~~l~~~~~d~~~L~~aEqF 165 (483)
T 2j1d_G 86 KVKELSVIDGRRAQNCNILLSRLKLSNDEIKRAILTMDEQEDLPKDMLEQLLKFVPEKSDIDLLEEHKHELDRMAKADRF 165 (483)
T ss_dssp --CCBCCSCHHHHHHHHHHHHHHCCCHHHHHHHHHTTSTTCCCCHHHHHHHHHSCCCHHHHHHHHTTTTCGGGBCHHHHH
T ss_pred CCCcceeCCHHHHHHHHHHHhcCCCCHHHHHHHHHccCccccCCHHHHHHHHHhCCCHHHHHHHHHhccChhhcCHHHHH
Confidence 67789999999999999999999999999999999876 499999999999999999999999999999999999999
Q ss_pred HHHHcCCcChHHHHHHHHHhhhhHHHHHHHHHHHHHHHHHHHHHhhcHHHHHHHHHHHHhcccccCCCCCcceeeeeccc
Q 005376 376 LKALVDIPFSFKRLEALLFMCTLQEEVSATKESFEILEVACKELRNSRLFLKLLEAVLKTGNRMNDGTFRGGAQAFKLDT 455 (699)
Q Consensus 376 l~~l~~Ip~~~~Rl~~l~f~~~f~~~~~~l~~~l~~l~~A~~~l~~S~~~~~lL~~vL~~GN~lN~gt~rg~A~GFkL~s 455 (699)
+++|+.||+|..||+||+|+.+|.+.+.+|.+.|.+|..||++|++|+.|+.||++||++|||||+| .||+|+||+|++
T Consensus 166 l~~l~~ip~~~~Rl~~l~f~~~f~~~~~~l~~~l~~l~~A~~el~~S~~l~~lL~~IL~~GN~mN~g-~rg~A~GFkL~s 244 (483)
T 2j1d_G 166 LFEMSRINHYQQRLQSLYFKKKFAERVAEVKPKVEAIRSGSEEVFRSGALKQLLEVVLAFGNYMNKG-QRGNAYGFKISS 244 (483)
T ss_dssp HHHHHTSTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHSCS-SSCCCSCCCGGG
T ss_pred HHHHhCCccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhchHHHHHHHHHHHHhhhhccC-CCCCceeeehHH
Confidence 9999999999999999999999999999999999999999999999999999999999999999999 799999999999
Q ss_pred cccccccccC-CCCccHHHHHHHHHHhhhhhhHHhhhhcccccccccchhhHhhhcCCccchHHHHhhhhhhhcchhhhH
Q 005376 456 LLKLSDVKGV-DGKTTLLHFVVQEIIRSEGVRAARRARESRSFSSVKTDDLLEETSKSNETDEHYRNLGLQAVSHLSSEL 534 (699)
Q Consensus 456 L~KL~d~Ks~-d~k~tLLh~lv~~i~~~~~~~~~~~~~e~~s~~~~~~~~ll~~~~~~~~~~e~~~~lgl~~v~~l~~eL 534 (699)
|.||.|||++ |+++|||||||+.|.++. ++ +.+|.+||
T Consensus 245 L~KL~d~Ks~~d~k~TLLhylv~~v~~~~-------------------p~----------------------l~~f~~eL 283 (483)
T 2j1d_G 245 LNKIADTKSSIDKNITLLHYLITIVENKY-------------------PS----------------------VLNLNEEL 283 (483)
T ss_dssp GGGGGGSBCSSCTTCBHHHHHHHHHHHHC-------------------GG----------------------GGGHHHHT
T ss_pred HHhhhhcccCCCCCccHHHHHHHHHHHhC-------------------ch----------------------hhchHHHH
Confidence 9999999995 999999999998765421 11 34688999
Q ss_pred HHHHHHhhhcHHHHHHHHHHHHHHHHHHHHHhhhhccc-cCCCcchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcc
Q 005376 535 ENVKKAAAIDADSLTGTVSKLGHALLKTRDFLNTDMKN-LGENSGFHETLKSFVQNAEGDIMWLLEEEKRIMSLVKSTGD 613 (699)
Q Consensus 535 ~~V~kAa~vd~d~L~~~v~~L~~~l~~~~~~l~~~~~~-~~~~~~F~~~m~~Fl~~Ae~~i~~L~e~~~~~~~~~k~l~~ 613 (699)
.+|.+|++||++.|..++.+|.+++..++..++..-.. .+.++.|..+|..|+..|+.++..|...++++.+.|++++.
T Consensus 284 ~~v~~Askv~~~~l~~~~~~L~~~l~~v~~~l~~~~~~~~~~~d~f~~~m~~Fl~~a~~~~~~L~~~~~~~~~~~~~l~~ 363 (483)
T 2j1d_G 284 RDIPQAAKVNMTELDKEISTLRSGLKAVETELEYQKSQPPQPGDKFVSVVSQFITVASFSFSDVEDLLAEAKDLFTKAVK 363 (483)
T ss_dssp TTHHHHHTCCHHHHHHHHHHHHHHHHHHHHHHHHHHTSCCCTTCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred hhHHHHhcCCHHHHHHHHHHHHHHHHHHHHHHHHhhccCCCchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 99999999999999999999999999999888653221 24568899999999999999999999999999999999999
Q ss_pred cccCCCCccchhhhcHHHHHHHHHHHHHHHHHHhhhh
Q 005376 614 YFHGNAGKDEGLRLFTIVRDFFIMLDKACKQVKDAPK 650 (699)
Q Consensus 614 YFged~~k~e~~~fF~iv~dFl~~l~ka~kEv~~~~k 650 (699)
||||+..+..+++||++|.+|+..|++|++|+.++++
T Consensus 364 yFGEd~~~~~~~~fF~~~~~F~~~f~~A~~en~~~~~ 400 (483)
T 2j1d_G 364 HFGEEAGKIQPDEFFGIFDQFLQAVSEAKQENENMRK 400 (483)
T ss_dssp HTTCCTTSCCHHHHHHHHHHHHHHHHHHHHHHHHHHT
T ss_pred HhCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 9999999999999999999999999999999976433
|
| >3obv_E Protein diaphanous homolog 1; autoinhibition, actin, nucleation, cytoskeleton, structural; HET: SUC; 2.75A {Mus musculus} PDB: 3o4x_E 2bap_D | Back alignment and structure |
|---|
| >4eah_A Formin-like protein 3, actin, alpha skeletal muscle; ATP binding, cytoskeleton, FMNL3, protein BIN; HET: ATP; 3.40A {Mus musculus} | Back alignment and structure |
|---|
| >1ux5_A BNI1 protein; structural protein, FH2 actin cytoskeleton; 2.5A {Saccharomyces cerevisiae} SCOP: a.207.1.1 PDB: 1y64_B* 1ux4_A | Back alignment and structure |
|---|
| >1v9d_A Diaphanous protein homolog 1; helix bundle, protein binding; 2.60A {Mus musculus} SCOP: a.207.1.1 | Back alignment and structure |
|---|
| >1cee_B Wiskott-aldrich syndrome protein WAsp; CDC42 actin regulator GTPase and the GTPase binding domain of ITS effector WAsp; HET: GCP; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2qme_I CRIB domain of the serine/threonine-protein kinas; GTPase RAC3, small GTP binding protein, P21 RAC, RAS-related botulinum toxin substrate 3; HET: GCP; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2lnh_A N-WAsp, neural wiskott-aldrich syndrome protein; protein complex, signaling protein-protein binding complex; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2odb_B Serine/threonine-protein kinase PAK 6; small GTPase, CRIB, protein-protein complex, structu genomics, structural genomics consortium, SGC; HET: GCP; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1ej5_A WAsp, wiskott-aldrich syndrome protein; alpha helix, beta-hairpin turn, blood clotting; NMR {Homo sapiens} SCOP: a.68.1.1 PDB: 1t84_A* 2k42_A | Back alignment and structure |
|---|
| >1f3m_A Serine/threonine-protein kinase PAK-alpha; kinase domain, autoinhibitory fragment, homodimer, transferase; 2.30A {Homo sapiens} SCOP: j.66.1.1 PDB: 1e0a_B* 1ees_B | Back alignment and structure |
|---|
| >2ov2_I Serine/threonine-protein kinase PAK 4; GTPase RAC3, small GTP binding protein, P21 RAC, RAS-related botulinum toxin substrate 3, signalling protein; HET: GCP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 699 | ||||
| d1v9da_ | 332 | a.207.1.1 (A:) Diaphanous protein homolog 1, dia1 | 7e-85 | |
| d1ux5a_ | 411 | a.207.1.1 (A:) Bni1 {Baker's yeast (Saccharomyces | 1e-78 | |
| d1jvra_ | 137 | a.61.1.2 (A:) HTLV-II matrix protein {Human T-cell | 5e-05 | |
| d1jvra_ | 137 | a.61.1.2 (A:) HTLV-II matrix protein {Human T-cell | 4e-04 | |
| d1jvra_ | 137 | a.61.1.2 (A:) HTLV-II matrix protein {Human T-cell | 0.002 | |
| d1jvra_ | 137 | a.61.1.2 (A:) HTLV-II matrix protein {Human T-cell | 0.003 | |
| d2gqba1 | 130 | a.282.1.1 (A:1-130) Hypothetical protein RPA2825 { | 0.002 | |
| d2gqba1 | 130 | a.282.1.1 (A:1-130) Hypothetical protein RPA2825 { | 0.002 | |
| d2gqba1 | 130 | a.282.1.1 (A:1-130) Hypothetical protein RPA2825 { | 0.004 |
| >d1v9da_ a.207.1.1 (A:) Diaphanous protein homolog 1, dia1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 332 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Formin homology 2 domain (FH2 domain) superfamily: Formin homology 2 domain (FH2 domain) family: Formin homology 2 domain (FH2 domain) domain: Diaphanous protein homolog 1, dia1 species: Mouse (Mus musculus) [TaxId: 10090]
Score = 268 bits (687), Expect = 7e-85
Identities = 95/361 (26%), Positives = 148/361 (40%), Gaps = 43/361 (11%)
Query: 301 QYIQIIDQKKAQNLSIMLRALNVTLEEVCDALLEGNE--LPAELIQTLLKMAPTAEEELK 358
+ ++++D K AQNLSI L + + +E+ + +LE NE L +IQ L+K P E+
Sbjct: 2 KELKVLDSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKM 61
Query: 359 LRLFNGELSQLGPAERFLKALVDIPFSFKRLEALLFMCTLQEEVSATKESFEILEVACKE 418
L E L +E+F + +P RL A+LF E+V K + AC+E
Sbjct: 62 LSELKEEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEE 121
Query: 419 LRNSRLFLKLLEAVLKTGNRMNDGTFRGGAQAFKLDTLLKLSDVKGVDGKTTLLHFVVQE 478
LR S F LLE L GN MN G+ GA F + L KL D K D K TLLHF+ +
Sbjct: 122 LRKSENFSSLLELTLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSADQKMTLLHFLAEL 181
Query: 479 IIRSEGVRAARRARESRSFSSVKTDDLLEETSKSNETDEHYRNLGLQAVSHLSSELENVK 538
V EL +V+
Sbjct: 182 CENDHP-----------------------------------------EVLKFPDELAHVE 200
Query: 539 KAAAIDADSLTGTVSKLGHALLKTRDFLNTDMKNLGENSGFHETLKSFVQNAEGDIMWLL 598
KA+ + A++L ++ ++ + + E F E + SFV++A+ L
Sbjct: 201 KASRVSAENLQKSLDQMKKQIADVERDVQNFPAATDEKDKFVEKMTSFVKDAQEQYNKLR 260
Query: 599 EEEKRIMSLVKSTGDYFHGNAGKDEGLRLFTIVRDFFIMLDKACKQVKDAPKKSTKSLKK 658
+ +L K GDYF + K F + +F M +A K+ + + K +
Sbjct: 261 MMHSNMETLYKELGDYFVFDPKKLSVEEFFMDLHNFRNMFLQAVKENQKRRETEEKMRRA 320
Query: 659 E 659
+
Sbjct: 321 K 321
|
| >d1ux5a_ a.207.1.1 (A:) Bni1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 411 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 699 | |||
| d1ux5a_ | 411 | Bni1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 100.0 | |
| d1v9da_ | 332 | Diaphanous protein homolog 1, dia1 {Mouse (Mus mus | 100.0 | |
| d1ej5a_ | 107 | Wiscott-Aldrich syndrome protein, WASP, C-terminal | 92.96 |
| >d1ux5a_ a.207.1.1 (A:) Bni1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Formin homology 2 domain (FH2 domain) superfamily: Formin homology 2 domain (FH2 domain) family: Formin homology 2 domain (FH2 domain) domain: Bni1 species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=100.00 E-value=8.4e-63 Score=542.77 Aligned_cols=367 Identities=19% Similarity=0.249 Sum_probs=316.7
Q ss_pred CCCCCCCCcccccccccCCCCcccccccccCcc------cccHHHHHHHhccccccccccccCCCCCCCCcceeecChHH
Q 005376 237 NAPKTKLKPFFWDKVLANPDNSMVWHQIKSGSF------QFNEEMIETLFGYSEKSKNEKKKGSSLDTGPQYIQIIDQKK 310 (699)
Q Consensus 237 ~~Pk~klK~l~W~ki~~~~~~~TiW~~i~~~~~------~~d~~~lE~lF~~~~~~k~~~kk~~~~~~~~~~v~iLd~kr 310 (699)
.+|+.+||+|||++|+ ..++|||+.+.+..+ .+|++.||++|+.+.......++ .+..+.++|||.||
T Consensus 3 PkP~~klK~l~W~ki~--~~~~tiW~~i~~~~~~~~~~~~~~~~~le~~F~~k~~~~~~~~~----~~~~~~~~lLd~kr 76 (411)
T d1ux5a_ 3 PRPHKKLKQLHWEKLD--CTDNSIWGTGKAEKFADDLYEKGVLADLEKAFAAREIKSLASKR----KEDLQKITFLSRDI 76 (411)
T ss_dssp CCCSSCBCCCCCCCCS--SCCSSSCCSSHHHHHHHHHHHTTHHHHHHHHTBSSCCHHHHHHH----HHTTTSBCCSCHHH
T ss_pred CCCCCCCCCCCceeCC--CCCCCcchhcccccchhHHHhhhhHHHHHHHhccCCCCCCcccc----cccccccccCcHHH
Confidence 3588899999999995 357899999876432 46778899999876543322111 12446789999999
Q ss_pred HhhHHHHHHhc-CCCHHHHHHHhhcCCC--CcHHHHHH--------------HHhcCCCHHHHHHHHhhc------cccc
Q 005376 311 AQNLSIMLRAL-NVTLEEVCDALLEGNE--LPAELIQT--------------LLKMAPTAEEELKLRLFN------GELS 367 (699)
Q Consensus 311 aqni~I~L~~l-~~s~~ei~~al~~~~~--L~~e~l~~--------------Ll~~~Pt~eE~~~l~~~~------~d~~ 367 (699)
+|||+|+|++| ++++++|++||.++|. |+.+.+.. |.+++||.+|+..|+.|. ||.+
T Consensus 77 ~qni~I~L~~~~~~s~~~i~~ai~~~d~~~l~~~~l~~ll~~~~~~~~~~~~l~~~lPt~eE~~~l~~~~~~~~~~~d~~ 156 (411)
T d1ux5a_ 77 SQQFGINLHMYSSLSVADLVKKILNCDRDFLQTPSVVEFLSKSEIIEVSVNLARNYAPYSTDWEGVRNLEDAKPPEKDPN 156 (411)
T ss_dssp HHHHHHHTGGGTTSCHHHHHHHHHTTTHHHHTCHHHHHHTTCHHHHCCCHHHHHHTGGGCCCCTTCCCGGGCCCCSSCST
T ss_pred HHHHHHHHHHccCCCHHHHHHHHHhcChhhcCHHHHHHHHhhcchhhhHHHHHHHhCCCcHHHHHHHHHHhhccccCChh
Confidence 99999999999 7999999999999873 66666644 558999999999998885 7889
Q ss_pred cCChHHHHHHHHc--CCcChHHHHHHHHHhhhhHHHHHHHHHHHHHHHHHHHHHhhcHHHHHHHHHHHHhcccccCCCCC
Q 005376 368 QLGPAERFLKALV--DIPFSFKRLEALLFMCTLQEEVSATKESFEILEVACKELRNSRLFLKLLEAVLKTGNRMNDGTFR 445 (699)
Q Consensus 368 ~L~~aE~Fl~~l~--~Ip~~~~Rl~~l~f~~~f~~~~~~l~~~l~~l~~A~~~l~~S~~~~~lL~~vL~~GN~lN~gt~r 445 (699)
.|+.+|||+++|+ .|+++..||+||+|+.+|.+.+.++.+.+..+..||++|++|+.|+.||++||++|||||+|+
T Consensus 157 ~L~~~Eqf~~~l~~~~i~~~~~Rl~~~~f~~~f~~~~~~l~~~l~~l~~a~~~l~~S~~l~~lL~~iL~~GN~lN~g~-- 234 (411)
T d1ux5a_ 157 DLQRADQIYLQLMVNLESYWGSRMRALTVVTSYEREYNELLAKLRKVDKAVSALQESDNLRNVFNVILAVGNFMNDTS-- 234 (411)
T ss_dssp TBCHHHHHHHHTTTTTTTTHHHHHHHHHHHTTHHHHHHHHHHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHHHHSCGG--
T ss_pred hcCHHHHHHHHHHhccchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhChHHHHHHHHHHHHhhhhcCCC--
Confidence 9999999999987 499999999999999999999999999999999999999999999999999999999999985
Q ss_pred cceeeeeccccccccccccCCCCccHHHHHHHHHHhhhhhhHHhhhhcccccccccchhhHhhhcCCccchHHHHhhhhh
Q 005376 446 GGAQAFKLDTLLKLSDVKGVDGKTTLLHFVVQEIIRSEGVRAARRARESRSFSSVKTDDLLEETSKSNETDEHYRNLGLQ 525 (699)
Q Consensus 446 g~A~GFkL~sL~KL~d~Ks~d~k~tLLh~lv~~i~~~~~~~~~~~~~e~~s~~~~~~~~ll~~~~~~~~~~e~~~~lgl~ 525 (699)
|+|+||+|++|.||.|+|++|+++|||||||+.+.+.. .+
T Consensus 235 ~~A~GFkL~sL~kL~d~Ks~d~~~tLL~yiv~~~~~~~-------------------p~--------------------- 274 (411)
T d1ux5a_ 235 KQAQGFKLSTLQRLTFIKDTTNSMTFLNYVEKIVRLNY-------------------PS--------------------- 274 (411)
T ss_dssp GCCSCCCGGGGGGSSSCBCTTSCSBHHHHHHHHHHHHC-------------------GG---------------------
T ss_pred CCcceeehHHHHHhhhccCCCCCeeHHHHHHHHHHHhC-------------------cH---------------------
Confidence 57999999999999999999999999999998765421 11
Q ss_pred hhcchhhhHHHHHHHhhhcHHHHHHHHHHHHHHHHHHHHHhhhhc----cccCCCcchhhHHHHHHHHHHHHHHHHHHHH
Q 005376 526 AVSHLSSELENVKKAAAIDADSLTGTVSKLGHALLKTRDFLNTDM----KNLGENSGFHETLKSFVQNAEGDIMWLLEEE 601 (699)
Q Consensus 526 ~v~~l~~eL~~V~kAa~vd~d~L~~~v~~L~~~l~~~~~~l~~~~----~~~~~~~~F~~~m~~Fl~~Ae~~i~~L~e~~ 601 (699)
+..|.+||..|.+|++++++.|..++.+|.+++.+++..++... .....+++|..+|..|++.|+.++..|...+
T Consensus 275 -l~~~~~el~~v~~a~~~~~~~l~~~~~~L~~~l~~i~~~~~~~~~~~~~~~~~~d~f~~~~~~fl~~~~~~~~~l~~~~ 353 (411)
T d1ux5a_ 275 -FNDFLSELEPVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTLPVLPEARKKGDLLEDEV 353 (411)
T ss_dssp -GGGHHHHTHHHHHHTTCCHHHHHHHHHHHHHHHHHHHHHHHHSTTTCTTSSCTTCCHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred -hhccHHHHHHHHHHhcCCHHHHHHHHHHHHHHHHHHHHHHHhhcccccccccchhhHHHHHHHHHHHHHHHHHHHHHHH
Confidence 23577899999999999999999999999999999998875422 1234568899999999999999999999999
Q ss_pred HHHHHHHHhhcccccCCCCc-cchhhhcHHHHHHHHHHHHHHHHHHhhhhhh
Q 005376 602 KRIMSLVKSTGDYFHGNAGK-DEGLRLFTIVRDFFIMLDKACKQVKDAPKKS 652 (699)
Q Consensus 602 ~~~~~~~k~l~~YFged~~k-~e~~~fF~iv~dFl~~l~ka~kEv~~~~kr~ 652 (699)
+++.+.|++++.||||+... ..+++||++|.+|+..|++|++|+.+.++++
T Consensus 354 ~~~~~~~~~~~~yfGEd~~~~~~~~~fF~~~~~F~~~~~~a~~en~~~~e~e 405 (411)
T d1ux5a_ 354 KLTIMEFESLMHTYGEDSGDKFAKISFFKKFADFINEYKKAQAQNLAAEEEE 405 (411)
T ss_dssp HHHHHHHHHHHHHTTCCSSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHhCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 99999999999999998864 5788999999999999999999987655443
|
| >d1v9da_ a.207.1.1 (A:) Diaphanous protein homolog 1, dia1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ej5a_ a.68.1.1 (A:) Wiscott-Aldrich syndrome protein, WASP, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|