Citrus Sinensis ID: 005412


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------
MQGQGSTIDSFPESVNIDQDSVSSNTSMSQQISVDSILQPVESRLSNYTVASGGATCVNAVTHDVRNLSTWNSGEPSCRLSLQNQKNDDEMKMEHGWSASCSARTGGGPVSEERQRESTSILFPGRHGIGHSGNQDRSGPSFSLGSSSSHSPQNLDLDAGYVDNSGFGGQSMEVGLGPNLRNSGGLETEQAYLASASSDKVGTSSGSSGFMLEENNGEAGSPLGGWGLSCKRKALEGTSAPSCSAGSSSRFPQAESGVSARYEASSSLSLSPPLQNYPSVCPPEQSNPRFGVAMRIVEDGFPSGISGNTENRLRSFGRRGDPRHQQESVPYNLSSIGGSGHSNIAPPHPPPISLPFSDALELRAAAAVAANTNASQNQAHSAPVSSFSRNAHPFRWDGASSSRAGNLSSSFISGERGATLREERNTRSIQRNNAEHPMLVPSAEMRNMVQDPTSWSLATGSSSGGVSSTARIGSSSSTHPSPASAWVPHHNISIHSPSSSSQEPVMPSSSNSQIHHQTQRRSSFLMERQGDNVLGLPRSLQVLAADIEGRHRLISEIRQVLNAMRRGENLRVEDYMLFEPFIYHGLAEMHDRHRDMRLDVDNMSYEELLALEERIGDVSTGLNEETIMKIMKQKRYPSLEIEIPSDEEPCCICQEEYTDGDNLGILDCGHDFHTNCIKQWLMQKNLCPICKTTGLPT
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccHHHccHHHHHHHccccccccccccccccccccHHHHHHHHHHHccccccccHHHHHHHHHHccccccccccccccccccccccccccccEEEEEccccccHHHHHHHHHHccccccccccccccc
cccccccccccccHcccccccccccccccccccHHcccccHHcccccccccccccccccccccccccccccccccccccccHHccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccHHHHHHHHHHHHccccccHHHHEEcccHHHcccccccccccccccccccccHHHHHHHHHHcccccccccHHHHHHHHcccEccccccccccccccEEEEEHHccccccEEEEcccccHHHHHHHHHHHHHccccccccccccc
mqgqgstidsfpesvnidqdsvssntsmsqqisvdsilqpvesrlsnytvasggatCVNAVthdvrnlstwnsgepscrlslqnqknddemkmehgwsascsartgggpvseerqrestsilfpgrhgighsgnqdrsgpsfslgsssshspqnldldagyvdnsgfggqsmevglgpnlrnsggletEQAYLASassdkvgtssgssgfmleenngeagsplggwglsckrkalegtsapscsagsssrfpqaesgvsaryeassslslspplqnypsvcppeqsnprfgVAMRIVedgfpsgisgntenrlrsfgrrgdprhqqesvpynlssiggsghsniapphpppislpfsDALELRAAAAVAANtnasqnqahsapvssfsrnahpfrwdgasssragnlsssfisgergatlrEERNTRsiqrnnaehpmlvpsaemrnmvqdptswslatgsssggvsstarigssssthpspasawvphhnisihspssssqepvmpsssnsqihhqTQRRSSFLmerqgdnvlglprSLQVLAADIEGRHRLISEIRQVLNAMRrgenlrvedymlfepfiyhglaemhdrhrdmrldvdnmSYEELLALEERIgdvstglnEETIMKIMkqkrypsleieipsdeepccicqeeytdgdnlgildcghdfhtNCIKQWLmqknlcpickttglpt
mqgqgstidsfpesvnIDQDSVSSNTSMSQQISVDSILQPVESRLSNYTVASGGATCVNAVTHDVRnlstwnsgepscRLSLQNQKNDDEMKMEHGWSASCSARTGGGPVSEERQRESTSILFPGRHGIGHSGNQDRSGPSFSLGSSSSHSPQNLDLDAGYVDNSGFGGQSMEVGLGPNLRNSGGLETEQAYLASASSDKVGTSSGSSGFMLEENNGEAGSPLGGWGLSCKRKALEGTsapscsagsssrfpqAESGVSARYEASSSLSLSPPLQNYPSVCPPEQSNPRFGVAMRIVEDGfpsgisgntenRLRSFgrrgdprhqqeSVPYNLSSIGGSGHSNIAPPHPPPISLPFSDALELRAAAAVAANTNASQNQAHSAPVSSFSRNAHPFRWDGasssragnlsssfisgergatlreerntrsiqrnnaehpmlvpSAEMRNMVQDPTSWSLATGSSSGGVSSTARIGSSSSTHPSPASAWVPHHNISIHSPSSSSQEPVMPSSSNSQIHHQTQRRSSFLMERQGDNVLGLPRSLQVLAADIEGRHRLISEIRQVLNAMRRGENLRVEDYMLFEPFIYHGLAEMHDRHRDMRLDVDNMSYEELLALEerigdvstglNEETIMKIMKQKRYPSLEIEIPSDEEPCCICQEEYTDGDNLGILDCGHDFHTNCIKQWLMQKNLCPICKTTGLPT
MQGQGSTIDSFPESVNIDQDSVSSNTSMSQQISVDSILQPVESRLSNYTVASGGATCVNAVTHDVRNLSTWNSGEPSCRLSLQNQKNDDEMKMEHGWSASCSARTGGGPVSEERQRESTSILFPGRHGIGHSGNQDRsgpsfslgsssshspQNLDLDAGYVDNSGFGGQSMEVGLGPNLRNSGGLETEQAYLAsassdkvgtssgssgFMLEENNGEAGSPLGGWGLSCKRKALEGTsapscsagsssRFPQAESGVSARYEAssslslspplQNYPSVCPPEQSNPRFGVAMRIVEDGFPSGISGNTENRLRSFGRRGDPRHQQESVPYNLSSIGGSGHSNIApphpppISLPFSDALELRaaaavaantnasqnqahsaPVSSFSRNAHPFRWDgasssragnlsssFISGERGATLREERNTRSIQRNNAEHPMLVPSAEMRNMVQDPTSWSLATgsssggvsstarigssssthpspasaWVPHHNIsihspssssqepvmpsssnsQIHHQTQRRSSFLMERQGDNVLGLPRSLQVLAADIEGRHRLISEIRQVLNAMRRGENLRVEDYMLFEPFIYHGLAEMHDRHRDMRLDVDNMSYEELLALEERIGDVSTGLNEETIMKIMKQKRYPSLEIEIPSDEEPCCICQEEYTDGDNLGILDCGHDFHTNCIKQWLMQKNLCPICKTTGLPT
*******************************************RLSNYTVASGGATCVNAVTHDVRNLSTW*****************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************VLGLPRSLQVLAADIEGRHRLISEIRQVLNAMRRGENLRVEDYMLFEPFIYHGLAEMHDRHRDMRLDVDNMSYEELLALEERIGDVSTGLNEETIMKIMKQKRYPSLEIEIPSDEEPCCICQEEYTDGDNLGILDCGHDFHTNCIKQWLMQKNLCPICKT*****
***********PESV*******************DSILQPVESR****************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************LFEPFIYHGLAEMHDRHRDMRLDVDNMSYEELLALEERIGDVSTGLNEETIMKIMKQKR**********DEEPCCICQEEYTDGDNLGILDCGHDFHTNCIKQWLMQKNLCPICKTTGLP*
MQGQGSTIDSFPESVNID***************VDSILQPVESRLSNYTVASGGATCVNAVTHDVRNLSTWNSGEPSCRLSLQNQKNDDEMKMEHGWSAS******************TSILFPGRHGIG*********************PQNLDLDAGYVDNSGFGGQSMEVGLGPNLRNSGGLETEQAYLA************SSGFMLEENNGEAGSPLGGWGLSCKRKAL**********************************LSPPLQNYPSVCPPEQSNPRFGVAMRIVEDGFPSGISGNTENRLRSFGRRGDPRHQQESVPYNLSSIGGSGHSNIAPPHPPPISLPFSDALELRAAAAVA****************SFSRNAHPFRWDGASSSRAGNLSSSFISGERGATLREERNTRSIQRNNAEHPMLVPSAEMRNMVQDPTSWS****************************AWVPHHNISI****************************SFLMERQGDNVLGLPRSLQVLAADIEGRHRLISEIRQVLNAMRRGENLRVEDYMLFEPFIYHGLAEMHDRHRDMRLDVDNMSYEELLALEERIGDVSTGLNEETIMKIMKQKRYPSLEIEIPSDEEPCCICQEEYTDGDNLGILDCGHDFHTNCIKQWLMQKNLCPICKTTGLPT
**************************SMSQQISVDSILQPVESRLSNYTVASGGATCVNAVTHDVRNLSTWNSGEPS********KNDDEMKMEHGWSASCSARTGGGPVSEERQRESTSILFPGRHGIGHSGNQDRSGPSFSLGSSSSHSPQNLDLDAGYVD**********V*L****************************************************************************************************YPSVCPPE*SN*****************************************VP*************************FSDALELRAAAAV*******************************************************************HPM****************************************HPSPASAWV********************************************NVLGLPRSLQVLAADIEGRHRLISEIRQVLNAMRRGENLRVEDYMLFEPFIYHGLAEMHDRHRDMRLDVDNMSYEELLALEERIGDVSTGLNEETIMKIMKQKRYPSL*I**PSDEEPCCICQEEYTDGDNLGILDCGHDFHTNCIKQWLMQKNLCPICKT*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQGQGSTIDSFPESVNIDQDSVSSNTSMSQQISVDSILQPVESRLSNYTVASGGATCVNAVTHDVRNLSTWNSGEPSCRLSLQNQKNDDEMKMEHGWSASCSARTGGGPVSEERQRESTSILFPGRHGIGHSGNQDRSGPSFSLGSSSSHSPQNLDLDAGYVDNSGFGGQSMEVGLGPNLRNSGGLETEQAYLASASSDKVGTSSGSSGFMLEENNGEAGSPLGGWGLSCKRKALEGTSAPSCSAGSSSRFPQAESGVSARYEASSSLSLSPPLQNYPSVCPPEQSNPRFGVAMRIVEDGFPSGISGNTENRLRSFGRRGDPRHQQESVPYNLSSIGGSGHSNIAPPHPPPISLPFSDALELRAAAAVAANTNASQNQAHSAPVSSFSRNAHPFRWDGASSSRAGNLSSSFISGERGATLREERNTRSIQRNNAEHPMLVPSAEMRNMVQDPTSWSLATGSSSGGVSSTARIGSSSSTHPSPASAWVPHHNISIHSPSSSSQEPVMPSSSNSQIHHQTQRRSSFLMERQGDNVLGLPRSLQVLAADIEGRHRLISEIRQVLNAMRRGENLRVEDYMLFEPFIYHGLAEMHDRHRDMRLDVDNMSYEELLALEERIGDVSTGLNEETIMKIMKQKRYPSLEIEIPSDEEPCCICQEEYTDGDNLGILDCGHDFHTNCIKQWLMQKNLCPICKTTGLPT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query697 2.2.26 [Sep-21-2011]
Q9LT17340 E3 ubiquitin ligase BIG B no no 0.131 0.270 0.393 6e-13
Q6ZSG1346 RING finger protein 165 O yes no 0.127 0.257 0.363 3e-11
E9QAU8347 RING finger protein 165 O yes no 0.127 0.256 0.363 3e-11
Q8L649248 E3 ubiquitin ligase BIG B no no 0.134 0.379 0.364 3e-10
Q7L0R7432 RING finger protein 44 OS no no 0.133 0.215 0.34 4e-10
Q5R476986 E3 ubiquitin-protein liga yes no 0.126 0.089 0.329 7e-10
Q0V9R0954 E3 ubiquitin-protein liga yes no 0.133 0.097 0.309 8e-10
Q6NRV8959 E3 ubiquitin-protein liga N/A no 0.133 0.096 0.309 8e-10
Q90ZT7923 E3 ubiquitin-protein liga N/A no 0.133 0.100 0.309 8e-10
Q66J97967 E3 ubiquitin-protein liga N/A no 0.133 0.096 0.309 8e-10
>sp|Q9LT17|BBR_ARATH E3 ubiquitin ligase BIG BROTHER-related OS=Arabidopsis thaliana GN=BBR PE=2 SV=1 Back     alignment and function desciption
 Score = 76.6 bits (187), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 57/94 (60%), Gaps = 2/94 (2%)

Query: 597 RLDVDNMSYEELLALEERIGDVSTGLNEETIMKIMKQKRYPSLEIEIPSDEEPCCICQEE 656
            +D D +SYEELLAL + +G  S GL+ +TI   +  KRY   + +  ++E  C IC+ +
Sbjct: 237 EMDPDELSYEELLALGDIVGTESRGLSADTIAS-LPSKRYKEGDNQNGTNE-SCVICRLD 294

Query: 657 YTDGDNLGILDCGHDFHTNCIKQWLMQKNLCPIC 690
           Y D ++L +L C H +H+ CI  WL    +CP+C
Sbjct: 295 YEDDEDLILLPCKHSYHSECINNWLKINKVCPVC 328




E3 ubiquitin-ligase probably involved in organ size regulation.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q6ZSG1|RN165_HUMAN RING finger protein 165 OS=Homo sapiens GN=RNF165 PE=1 SV=1 Back     alignment and function description
>sp|E9QAU8|RN165_MOUSE RING finger protein 165 OS=Mus musculus GN=Rnf165 PE=2 SV=1 Back     alignment and function description
>sp|Q8L649|BB_ARATH E3 ubiquitin ligase BIG BROTHER OS=Arabidopsis thaliana GN=BB PE=1 SV=1 Back     alignment and function description
>sp|Q7L0R7|RNF44_HUMAN RING finger protein 44 OS=Homo sapiens GN=RNF44 PE=2 SV=1 Back     alignment and function description
>sp|Q5R476|RN111_PONAB E3 ubiquitin-protein ligase Arkadia OS=Pongo abelii GN=RNF111 PE=2 SV=1 Back     alignment and function description
>sp|Q0V9R0|RN111_XENTR E3 ubiquitin-protein ligase arkadia OS=Xenopus tropicalis GN=rnf111 PE=2 SV=1 Back     alignment and function description
>sp|Q6NRV8|R111B_XENLA E3 ubiquitin-protein ligase arkadia-B OS=Xenopus laevis GN=rnf111-b PE=2 SV=1 Back     alignment and function description
>sp|Q90ZT7|R111A_XENLA E3 ubiquitin-protein ligase arkadia-A (Fragment) OS=Xenopus laevis GN=rnf111-a PE=2 SV=1 Back     alignment and function description
>sp|Q66J97|R111C_XENLA E3 ubiquitin-protein ligase arkadia-C OS=Xenopus laevis GN=rnf111-c PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query697
225428847734 PREDICTED: uncharacterized protein LOC10 0.978 0.929 0.547 1e-180
255555411734 protein binding protein, putative [Ricin 0.968 0.919 0.531 1e-170
356519717715 PREDICTED: uncharacterized protein LOC10 0.979 0.955 0.466 1e-160
356502509720 PREDICTED: uncharacterized protein LOC10 0.979 0.948 0.452 1e-151
225458665734 PREDICTED: uncharacterized protein LOC10 0.985 0.935 0.460 1e-146
147845456 1022 hypothetical protein VITISV_042276 [Viti 0.985 0.672 0.459 1e-146
147821644553 hypothetical protein VITISV_022802 [Viti 0.723 0.911 0.567 1e-142
357475291669 RING finger protein [Medicago truncatula 0.905 0.943 0.452 1e-139
255538248709 protein binding protein, putative [Ricin 0.952 0.936 0.413 1e-126
357475293557 RING finger protein [Medicago truncatula 0.744 0.931 0.481 1e-123
>gi|225428847|ref|XP_002282377.1| PREDICTED: uncharacterized protein LOC100258840 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  637 bits (1643), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 410/749 (54%), Positives = 505/749 (67%), Gaps = 67/749 (8%)

Query: 1   MQGQGSTIDSFPESVNIDQDSVSSNTSMSQQISVDSILQPVESRLSNYTVASGGA--TCV 58
           MQGQ STI SF E+++  Q SVS+NT M+QQ S +++L PV+SRLSNY + S  A  TCV
Sbjct: 1   MQGQRSTIGSFSETIDFGQGSVSNNTGMNQQTSWNNMLNPVDSRLSNYMLPSNEANFTCV 60

Query: 59  NAVTHDVRNLSTWNSGEPSCRLSLQNQKNDDEMKMEHGWSASCSARTGGGPVSEERQRES 118
           NAV HDV+N + W+ GE S  ++ +NQ  +  ++MEHG S+S +   G  P  E+R+ + 
Sbjct: 61  NAVNHDVQNFNGWHLGESSSSMNPRNQAINAGVRMEHGRSSSGTL-AGADPNLEDRRLDL 119

Query: 119 TSILFPGRHGIGHSGNQDRSGPSFSLGSSSSHSPQNLDLDAGYVDNSGFGGQSMEVGLGP 178
            +      H    SGNQ   GP F  GSSS+  P N++L+A  V NSG GGQ M  GL  
Sbjct: 120 ANSPL---HESATSGNQITRGPLFIRGSSSTRIPLNVNLNAEIVGNSGSGGQEMGAGLC- 175

Query: 179 NLRNSGGLETEQAYLASASSDKVGTSSGSSGFMLEENNGEAGSPLGGWGLSCKRKALEGT 238
               SGGL TEQ    SAS+D +G SSGSSG ++EE+NG +GS LG WGLSCKRKALEGT
Sbjct: 176 ---KSGGLGTEQVSPVSASADNIGASSGSSGSLIEESNGGSGSSLGSWGLSCKRKALEGT 232

Query: 239 SAPSCSAGSSSRFPQAES----GVSARYEASSSLSLSPPLQNYPSVCPPEQSNPRFGVAM 294
           S  S  +GSSS  PQAE      V A   AS+S S+S P  N  SV PP   N + G+ M
Sbjct: 233 SGQSYPSGSSSCSPQAEPSAWLAVPAHSNASNSSSISTPSGNSLSVNPPGLPNQQSGIGM 292

Query: 295 RIV--EDGFPS-GISGNTENRLRSFGRRGDPRHQQESVPYNLSSIGGSGHSNIAPPHPPP 351
           R V   D FPS  ++GN EN  R+FGRR +P HQQE V +NLSS G +  SN++  H   
Sbjct: 293 RGVAPSDVFPSLSVTGNAENSQRNFGRRVNPGHQQEPVAFNLSSAGITRRSNVSSNHQSS 352

Query: 352 ISLPFSDALELRAAAAVAANTN----ASQNQAHSAPVSSFSRNAHPFRWDGASSSRAGNL 407
             L FSD+L+LR +AAVAAN N    A Q+Q+H   +   +RN HPF W GAS+SRAG+ 
Sbjct: 353 RPLTFSDSLDLRPSAAVAANANAPQIAPQSQSHVLHIPGLARNMHPFPWSGASNSRAGSS 412

Query: 408 SSSFISG-ERGATLREERNTRSIQRNNAEHPMLVPSAEMRNMVQDPTSWSLATG--SSSG 464
           S SF    ER A L+EE N RS  RNNAEHPM +P+ E RN+ QDPT WSLATG  S++G
Sbjct: 413 SRSFNFSRERAAVLQEEANLRSNHRNNAEHPMFIPATETRNLAQDPTHWSLATGNISTNG 472

Query: 465 GVSSTARIGSSSSTHPSPASAWVPHHNI------------------SIHS---------- 496
           G  ST+R+G SSS H  P +AW+P HN                   SI S          
Sbjct: 473 GGPSTSRMGLSSSVHSLP-TAWIPVHNPPTSNQQRLSEIAPWTLFPSIESEAGGLSGPFS 531

Query: 497 -----PSSSSQEPVMPSSSNSQIHHQTQRRSSFLMERQGDNVLGLPRSLQVLAADIEGRH 551
                PS++++E V+ + + SQ+H QT  RS+FLMERQG++VLG+P SL+ LAADIEGRH
Sbjct: 532 SLPSGPSANTRETVISAGAISQVHQQTYPRSAFLMERQGNDVLGMPHSLRALAADIEGRH 591

Query: 552 RLISEIRQVLNAMRRGENLRVEDYMLFEPFIYHGLAEMHDRHRDMRLDVDNMSYEELLAL 611
           RLISEIRQVL AMRRGE+LR EDYMLF+PFIYHG++E+ DRHRDMRLDVDNMSYEELL L
Sbjct: 592 RLISEIRQVLTAMRRGESLRAEDYMLFDPFIYHGMSELQDRHRDMRLDVDNMSYEELLDL 651

Query: 612 EERIGDVSTGLNEETIMKIMKQKRY---PSLEIEIPSDEEPCCICQEEYTDGDNLGILDC 668
           EERIGDV+TGL++E I+K MK+++Y   P+ E+      EPCCICQEEY  GD+LGILDC
Sbjct: 652 EERIGDVNTGLSDEKILKCMKRQKYSSNPTPEV------EPCCICQEEYAVGDDLGILDC 705

Query: 669 GHDFHTNCIKQWLMQKNLCPICKTTGLPT 697
           GHDFHTNCIKQWLMQKNLCPICKTTGL T
Sbjct: 706 GHDFHTNCIKQWLMQKNLCPICKTTGLAT 734




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255555411|ref|XP_002518742.1| protein binding protein, putative [Ricinus communis] gi|223542123|gb|EEF43667.1| protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356519717|ref|XP_003528516.1| PREDICTED: uncharacterized protein LOC100809024 [Glycine max] Back     alignment and taxonomy information
>gi|356502509|ref|XP_003520061.1| PREDICTED: uncharacterized protein LOC100820322 [Glycine max] Back     alignment and taxonomy information
>gi|225458665|ref|XP_002282892.1| PREDICTED: uncharacterized protein LOC100267740 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147845456|emb|CAN83345.1| hypothetical protein VITISV_042276 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147821644|emb|CAN68213.1| hypothetical protein VITISV_022802 [Vitis vinifera] Back     alignment and taxonomy information
>gi|357475291|ref|XP_003607931.1| RING finger protein [Medicago truncatula] gi|355508986|gb|AES90128.1| RING finger protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|255538248|ref|XP_002510189.1| protein binding protein, putative [Ricinus communis] gi|223550890|gb|EEF52376.1| protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357475293|ref|XP_003607932.1| RING finger protein [Medicago truncatula] gi|355508987|gb|AES90129.1| RING finger protein [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query697
TAIR|locus:2124271666 MBR2 "MED25 BINDING RING-H2 PR 0.261 0.273 0.693 2.6e-95
TAIR|locus:2028225645 AT1G45180 [Arabidopsis thalian 0.259 0.280 0.569 1e-73
TAIR|locus:2160031691 AT5G42940 [Arabidopsis thalian 0.263 0.266 0.587 2.3e-71
TAIR|locus:2149378520 AT5G24870 [Arabidopsis thalian 0.225 0.301 0.455 5.2e-33
TAIR|locus:2125284497 AT4G31450 [Arabidopsis thalian 0.200 0.281 0.489 4.7e-30
TAIR|locus:2159634525 AT5G10650 [Arabidopsis thalian 0.200 0.266 0.452 2.8e-29
TAIR|locus:2027804367 AT1G73760 [Arabidopsis thalian 0.169 0.321 0.466 3.6e-27
TAIR|locus:2030933368 AT1G17970 [Arabidopsis thalian 0.162 0.307 0.448 1.7e-25
TAIR|locus:2009660494 AT1G53190 [Arabidopsis thalian 0.159 0.224 0.466 1.1e-23
TAIR|locus:2086305486 AT3G15070 [Arabidopsis thalian 0.195 0.279 0.4 6.4e-23
TAIR|locus:2124271 MBR2 "MED25 BINDING RING-H2 PROTEIN 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 670 (240.9 bits), Expect = 2.6e-95, Sum P(3) = 2.6e-95
 Identities = 127/183 (69%), Positives = 146/183 (79%)

Query:   515 HHQTQRRSSFLMERQGDNVLGLPRSLQVLAADIEGRHRLISEIRQVLNAMRRGENLRVED 574
             H   QRRS  L+ERQ D+ L L    + LAAD +GR+RLISEIRQVL+AMRRGENLR ED
Sbjct:   485 HRSRQRRSGLLLERQNDH-LHLRHLGRSLAADNDGRNRLISEIRQVLSAMRRGENLRFED 543

Query:   575 YMLFEPFIYHGLAEMHDRHRDMRLDVDNMSYEELLALEERIGDVSTGLNEETIMKIMKQK 634
             YM+F+P IY G+AEMHDRHRDMRLDVDNMSYEELLAL ERIGDVSTGL+EE I+K+MKQ 
Sbjct:   544 YMVFDPLIYQGMAEMHDRHRDMRLDVDNMSYEELLALGERIGDVSTGLSEEVILKVMKQH 603

Query:   635 RYPSLEIEIPSDEEPCCICQEEYTDGDNLGILDCGHDFHTNCIKQWLMQKNLCPICKTTG 694
             ++ S       D EPCC+CQEEY +GD+LG L CGH+FHT C+KQWLM KNLCPICKT  
Sbjct:   604 KHTSSAAGSHQDMEPCCVCQEEYAEGDDLGTLGCGHEFHTACVKQWLMLKNLCPICKTVA 663

Query:   695 LPT 697
             L T
Sbjct:   664 LST 666


GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
TAIR|locus:2028225 AT1G45180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2160031 AT5G42940 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149378 AT5G24870 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2125284 AT4G31450 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2159634 AT5G10650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2027804 AT1G73760 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2030933 AT1G17970 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2009660 AT1G53190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086305 AT3G15070 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00036617001
SubName- Full=Chromosome chr3 scaffold_8, whole genome shotgun sequence; (669 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query697
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 1e-16
cd0016245 cd00162, RING, RING-finger (Really Interesting New 2e-13
smart0018440 smart00184, RING, Ring finger 1e-11
pfam1267873 pfam12678, zf-rbx1, RING-H2 zinc finger 4e-11
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 1e-10
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 5e-10
COG519488 COG5194, APC11, Component of SCF ubiquitin ligase 3e-08
PHA02929238 PHA02929, PHA02929, N1R/p28-like protein; Provisio 5e-08
COG5540374 COG5540, COG5540, RING-finger-containing ubiquitin 2e-07
pfam1286185 pfam12861, zf-Apc11, Anaphase-promoting complex su 2e-07
COG5243 491 COG5243, HRD1, HRD ubiquitin ligase complex, ER me 6e-06
pfam1392049 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI 3e-05
smart0074449 smart00744, RINGv, The RING-variant domain is a C4 0.002
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
 Score = 73.6 bits (181), Expect = 1e-16
 Identities = 18/43 (41%), Positives = 27/43 (62%)

Query: 650 CCICQEEYTDGDNLGILDCGHDFHTNCIKQWLMQKNLCPICKT 692
           C IC +E+  G+ + +L CGH FH  C+ +WL   N CP+C+ 
Sbjct: 3   CPICLDEFEPGEEVVVLPCGHVFHKECLDKWLRSSNTCPLCRA 45


Length = 46

>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|221705 pfam12678, zf-rbx1, RING-H2 zinc finger Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|227521 COG5194, APC11, Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional Back     alignment and domain information
>gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|193335 pfam12861, zf-Apc11, Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|128983 smart00744, RINGv, The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 697
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 99.42
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.37
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 99.12
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 99.07
PHA02929238 N1R/p28-like protein; Provisional 99.07
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 99.01
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 98.99
PLN03208 193 E3 ubiquitin-protein ligase RMA2; Provisional 98.95
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.93
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.88
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.81
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.79
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.76
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.67
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.67
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 98.66
PHA02926242 zinc finger-like protein; Provisional 98.62
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 98.61
PF1463444 zf-RING_5: zinc-RING finger domain 98.6
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.54
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.54
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.53
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.42
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 98.29
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 98.24
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.21
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 98.18
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.12
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.12
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 98.1
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 98.08
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.07
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 97.99
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 97.97
COG52191525 Uncharacterized conserved protein, contains RING Z 97.91
KOG149384 consensus Anaphase-promoting complex (APC), subuni 97.82
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 97.76
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 97.73
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 97.66
KOG0825 1134 consensus PHD Zn-finger protein [General function 97.56
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 97.56
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 97.52
KOG4445 368 consensus Uncharacterized conserved protein, conta 97.42
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 97.36
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 97.3
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 97.22
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 97.15
KOG1785 563 consensus Tyrosine kinase negative regulator CBL [ 96.83
KOG1428 3738 consensus Inhibitor of type V adenylyl cyclases/Ne 96.82
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 96.81
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 96.77
KOG0297 391 consensus TNF receptor-associated factor [Signal t 96.76
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 96.66
COG5152259 Uncharacterized conserved protein, contains RING a 96.64
KOG2660 331 consensus Locus-specific chromosome binding protei 96.62
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 96.61
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 96.41
KOG1941518 consensus Acetylcholine receptor-associated protei 96.32
KOG1002 791 consensus Nucleotide excision repair protein RAD16 96.15
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 96.02
KOG3039303 consensus Uncharacterized conserved protein [Funct 95.97
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 95.93
KOG3970 299 consensus Predicted E3 ubiquitin ligase [Posttrans 95.77
COG5222 427 Uncharacterized conserved protein, contains RING Z 95.69
PHA03096284 p28-like protein; Provisional 95.41
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 95.31
COG5236 493 Uncharacterized conserved protein, contains RING Z 95.23
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 95.04
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 94.95
KOG0801205 consensus Predicted E3 ubiquitin ligase [Posttrans 94.88
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 94.86
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 94.81
PF04641260 Rtf2: Rtf2 RING-finger 94.73
PHA02825 162 LAP/PHD finger-like protein; Provisional 94.65
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 94.38
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 94.3
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 94.07
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 93.67
PHA02862 156 5L protein; Provisional 93.66
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 93.38
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 93.32
KOG3268234 consensus Predicted E3 ubiquitin ligase [Posttrans 93.21
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 92.99
KOG0298 1394 consensus DEAD box-containing helicase-like transc 92.53
COG5175 480 MOT2 Transcriptional repressor [Transcription] 91.69
PF10272358 Tmpp129: Putative transmembrane protein precursor; 91.33
KOG1940276 consensus Zn-finger protein [General function pred 91.07
KOG3002 299 consensus Zn finger protein [General function pred 90.6
KOG1829580 consensus Uncharacterized conserved protein, conta 89.85
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 89.48
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 89.17
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 88.65
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 87.69
KOG1609 323 consensus Protein involved in mRNA turnover and st 87.59
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 86.81
KOG4362 684 consensus Transcriptional regulator BRCA1 [Replica 85.95
KOG3053 293 consensus Uncharacterized conserved protein [Funct 85.26
KOG03091081 consensus Conserved WD40 repeat-containing protein 85.21
KOG1812 384 consensus Predicted E3 ubiquitin ligase [Posttrans 85.11
COG5183 1175 SSM4 Protein involved in mRNA turnover and stabili 82.77
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 82.3
KOG0825 1134 consensus PHD Zn-finger protein [General function 82.19
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 81.43
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.42  E-value=8.1e-14  Score=149.37  Aligned_cols=49  Identities=49%  Similarity=1.151  Sum_probs=45.3

Q ss_pred             CcccccccccCCCCceEEeCCCChhcHHHHHHHHhcCC-CCcCCCCCcCC
Q 005412          648 EPCCICQEEYTDGDNLGILDCGHDFHTNCIKQWLMQKN-LCPICKTTGLP  696 (697)
Q Consensus       648 e~C~ICLEefe~ge~V~~LpCGH~FH~~CI~qWL~qkn-sCPICRk~LLp  696 (697)
                      ..|+||+|+|+.+++++.|||+|.||..||++||.+.. .||+||+.+..
T Consensus       230 ~~CaIClEdY~~GdklRiLPC~H~FH~~CIDpWL~~~r~~CPvCK~di~~  279 (348)
T KOG4628|consen  230 DTCAICLEDYEKGDKLRILPCSHKFHVNCIDPWLTQTRTFCPVCKRDIRT  279 (348)
T ss_pred             ceEEEeecccccCCeeeEecCCCchhhccchhhHhhcCccCCCCCCcCCC
Confidence            68999999999999999999999999999999999875 59999997654



>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0801 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG1829 consensus Uncharacterized conserved protein, contains C1, PH and RUN domains [Signal transduction mechanisms] Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1609 consensus Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>KOG3053 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query697
2ep4_A74 Solution Structure Of Ring Finger From Human Ring F 2e-06
2l0b_A91 Solution Nmr Structure Of Zinc Finger Domain Of E3 9e-06
1iym_A55 Ring-H2 Finger Domain Of El5 Length = 55 2e-05
2ect_A78 Solution Structure Of The Zinc Finger, C3hc4 Type ( 3e-05
1x4j_A75 Solution Structure Of Ring Finger In Ring Finger Pr 8e-05
2kiz_A69 Solution Structure Of Arkadia Ring-H2 Finger Domain 9e-05
4ayc_A138 Rnf8 Ring Domain Structure Length = 138 7e-04
4ayc_B138 Rnf8 Ring Domain Structure Length = 138 8e-04
4epo_C149 Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HE 9e-04
>pdb|2EP4|A Chain A, Solution Structure Of Ring Finger From Human Ring Finger Protein 24 Length = 74 Back     alignment and structure

Iteration: 1

Score = 50.8 bits (120), Expect = 2e-06, Method: Composition-based stats. Identities = 18/43 (41%), Positives = 26/43 (60%) Query: 648 EPCCICQEEYTDGDNLGILDCGHDFHTNCIKQWLMQKNLCPIC 690 E C +C E++ D LGI C H FH C+ +WL + +CP+C Sbjct: 16 ELCAVCLEDFKPRDELGICPCKHAFHRKCLIKWLEVRKVCPLC 58
>pdb|2L0B|A Chain A, Solution Nmr Structure Of Zinc Finger Domain Of E3 Ubiquitin-Protein Ligase Praja-1 From Homo Sapiens, Northeast Structural Genomics Consortium (Nesg) Target Hr4710b Length = 91 Back     alignment and structure
>pdb|1IYM|A Chain A, Ring-H2 Finger Domain Of El5 Length = 55 Back     alignment and structure
>pdb|2ECT|A Chain A, Solution Structure Of The Zinc Finger, C3hc4 Type (Ring Finger) Domain Of Ring Finger Protein 126 Length = 78 Back     alignment and structure
>pdb|1X4J|A Chain A, Solution Structure Of Ring Finger In Ring Finger Protein 38 Length = 75 Back     alignment and structure
>pdb|2KIZ|A Chain A, Solution Structure Of Arkadia Ring-H2 Finger Domain Length = 69 Back     alignment and structure
>pdb|4AYC|A Chain A, Rnf8 Ring Domain Structure Length = 138 Back     alignment and structure
>pdb|4AYC|B Chain B, Rnf8 Ring Domain Structure Length = 138 Back     alignment and structure
>pdb|4EPO|C Chain C, Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HETERODIMER Length = 149 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query697
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 5e-20
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 1e-17
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 7e-17
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 2e-16
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 3e-15
2ect_A78 Ring finger protein 126; metal binding protein, st 8e-15
2ecm_A55 Ring finger and CHY zinc finger domain- containing 1e-14
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 1e-14
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 1e-14
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 2e-14
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 7e-14
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 1e-13
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 1e-12
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 7e-11
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 3e-10
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 7e-06
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 3e-10
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 5e-10
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 6e-10
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 8e-10
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 9e-10
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 2e-09
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 2e-09
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 5e-09
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 6e-09
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 3e-08
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 6e-08
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 4e-07
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 9e-07
3nw0_A238 Non-structural maintenance of chromosomes element 1e-06
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 2e-06
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 3e-06
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 3e-06
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 6e-06
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 1e-05
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 1e-05
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 3e-05
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 3e-05
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 4e-05
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 6e-05
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 7e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-05
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 1e-04
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 1e-04
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 1e-04
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 2e-04
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 2e-04
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 2e-04
1z6u_A150 NP95-like ring finger protein isoform B; structura 3e-04
3hcs_A 170 TNF receptor-associated factor 6; cross-brace, bet 4e-04
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 5e-04
2ysl_A73 Tripartite motif-containing protein 31; ring-type 5e-04
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 6e-04
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 7e-04
2ecw_A85 Tripartite motif-containing protein 30; metal bind 8e-04
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 8e-04
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 9e-04
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
 Score = 83.7 bits (207), Expect = 5e-20
 Identities = 19/58 (32%), Positives = 31/58 (53%)

Query: 640 EIEIPSDEEPCCICQEEYTDGDNLGILDCGHDFHTNCIKQWLMQKNLCPICKTTGLPT 697
           +++  +  E C +C E++   D LGI  C H FH  C+ +WL  + +CP+C    L  
Sbjct: 8   KVKELNLHELCAVCLEDFKPRDELGICPCKHAFHRKCLIKWLEVRKVCPLCNMPVLQL 65


>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Length = 106 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Length = 117 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 94 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Length = 60 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Length = 60 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Length = 62 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query697
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.51
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.42
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.41
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.41
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.4
2ect_A78 Ring finger protein 126; metal binding protein, st 99.38
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.32
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.3
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.27
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.27
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.26
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.22
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.21
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 99.21
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.2
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.19
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.18
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.18
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.17
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.14
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.14
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.14
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.13
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.11
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.11
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.1
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.08
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.07
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 99.07
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.06
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.06
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.05
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.02
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.02
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.02
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.01
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.0
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.95
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.94
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 98.94
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.92
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.91
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.91
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.89
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.88
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 98.86
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 98.86
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 98.85
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.83
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.82
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.77
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.77
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.73
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.72
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.72
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.71
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.69
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.66
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.62
3hcs_A 170 TNF receptor-associated factor 6; cross-brace, bet 98.59
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.58
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.45
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 98.44
2ea5_A68 Cell growth regulator with ring finger domain prot 98.43
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.37
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.36
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.3
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.3
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.28
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.2
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 97.64
3nw0_A238 Non-structural maintenance of chromosomes element 97.39
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 93.84
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 93.62
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 92.53
3i2d_A371 E3 SUMO-protein ligase SIZ1; signal transduction, 87.78
1we9_A64 PHD finger family protein; structural genomics, PH 84.46
4fo9_A360 E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom 84.04
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 83.67
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 83.24
1wil_A89 KIAA1045 protein; ring finger domain, structural g 82.71
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 81.54
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 81.0
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
Probab=99.51  E-value=1.1e-14  Score=126.71  Aligned_cols=77  Identities=29%  Similarity=0.566  Sum_probs=61.6

Q ss_pred             CCCCCCHHHHHHHhhhccCCCcccCCCCCCCcccccccccCCCCceEEeCCCChhcHHHHHHHHhcCCCCcCCCCCcCC
Q 005412          618 VSTGLNEETIMKIMKQKRYPSLEIEIPSDEEPCCICQEEYTDGDNLGILDCGHDFHTNCIKQWLMQKNLCPICKTTGLP  696 (697)
Q Consensus       618 vs~GlSeE~I~kllk~~ky~~~e~~~~~~~e~C~ICLEefe~ge~V~~LpCGH~FH~~CI~qWL~qknsCPICRk~LLp  696 (697)
                      ...+++++.|.++... ++ .........+..|+||+++|..++.++.|+|+|.||..||.+||+.+..||+||+.+.+
T Consensus        13 ~~~~~s~~~i~~lp~~-~~-~~~~~~~~~~~~C~IC~~~~~~~~~~~~l~C~H~Fh~~Ci~~wl~~~~~CP~Cr~~~~~   89 (91)
T 2l0b_A           13 ANPPASKESIDALPEI-LV-TEDHGAVGQEMCCPICCSEYVKGDVATELPCHHYFHKPCVSIWLQKSGTCPVCRCMFPP   89 (91)
T ss_dssp             CCCCCCHHHHHTSCEE-EC-CTTCSSSSSCSEETTTTEECCTTCEEEEETTTEEEEHHHHHHHHTTTCBCTTTCCBSSC
T ss_pred             CCCCCCHHHHHhCCCe-ee-cccccccCCCCCCcccChhhcCCCcEEecCCCChHHHHHHHHHHHcCCcCcCcCccCCC
Confidence            3467888888775543 33 22223345677899999999998889999999999999999999999999999998764



>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 697
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 2e-17
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 9e-15
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 1e-13
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 4e-13
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 6e-12
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 5e-11
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 2e-10
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 6e-10
d1wima_94 g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 8e-08
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 2e-07
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 2e-07
d1v87a_114 g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou 1e-06
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 4e-05
d2baya156 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { 7e-05
d1wesa_71 g.50.1.2 (A:) PHD Inhibitor of growth protein 2, I 3e-04
d1wewa_78 g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale c 4e-04
d1t1ha_78 g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre 6e-04
d2c2la280 g.44.1.2 (A:225-304) STIP1 homology and U box-cont 8e-04
d1wema_76 g.50.1.2 (A:) Death associated transcription facto 0.002
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]
 Score = 74.1 bits (182), Expect = 2e-17
 Identities = 19/49 (38%), Positives = 25/49 (51%), Gaps = 1/49 (2%)

Query: 646 DEEPCCICQEEYTDGDNLGIL-DCGHDFHTNCIKQWLMQKNLCPICKTT 693
           D   C +C  E  DG+    L  CGH FH  C+  WL   + CP+C+ T
Sbjct: 4   DGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLT 52


>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 71 Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query697
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.53
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.32
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.28
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.24
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.23
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.18
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.16
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.08
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.03
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.02
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.98
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.84
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.83
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.8
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.79
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.65
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.31
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 89.87
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 88.0
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 81.65
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 80.5
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]
Probab=99.53  E-value=1.8e-15  Score=119.66  Aligned_cols=51  Identities=37%  Similarity=0.990  Sum_probs=46.5

Q ss_pred             CCCCcccccccccCCCCceEEe-CCCChhcHHHHHHHHhcCCCCcCCCCCcC
Q 005412          645 SDEEPCCICQEEYTDGDNLGIL-DCGHDFHTNCIKQWLMQKNLCPICKTTGL  695 (697)
Q Consensus       645 ~~~e~C~ICLEefe~ge~V~~L-pCGH~FH~~CI~qWL~qknsCPICRk~LL  695 (697)
                      +++..|+||+++|..++.+..+ .|+|.||.+||.+||+.+.+||+||++++
T Consensus         3 ed~~~C~ICl~~~~~~~~~~~l~~C~H~Fh~~Ci~~Wl~~~~~CP~CR~~i~   54 (55)
T d1iyma_           3 DDGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTVV   54 (55)
T ss_dssp             CCSCCCTTTCCCCCTTSCCEECSSSCCEECTTHHHHTTTTCCSCSSSCCCSC
T ss_pred             CCCCCCeEECccccCCCEEEEeCCCCCcccHHHHHHHHHhCCcCCCCCCEeE
Confidence            3556799999999999988887 59999999999999999999999999886



>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure