Citrus Sinensis ID: 005506

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690---

MENFPFHDGSIYDMLDTRHTDTRPDVNHSLQMHSSLVRRLSQERELEGHQGCVNAISWNSKGSLLISGSDDTHINVWSYSSRKLLHSIETGHSANVFCTKFVPETSDELVVSGAGDAEVRLFNLSRFSGRGLDDNAITPSALYQCHTRRVKKLAVEVGNPHVVWSASEDGTLRQHDFRQGSSCPPAGSSHQECRNILLDLRCGAKRSLADPPKQTLSLKSCDISSTRPHLLLVGGSDAFARLYDRRMLPPLTSCQKRMSPPPCVNYFCPMHLSEHGRSSLHLTHVTFSPNGEEVLLSYSGEHVYLMDVNHAGGRAMRYTVGDASKIMSFTPTLNGLELQPPIHDFLQTNIRVRGEVATGLGKCRMLVEIARNSLEEGKHPYYGIEACNEVLEGHLSGIGPMLRHECLCIRAALLLKRKWKNDAQMAIRDCYNARRIDSSSFRAHLYMSEALEQLCKYKEALDFAIAAQCLDPSNSVMAEKVENIKKHIAAAETEKNNKANDGGARSEPRTGRVLSLSDIIYRSEANSDASQDGPRSEREDSDYDEEVEVDFHTSVPGDEGRDVEANFLHGSLNVRIHRRGDSARETVDANGSSGSPSSSSQNDRIPYQPETVIDMKQRYVGHCNVGTDIKQASFLGQRGDYIASGSDDGRWFIWEKQTGRLIKMLLGDEAGNVISSMEECGLLLYFSILILSN

cccccccccccEEEEEcccccccccccccEEEEcccccccccccccccccccEEEEEEcccccEEEEEcccccEEEEEcccccEEEcccccccccEEEEEEEccccccEEEEEEccccEEEEEccccccccccccccccccccccccccEEEEEEEccccEEEEEEEccccEEEEEcccccccccccccccccEEEEEEccccccEEEcccccccccEEEEEEEcccccEEEEEEccccEEEEccccccccccccccccccccEEEEcccccccccccccEEEEEEEcccccEEEEEEccccEEEEEccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccHHHHHHHHHccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccHHHccccccHHHHccccccccEEccccccccccccccccccccccccccccccEEEccccccccEEEEEEEcccccEEEEcccccEEEEEEccHHHHHHHHcccccccEEEEccccccccEEEEccccc

ccccccccccEEEEcccccccccccccccEEccHHHHHHHHHHHHcccccccEEEEEEcccccEEEEcccccEEEEEEccccEEEEEEcccccccEEEEEEcccccccEEEEEccccEEEEEEcccccEEEcccccccEEEEEEcccccEEEEEEcccccEEEEEcccccEEEEEEcccccccEcccccccEEEEEEEccccccEEEEEcccccEEEEEEEEEccccccEEEEEccccEEEEEEcccccccccccccccccccEEEEccccccccccccEEEEEEEEcccccEEEEEccccEEEEEEccccccccccccccEEEEcccccccccEEEEccccccEEccccccccccHHHcccccccHHHcHHHHHHHHcHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccccccccccccccccccEEEHHHHHcccccccccccccccccccccccccHHEEccEEccccccccccccccccccEEEEEEEccccccccccccccccccccccccccccccccccccHHHHEccccccccccEEEEEEcccccEEEEEcccccEEEEEcccccEEEEEEcccccEEEcccccccEEEEHHHHEHcc

menfpfhdgsiydmldtrhtdtrpdvnhsLQMHSSLVRRLSQereleghqgcvnaiswnskgsllisgsddthinvWSYSSRKLLHSIetghsanvfctkfvpetsdelvvsgagdaEVRLFNlsrfsgrglddnaitpsalyqcHTRRVKKLAVEvgnphvvwsasedgtlrqhdfrqgsscppagsshqECRNILLDLrcgakrsladppkqtlslkscdisstrphlllvggsdafarlydrrmlppltscqkrmspppcvnyfcpmhlsehgrsslhlthvtfspngEEVLLSYSGEHVYLMDVnhaggramrytvgdaskimsftptlnglelqppihdflQTNIRVRGEVATGLGKCRMLVEIARNsleegkhpyygieaCNEVLEghlsgigpmlRHECLCIRAALLLKRKWKNDAQMAIRDCynarridsssfRAHLYMSEALEQLCKYKEALDFAIAAqcldpsnsvmAEKVENIKKHIAAAEteknnkandggarseprtgrvlsLSDIIYrseansdasqdgprseredsdydeevevdfhtsvpgdegrdveanflhgslnvrihrrgdsaretvdangssgspssssqndripyqpetVIDMKQRYVGhcnvgtdikqasflgqrgdyiasgsddgrwfIWEKQTGRLIKMLLGDEAGNVISSMEECGLLLYFSILILSN

menfpfhdgsiydMLDTRHTDTRPDVNHSLQMHSSLVRRLSQERELEGHQGCVNAISWNSKGSLLISGSDDTHINVWSYSSRKLLHSIETGHSANVFCTKFVPETSDELVVSGAGDAEVRLFNLSrfsgrglddnaitpsalyqCHTRRVKKLAVEVGNPHVVWSASEDGTLRQHDFRQGSSCPPAGSSHQECRNILLDLRCGAKRsladppkqtlslkscdisstrphLLLVGGSDAFARLYDRRMLPPLTSCQKRMSPPPCVNYFCPMHLSEHGRSSLHLTHVTFSPNGEEVLLSYSGEHVYLMDVNHAGGRAMRYTVGDASKIMSFTPTLNGLELQPPIHDFLQTNIRVRGEVATGLGKCRMLVEIARNSLEEGKHPYYGIEACNEVLEGHLSGIGPMLRHECLCIRAALLLKRKWKNDAQMAIRDCYNARRIDSSSFRAHLYMSEALEQLCKYKEALDFAIAAQCLDPSNSVMAEKVENIKKHIAaaeteknnkandggarseprtgrVLSLSDIIYrseansdasqdgprseredsdydeevEVDFHtsvpgdegrdvEANFLHGSLNVRIHRRGDSAREtvdangssgspssssqndriPYQPETVIDMKQRYVGHCNVGTDIKQASFLGQRGDYIasgsddgrwFIWEKQTGRLIKMLLGDEAGNVISSMEECGLLLYFSILILSN

MENFPFHDGSIYDMLDTRHTDTRPDVNHSLQMHSSLVRRLSQERELEGHQGCVNAISWNSKGSLLISGSDDTHINVWSYSSRKLLHSIETGHSANVFCTKFVPETSDELVVSGAGDAEVRLFNLSRFSGRGLDDNAITPSALYQCHTRRVKKLAVEVGNPHVVWSASEDGTLRQHDFRQGSSCPPAGSSHQECRNILLDLRCGAKRSLADPPKQTLSLKSCDISSTRPHLLLVGGSDAFARLYDRRMLPPLTSCQKRMSPPPCVNYFCPMHLSEHGRSSLHLTHVTFSPNGEEVLLSYSGEHVYLMDVNHAGGRAMRYTVGDASKIMSFTPTLNGLELQPPIHDFLQTNIRVRGEVATGLGKCRMLVEIARNSLEEGKHPYYGIEACNEVLEGHLSGIGPMLRHECLCIRAALLLKRKWKNDAQMAIRDCYNARRIDSSSFRAHLYMSEALEQLCKYKEALDFAIAAQCLDPSNSVMAEKVENIKKHIaaaeteknnkanDGGARSEPRTGRVLSLSDIIYRSEANSDASQDGPrseredsdydeevevdFHTSVPGDEGRDVEANFLHGSLNVRIHRRGDSARETVDANgssgspssssQNDRIPYQPETVIDMKQRYVGHCNVGTDIKQASFLGQRGDYIASGSDDGRWFIWEKQTGRLIKMLLGDEAGNVISSMEECGLLLYFSILILSN

************************************************HQGCVNAISWNSKGSLLISGSDDTHINVWSYSSRKLLHSIETGHSANVFCTKFVPETSDELVVSGAGDAEVRLFNLSRFSGRGLDDNAITPSALYQCHTRRVKKLAVEVGNPHVVWSA**************************CRNILLDLRCGA****************CDISSTRPHLLLVGGSDAFARLYDRRMLPPLTSCQKRMSPPPCVNYFCPMHLSEHGRSSLHLTHVTFSPNGEEVLLSYSGEHVYLMDVNHAGGRAMRYTVGDASKIMSFTPTLNGLELQPPIHDFLQTNIRVRGEVATGLGKCRMLVEIARNSLEEGKHPYYGIEACNEVLEGHLSGIGPMLRHECLCIRAALLLKRKWKNDAQMAIRDCYNARRIDSSSFRAHLYMSEALEQLCKYKEALDFAIAAQCLDP**********************************************************************************************FLH*****************************************TVIDMKQRYVGHCNVGTDIKQASFLGQRGDYIASGSDDGRWFIWEKQTGRLIKMLLGDEAGNVISSMEECGLLLYFSILIL**

MENFPFHDGSIYDMLDTRHTDTRPDVNHSLQMHSSLVRRLSQERELEGHQGCVNAISWNSKGSLLISGSDDTHINVWSYSSRKLLHSIETGHSANVFCTKFVPETSDELVVSGAGDAEVRLFNLSRFSGRGLDDNAITPSALYQCHTRRVKKLAVEVGNPHVVWSASEDGTLRQHDFRQGSSCPPAGSSHQECRNILLDLRCGAKRSLADPPKQTLSLKSCDISSTRPHLLLVGGSDAFARLYDRRMLPPLTSCQKRMSPPPCVNYFCPMHLSEHGRSSLHLTHVTFSPNGEEVLLSYSGEHVYLMDVNHAGGRAMRYTVGDASKIMSFTPTL****************************************LEEGKHPYYGIEACNEVLEGHLSGIGPMLRHECLCIRAALLLKRKWKNDAQMAIRDCYNARRIDSSSFRAHLYMSEALEQLCKYKEALDFAIAAQCLDPSNSVMAEKVE*******************************************************************************DVE*NF*****************************************PETVIDMKQRYVGHCNVGTDIKQASFLGQRGDYIASGSDDGRWFIWEKQTGRLIKMLLGDEAGNVISSMEECGLLLYFSILIL**

MENFPFHDGSIYDMLDTRHTDTRPDVNHSLQMHSSLVRRLSQERELEGHQGCVNAISWNSKGSLLISGSDDTHINVWSYSSRKLLHSIETGHSANVFCTKFVPETSDELVVSGAGDAEVRLFNLSRFSGRGLDDNAITPSALYQCHTRRVKKLAVEVGNPHVVWSASEDGTLRQHD**************QECRNILLDLRCGAKRSLADPPKQTLSLKSCDISSTRPHLLLVGGSDAFARLYDRRMLPPLTSCQKRMSPPPCVNYFCPMHLSEHGRSSLHLTHVTFSPNGEEVLLSYSGEHVYLMDVNHAGGRAMRYTVGDASKIMSFTPTLNGLELQPPIHDFLQTNIRVRGEVATGLGKCRMLVEIARNSLEEGKHPYYGIEACNEVLEGHLSGIGPMLRHECLCIRAALLLKRKWKNDAQMAIRDCYNARRIDSSSFRAHLYMSEALEQLCKYKEALDFAIAAQCLDPSNSVMAEKVENIKKHIAAAETEK**************TGRVLSLSDIIYRSE*********************EVEVDFHTSVPGDEGRDVEANFLHGSLNVRIHRRG************************IPYQPETVIDMKQRYVGHCNVGTDIKQASFLGQRGDYIASGSDDGRWFIWEKQTGRLIKMLLGDEAGNVISSMEECGLLLYFSILILSN

*****FHDGSIYDMLDTRHTDTRPDVNHSLQMHSSLVRRLSQERELEGHQGCVNAISWNSKGSLLISGSDDTHINVWSYSSRKLLHSIETGHSANVFCTKFVPETSDELVVSGAGDAEVRLFNLSRFSGRGLDDNAITPSALYQCHTRRVKKLAVEVGNPHVVWSASEDGTLRQHDFRQGSSCPPAGSSHQECRNILLDLRCGAKRSLADPPKQTLSLKSCDISSTRPHLLLVGGSDAFARLYDRRMLPPLTSCQKRMSPPPCVNYFCPMHLSEHGRSSLHLTHVTFSPNGEEVLLSYSGEHVYLMDVNHAGGRAMRYTVGDASKIMSFTPTLNGLELQPPIHDFLQTNIRVRGEVATGLGKCRMLVEIARNSLEEGKHPYYGIEACNEVLEGHLSGIGPMLRHECLCIRAALLLKRKWKNDAQMAIRDCYNARRIDSSSFRAHLYMSEALEQLCKYKEALDFAIAAQCLDPSNSVMAEKVENIKKHIAAAETE****************GRVLSLSDIIYRSE****************SDYDEEVEVDFHTSVP*D*****EANFLHGSLNVRIHRRG*************************PYQPETVIDMKQRYVGHCNVGTDIKQASFLGQRGDYIASGSDDGRWFIWEKQTGRLIKMLLGDEAGNVISSMEECGLLLYFSILILSN

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MENFPFHDGSIYDMLDTRHTDTRPDVNHSLQMHSSLVRRLSQERELEGHQGCVNAISWNSKGSLLISGSDDTHINVWSYSSRKLLHSIETGHSANVFCTKFVPETSDELVVSGAGDAEVRLFNLSRFSGRGLDDNAITPSALYQCHTRRVKKLAVEVGNPHVVWSASEDGTLRQHDFRQGSSCPPAGSSHQECRNILLDLRCGAKRSLADPPKQTLSLKSCDISSTRPHLLLVGGSDAFARLYDRRMLPPLTSCQKRMSPPPCVNYFCPMHLSEHGRSSLHLTHVTFSPNGEEVLLSYSGEHVYLMDVNHAGGRAMRYTVGDASKIMSFTPTLNGLELQPPIHDFLQTNIRVRGEVATGLGKCRMLVEIARNSLEEGKHPYYGIEACNEVLEGHLSGIGPMLRHECLCIRAALLLKRKWKNDAQMAIRDCYNARRIDSSSFRAHLYMSEALEQLCKYKEALDFAIAAQCLDPSNSVMAEKxxxxxxxxxxxxxxxxxxxxxGGARSEPRTGRVLSLSDIIYRSEANSDASQDGPRSEREDSDYDEEVEVDFHTSVPGDEGRDVEANFLHGSLNVRIHRRGDSARETVDANGSSGSPSSSSQNDRIPYQPETVIDMKQRYVGHCNVGTDIKQASFLGQRGDYIASGSDDGRWFIWEKQTGRLIKMLLGDEAGNVISSMEECGLLLYFSILILSN

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		693	2.2.26 [Sep-21-2011]
Q8N5D0		677	WD and tetratricopeptide	yes	no	0.607	0.621	0.305	1e-45
Q80ZK9		677	WD and tetratricopeptide	yes	no	0.536	0.549	0.295	1e-43
Q9DC22		876	DDB1- and CUL4-associated	no	no	0.415	0.328	0.313	4e-34
Q5R9B8		860	DDB1- and CUL4-associated	no	no	0.415	0.334	0.310	9e-34
Q58WW2		860	DDB1- and CUL4-associated	no	no	0.415	0.334	0.310	1e-33
O94527		809	WD repeat protein iqw1 OS	yes	no	0.484	0.415	0.290	1e-33
Q5R448		597	DDB1- and CUL4-associated	no	no	0.376	0.437	0.288	6e-28
Q5TAQ9		597	DDB1- and CUL4-associated	no	no	0.376	0.437	0.285	3e-27
Q5U2M6		591	DDB1- and CUL4-associated	no	no	0.337	0.395	0.296	4e-27
Q8N7N5		591	DDB1- and CUL4-associated	no	no	0.376	0.441	0.282	8e-27

>sp\|Q8N5D0\|WDTC1_HUMAN WD and tetratricopeptide repeats protein 1 OS=Homo sapiens GN=WDTC1 PE=1 SV=2	Back alignment and function desciption

 Score =  185 bits (470), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 152/497 (30%), Positives = 221/497 (44%), Gaps = 76/497 (15%)

Query: 36  LVRRLSQERELEGHQGCVNAISWNSKGSLLISGSDDTHINVWSYSSRKLLHSIETGHSAN 95
            +RRL  E EL+GH GCVN + WN KG LL SGSDD H  VW     K L S+ TGH+AN
Sbjct: 33  FIRRLGLEAELQGHSGCVNCLEWNEKGDLLASGSDDQHTIVWDPLHHKKLLSMHTGHTAN 92

Query: 96  VFCTKFVPETSDELVVSGAGDAEVRLFNLSRFSGRGLDDNAITPSALYQCHTRRVKKLAV 155
           +F  KF+P   D ++++GA D++V + +L+                ++  HT RVK++A 
Sbjct: 93  IFSVKFLPHAGDRILITGAADSKVHVHDLT----------VKETIHMFGDHTNRVKRIAT 142

Query: 156 EVGNPHVVWSASEDGTLRQHDFRQGSSCPPAGSSHQECRNILLDLR--CGAKRSLADPPK 213
               P+  WSA+EDG +RQ+D R+        S H E   +L+DL   CG          
Sbjct: 143 APMWPNTFWSAAEDGLIRQYDLRE-------NSKHSE---VLIDLTEYCG---------- 182

Query: 214 QTLSLKSCDISSTRPHLLLVGGSDAFARLYDRRMLPPLTSCQKRMSPPPCVNYFC----- 268
           Q +  K   ++    + L VG S  F RLYD RM+       K+ SP   V+ FC     
Sbjct: 183 QLVEAKCLTVNPQDNNCLAVGASGPFVRLYDIRMIHNHRKSMKQ-SPSAGVHTFCDRQKP 241

Query: 269 --------------PMHLSEHGR--SSLHLTHVTFSPNGEEVLLSYSGEHVYLMDVNHAG 312
                         P+ L ++      L  T+VTFSPNG E+L++  GE VYL D+ +  
Sbjct: 242 LPDGAAQYYVAGHLPVKLPDYNNRLRVLVATYVTFSPNGTELLVNMGGEQVYLFDLTY-- 299

Query: 313 GRAMRYTVGDASKIMSFTPTLNGLELQPPIHDFLQTNIRVRG---EVATGLGKCRMLVEI 369
            +   YT     K  S     NG      + + +   + +      +    G     VE+
Sbjct: 300 -KQRPYTFLLPRKCHSSGEVQNGKMSTNGVSNGVSNGLHLHSNGFRLPESRGHVSPQVEL 358

Query: 370 ARNSLEEGKHPYYGIEACNEVLEGHLSGIGPMLR--HECLCI--RAALLLKRKWKNDAQM 425
               LE  K       AC +  +        + R  H  +    RAA  +KRKW  D   
Sbjct: 359 P-PYLERVKQQANEAFACQQWTQAIQLYSKAVQRAPHNAMLYGNRAAAYMKRKWDGDHYD 417

Query: 426 AIRDCYNARRIDSSSFRAHLYMSEALEQLCKYKEALDFAIAAQCLDPSNSVMAEKVEN-- 483
           A+RDC  A  ++    +AH  ++  L +L    EAL      +CLD       E+  +  
Sbjct: 418 ALRDCLKAISLNPCHLKAHFRLARCLFELKYVAEAL------ECLDDFKGKFPEQAHSSA 471

Query: 484 ---IKKHIAAAETEKNN 497
              + + I AA   KN+
Sbjct: 472 CDALGRDITAALFSKND 488

Homo sapiens (taxid: 9606)

>sp\|Q80ZK9\|WDTC1_MOUSE WD and tetratricopeptide repeats protein 1 OS=Mus musculus GN=Wdtc1 PE=1 SV=1	Back alignment and function description

>sp\|Q9DC22\|DCAF6_MOUSE DDB1- and CUL4-associated factor 6 OS=Mus musculus GN=Dcaf6 PE=1 SV=1	Back alignment and function description

>sp\|Q5R9B8\|DCAF6_PONAB DDB1- and CUL4-associated factor 6 OS=Pongo abelii GN=DCAF6 PE=2 SV=2	Back alignment and function description

>sp\|Q58WW2\|DCAF6_HUMAN DDB1- and CUL4-associated factor 6 OS=Homo sapiens GN=DCAF6 PE=1 SV=1	Back alignment and function description

>sp\|O94527\|IQW1_SCHPO WD repeat protein iqw1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=iqw1 PE=1 SV=1	Back alignment and function description

>sp\|Q5R448\|DCAF8_PONAB DDB1- and CUL4-associated factor 8 OS=Pongo abelii GN=DCAF8 PE=2 SV=1	Back alignment and function description

>sp\|Q5TAQ9\|DCAF8_HUMAN DDB1- and CUL4-associated factor 8 OS=Homo sapiens GN=DCAF8 PE=1 SV=1	Back alignment and function description

>sp\|Q5U2M6\|DCAF8_RAT DDB1- and CUL4-associated factor 8 OS=Rattus norvegicus GN=Dcaf8 PE=2 SV=1	Back alignment and function description

>sp\|Q8N7N5\|DCAF8_MOUSE DDB1- and CUL4-associated factor 8 OS=Mus musculus GN=Dcaf8 PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		693
255545904		761	WD and tetratricopeptide repeat protein,	0.963	0.877	0.779	0.0
224081993		756	predicted protein [Populus trichocarpa]	0.956	0.876	0.789	0.0
302142032		762	unnamed protein product [Vitis vinifera]	0.963	0.876	0.757	0.0
449436964		759	PREDICTED: WD and tetratricopeptide repe	0.961	0.877	0.731	0.0
356515704		762	PREDICTED: WD and tetratricopeptide repe	0.963	0.876	0.715	0.0
356508017		762	PREDICTED: WD and tetratricopeptide repe	0.963	0.876	0.712	0.0
297811205		755	hypothetical protein ARALYDRAFT_487925 [	0.950	0.872	0.714	0.0
334187604		754	WD and tetratricopeptide repeats protein	0.950	0.874	0.714	0.0
357465333		758	DDB1- and CUL4-associated factor [Medica	0.953	0.872	0.709	0.0
18416416		757	WD and tetratricopeptide repeats protein	0.952	0.871	0.710	0.0

>gi\|255545904\|ref\|XP_002514012.1\| WD and tetratricopeptide repeat protein, putative [Ricinus communis] gi\|223547098\|gb\|EEF48595.1\| WD and tetratricopeptide repeat protein, putative [Ricinus communis]	Back alignment and taxonomy information

 Score = 1101 bits (2847), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/670 (77%), Positives = 589/670 (87%), Gaps = 2/670 (0%)

Query: 1   MENFPFHDGSIYDMLDTRHTDTRPDVNHSLQMHSSLVRRLSQERELEGHQGCVNAISWNS 60
           M+   FHDG+IY+ L+TR+ D+R D+NHSLQMHSSL+RRLSQERELEGHQGCVN+I+WNS
Sbjct: 1   MDTCGFHDGNIYNFLETRYFDSRRDINHSLQMHSSLIRRLSQERELEGHQGCVNSIAWNS 60

Query: 61  KGSLLISGSDDTHINVWSYSSRKLLHSIETGHSANVFCTKFVPETSDELVVSGAGDAEVR 120
            GSLL+SGSDDT +N+WSYS RKLLHSI+TGHSAN+FCTKF+PETSDELVVSGAGDAEVR
Sbjct: 61  TGSLLVSGSDDTRMNIWSYSGRKLLHSIDTGHSANIFCTKFIPETSDELVVSGAGDAEVR 120

Query: 121 LFNLSRFSGRGLDDNAITPSALYQCHTRRVKKLAVEVGNPHVVWSASEDGTLRQHDFRQG 180
           LFNLSR SGRG DDNAI P ALYQCHT+RVKKLAVEVGNP+VVWSASEDGTLRQHD R+ 
Sbjct: 121 LFNLSRLSGRGPDDNAIAPLALYQCHTKRVKKLAVEVGNPNVVWSASEDGTLRQHDLRED 180

Query: 181 SSCPPAGSSHQECRNILLDLRCGAKRSLADPPKQTLSLKSCDISSTRPHLLLVGGSDAFA 240
           SSCPPAGSS QECRN+LLDLRCGAKRSL DPPKQTL+LKSCDIS+ RPHLLLVGGSDAFA
Sbjct: 181 SSCPPAGSSPQECRNVLLDLRCGAKRSLVDPPKQTLALKSCDISARRPHLLLVGGSDAFA 240

Query: 241 RLYDRRMLPPLTSCQKRMSPPPCVNYFCPMHLSEHGRSSLHLTHVTFSPNGEEVLLSYSG 300
           RLYDRRMLPPLTSC+KRM PPPCVNY CPMHLSE GRS LHLTHVTFSP+G+EVLLSYSG
Sbjct: 241 RLYDRRMLPPLTSCRKRMPPPPCVNYICPMHLSERGRSGLHLTHVTFSPSGDEVLLSYSG 300

Query: 301 EHVYLMDVNHAGGRAMRYTVGDASKIMSFTPTLNGLELQPPIHDFLQTNIRVRGEVATGL 360
           EHVYLM+VNHAGG +M+YT GDASK+M+F P LNGLELQPP  D  +  +R +  VA+ L
Sbjct: 301 EHVYLMNVNHAGGSSMQYTTGDASKLMTFAPILNGLELQPPPSDISKNGLRFKSYVASTL 360

Query: 361 GKCRMLVEIARNSLEEGKHPYYGIEACNEVLEGHLSGIGPMLRHECLCIRAALLLKRKWK 420
            KCR L++ A   L++G + +YGIEACNEVL+ H   I P +RH+CLC RAALLLKRKWK
Sbjct: 361 QKCRKLLQFAEKCLDDGANFFYGIEACNEVLDRHGRDISPAIRHDCLCTRAALLLKRKWK 420

Query: 421 NDAQMAIRDCYNARRIDSSSFRAHLYMSEALEQLCKYKEALDFAIAAQCLDPSNSVMAEK 480
           ND  MAIRDCYNARRIDSSSFRA  YMSEAL QL KYKEALDFA+A+QC+ PS++ +AE 
Sbjct: 421 NDVHMAIRDCYNARRIDSSSFRALYYMSEALSQLGKYKEALDFAVASQCVAPSDTEIAEW 480

Query: 481 VENIKKHIAAAETEKNNKANDGGARSEPRTGRVLSLSDIIYRSEANSDASQDGPRSERED 540
           VENIK ++A AE EK NKANDG  +SE R+GR LSLSDI+YRSEA SD SQDGP +ERE+
Sbjct: 481 VENIKNNLAQAEAEKTNKANDGALKSESRSGRALSLSDILYRSEATSDGSQDGP-TEREE 539

Query: 541 SDYDEEVEVDFHTSVPGDEGRDVEANFLHGSLNVRIHRRGDSARETVDANGSSGSPSSSS 600
           SDYDEE+E+DF TS+ GDEGRD+E N LHGSLN+RIHRRGDS+RET   NGS GSP SSS
Sbjct: 540 SDYDEELELDFETSISGDEGRDIEPNTLHGSLNLRIHRRGDSSRETSCTNGSCGSP-SSS 598

Query: 601 QNDRIPYQPETVIDMKQRYVGHCNVGTDIKQASFLGQRGDYIASGSDDGRWFIWEKQTGR 660
            NDR+PYQPETVIDMKQR+VGHCNVGTDIKQASFLG+RG+Y+ASGSDDGRWFIWEKQTGR
Sbjct: 599 HNDRMPYQPETVIDMKQRFVGHCNVGTDIKQASFLGERGEYVASGSDDGRWFIWEKQTGR 658

Query: 661 LIKMLLGDEA 670
           LIKMLLGDEA
Sbjct: 659 LIKMLLGDEA 668

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224081993\|ref\|XP_002306549.1\| predicted protein [Populus trichocarpa] gi\|222855998\|gb\|EEE93545.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|302142032\|emb\|CBI19235.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|449436964\|ref\|XP_004136262.1\| PREDICTED: WD and tetratricopeptide repeats protein 1-like [Cucumis sativus] gi\|449497029\|ref\|XP_004160293.1\| PREDICTED: WD and tetratricopeptide repeats protein 1-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|356515704\|ref\|XP_003526538.1\| PREDICTED: WD and tetratricopeptide repeats protein 1-like [Glycine max]	Back alignment and taxonomy information

>gi\|356508017\|ref\|XP_003522759.1\| PREDICTED: WD and tetratricopeptide repeats protein 1-like [Glycine max]	Back alignment and taxonomy information

>gi\|297811205\|ref\|XP_002873486.1\| hypothetical protein ARALYDRAFT_487925 [Arabidopsis lyrata subsp. lyrata] gi\|297319323\|gb\|EFH49745.1\| hypothetical protein ARALYDRAFT_487925 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|334187604\|ref\|NP_001190286.1\| WD and tetratricopeptide repeats protein 1 [Arabidopsis thaliana] gi\|8979728\|emb\|CAB96849.1\| putative protein [Arabidopsis thaliana] gi\|332004229\|gb\|AED91612.1\| WD and tetratricopeptide repeats protein 1 [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|357465333\|ref\|XP_003602948.1\| DDB1- and CUL4-associated factor [Medicago truncatula] gi\|355491996\|gb\|AES73199.1\| DDB1- and CUL4-associated factor [Medicago truncatula]	Back alignment and taxonomy information

>gi\|18416416\|ref\|NP_568242.1\| WD and tetratricopeptide repeats protein 1 [Arabidopsis thaliana] gi\|14532680\|gb\|AAK64141.1\| unknown protein [Arabidopsis thaliana] gi\|23297429\|gb\|AAN12885.1\| unknown protein [Arabidopsis thaliana] gi\|332004228\|gb\|AED91611.1\| WD and tetratricopeptide repeats protein 1 [Arabidopsis thaliana]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		693
TAIR\|locus:2183735		757	ASG2 "AT5G10940" [Arabidopsis	0.952	0.871	0.672	2.8e-240
UNIPROTKB\|Q8N5D0		677	WDTC1 "WD and tetratricopeptid	0.597	0.611	0.298	6.6e-54
UNIPROTKB\|E2RA21		679	WDTC1 "Uncharacterized protein	0.597	0.609	0.298	6.9e-54
UNIPROTKB\|B6CVL4		678	WDTC1 "Uncharacterized protein	0.597	0.610	0.298	1.1e-53
MGI\|MGI:2685541		677	Wdtc1 "WD and tetratricopeptid	0.360	0.369	0.344	3e-53
RGD\|1310362		676	Wdtc1 "WD and tetratricopeptid	0.360	0.369	0.341	7.1e-53
UNIPROTKB\|E1C4X5		671	WDTC1 "Uncharacterized protein	0.369	0.381	0.327	3.3e-52
FB\|FBgn0000057		628	adp "adipose" [Drosophila mela	0.245	0.270	0.368	1.9e-44
POMBASE\|SPBC609.03		809	iqw1 "WD repeat protein, Iqw1"	0.441	0.378	0.307	1.2e-43
UNIPROTKB\|F1NU19		825	F1NU19 "Uncharacterized protei	0.258	0.216	0.338	3.7e-35

TAIR\|locus:2183735 ASG2 "AT5G10940" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 2316 (820.3 bits), Expect = 2.8e-240, P = 2.8e-240
 Identities = 453/674 (67%), Positives = 520/674 (77%)

Query:     1 MENFPFHDGSIYDMLDTRHTDTRPDVNHSLQMHSSLVRRLSQERELEGHQGCVNAISWNS 60
             M+N  FHDG+I+++L TR  D   +V+  +Q HSSLVRRLSQE+ELEGHQGCVNA++WNS
Sbjct:     1 MDNLSFHDGNIFNLLHTRSQDPSHEVDQRMQFHSSLVRRLSQEQELEGHQGCVNALAWNS 60

Query:    61 KGSLLISGSDDTHINVWSYSSRKLLHSIETGHSANVFCTKFVPETSDELVVSGAGDAEVR 120
              GSLLISGSDD  IN+W+YSSRKLLHSI+TGH+AN+FCTKFVPETSDELVVSGAGDAEVR
Sbjct:    61 NGSLLISGSDDLRINIWNYSSRKLLHSIDTGHTANIFCTKFVPETSDELVVSGAGDAEVR 120

Query:   121 LFNLSRFSGRGLDDNAITPSALYQCHTRRVKKLAVEVGNPHVVWSASEDGTLRQHDFRQG 180
             LFN SR SGR  DDNAI PSALYQCHTRRVKKLAVE GNP+VVWSASEDGTLRQHDFR+ 
Sbjct:   121 LFNTSRLSGRAEDDNAIIPSALYQCHTRRVKKLAVEPGNPNVVWSASEDGTLRQHDFRES 180

Query:   181 SSCPPAGSSHQECRNILLDLRCGAKRSLADPPKQTLSLKSCDISSTRPHLLLVGGSDAFA 240
             +SCPPAG++HQECR++LLDLR GAKR+LADPPKQTLSLKSCDIS+TRPHLLLVGGSDAFA
Sbjct:   181 TSCPPAGTAHQECRSVLLDLRSGAKRALADPPKQTLSLKSCDISATRPHLLLVGGSDAFA 240

Query:   241 RLYDRRMLPPLTSCQKRMSPPPCVNYFCPMHLSEHGRSSLHLTHVTFSPNGEEVLLSYSG 300
             RLYDRRMLPPL S +KRM PPPCVNYFCPMHLSE GR++LHLTHVTFSPNGEEVLLSYSG
Sbjct:   241 RLYDRRMLPPLASSRKRMPPPPCVNYFCPMHLSERGRTNLHLTHVTFSPNGEEVLLSYSG 300

Query:   301 EHVYLMDVNHA--GGRAMRYTVGDASKIMSFTPTLNGLELQPPIHDFLQTNIRVRGEVAT 358
             EHVYLM+VN+       M+YT GD   + SF+  L+ +E  P +    Q         AT
Sbjct:   301 EHVYLMNVNNGICSTGIMQYTPGDVDNLFSFSNNLHDVESPPQVSTTPQNGFHRSSNAAT 360

Query:   359 GLGKCRMLVEIARNSLEEGKHPYYGIEACNEVLEGHLSGIGPMLRHECLCIRAALLLKRK 418
              + KC  LVEIA+ SLEEG   +Y IEA NEVL+ H + I   LRHECLC RAALLLKRK
Sbjct:   361 -VKKCTELVEIAKWSLEEGTDVFYAIEAANEVLDAHSNDIESALRHECLCTRAALLLKRK 419

Query:   419 WKNDAQMAIRDCYNARRIDSSSFRAHLYMSEALEQLCKYKEALDFAIAAQCLDPSNSVMA 478
             WKNDA MA+RDC+NARRID+SSF+AH YMSEAL+QL K KEALDFA AAQ ++PS++ + 
Sbjct:   420 WKNDAHMAVRDCHNARRIDASSFKAHYYMSEALQQLGKCKEALDFATAAQHMNPSDADIV 479

Query:   479 EKVENIKKHIXXXXXXXXXXXXDGGARSEPRTGRVLSLSDIIYRSEANSDASQDGPXXXX 538
              KVE+IK+ +             G       T RVLSLSDI+YRSEANSD+S D      
Sbjct:   480 AKVESIKRDLQAAGAEKNEETGAG-------TTRVLSLSDILYRSEANSDSSHDMSRSER 532

Query:   539 XXXXXXXXXXXXFHTSVPGDEGRDVEANFLHGSLNVRIHRRGDSA--RETVDANXXXXXX 596
                           TS+  DEGRD ++N + GSLN+RIHR GD      TVD        
Sbjct:   533 EDSDYDEELELDIQTSLSDDEGRDTDSNSMRGSLNLRIHRVGDDKPMENTVD--NASSGT 590

Query:   597 XXXXQNDRIPYQPETVIDMKQRYVGHCNVGTDIKQASFLGQRGDYIASGSDDGRWFIWEK 656
                 QNDR  YQPE  IDMK+RYVGHCNVGTDIKQASFLGQRG+YIASGSDDGRWFIWEK
Sbjct:   591 ASSSQNDRTSYQPEGAIDMKRRYVGHCNVGTDIKQASFLGQRGEYIASGSDDGRWFIWEK 650

Query:   657 QTGRLIKMLLGDEA 670
             QTGRL+K+L+GDE+
Sbjct:   651 QTGRLMKVLVGDES 664

GO:0000166 "nucleotide binding" evidence=ISS

GO:0005737 "cytoplasm" evidence=ISM

GO:0008150 "biological_process" evidence=ND

GO:0005886 "plasma membrane" evidence=IDA

GO:0080008 "Cul4-RING ubiquitin ligase complex" evidence=ISS

GO:0009506 "plasmodesma" evidence=IDA

GO:0000956 "nuclear-transcribed mRNA catabolic process" evidence=RCA

GO:0006346 "methylation-dependent chromatin silencing" evidence=RCA

GO:0007062 "sister chromatid cohesion" evidence=RCA

GO:0009630 "gravitropism" evidence=RCA

GO:0010413 "glucuronoxylan metabolic process" evidence=RCA

GO:0016246 "RNA interference" evidence=RCA

GO:0031048 "chromatin silencing by small RNA" evidence=RCA

GO:0045132 "meiotic chromosome segregation" evidence=RCA

GO:0045492 "xylan biosynthetic process" evidence=RCA

UNIPROTKB\|Q8N5D0 WDTC1 "WD and tetratricopeptide repeats protein 1" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|E2RA21 WDTC1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|B6CVL4 WDTC1 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

MGI\|MGI:2685541 Wdtc1 "WD and tetratricopeptide repeats 1" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

RGD\|1310362 Wdtc1 "WD and tetratricopeptide repeats 1" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|E1C4X5 WDTC1 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

FB\|FBgn0000057 adp "adipose" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

POMBASE\|SPBC609.03 iqw1 "WD repeat protein, Iqw1" [Schizosaccharomyces pombe (taxid:4896)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NU19 F1NU19 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		693
cd00200		289	cd00200, WD40, WD40 domain, found in a number of e	2e-17
cd00200		289	cd00200, WD40, WD40 domain, found in a number of e	6e-15
cd00200		289	cd00200, WD40, WD40 domain, found in a number of e	6e-14
cd00200		289	cd00200, WD40, WD40 domain, found in a number of e	2e-13
cd00200		289	cd00200, WD40, WD40 domain, found in a number of e	4e-11
COG2319		466	COG2319, COG2319, FOG: WD40 repeat [General functi	5e-10
COG2319		466	COG2319, COG2319, FOG: WD40 repeat [General functi	2e-08
COG2319		466	COG2319, COG2319, FOG: WD40 repeat [General functi	2e-08
COG2319		466	COG2319, COG2319, FOG: WD40 repeat [General functi	4e-08
pfam00400		39	pfam00400, WD40, WD domain, G-beta repeat	4e-07
COG2319		466	COG2319, COG2319, FOG: WD40 repeat [General functi	6e-07
smart00320		40	smart00320, WD40, WD40 repeats	8e-07
COG2319		466	COG2319, COG2319, FOG: WD40 repeat [General functi	8e-06
cd00200		289	cd00200, WD40, WD40 domain, found in a number of e	0.004

>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment

Back alignment and domain information

 Score = 82.8 bits (205), Expect = 2e-17
 Identities = 45/219 (20%), Positives = 83/219 (37%), Gaps = 48/219 (21%)

Query: 41  SQERELEGHQGCVNAISWNSKGSLLISGSDDTHINVWSYSSRKLLHSIETGHSANVFCTK 100
              R L+GH G V  ++ ++ G+ L SGS D  I +W   + + + ++ TGH++ V    
Sbjct: 42  ELLRTLKGHTGPVRDVAASADGTYLASGSSDKTIRLWDLETGECVRTL-TGHTSYVSSVA 100

Query: 101 FVPETSDELVVSGAGDAEVRLFNLSRFSGRGLDDNAITPSALYQCHTRRVKKLAVEVGNP 160
           F P     ++ S + D  ++++++                   + HT  V  +A      
Sbjct: 101 FSP--DGRILSSSSRDKTIKVWDVETG----------KCLTTLRGHTDWVNSVAFSPDGT 148

Query: 161 HVVWSASEDGTLRQHDFRQGSSCPPAGSSHQECRNILLDLRCGAKRSLADPPKQTLSLKS 220
            V  S+S+DGT++  D R G                                  TL+  +
Sbjct: 149 FVA-SSSQDGTIKLWDLRTGK------------------------------CVATLTGHT 177

Query: 221 CDISSTRPH----LLLVGGSDAFARLYDRRMLPPLTSCQ 255
            +++S         LL   SD   +L+D      L + +
Sbjct: 178 GEVNSVAFSPDGEKLLSSSSDGTIKLWDLSTGKCLGTLR 216

Length = 289

Back alignment and domain information

>gnl\|CDD\|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|201208 pfam00400, WD40, WD domain, G-beta repeat	Back alignment and domain information

>gnl\|CDD\|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|197651 smart00320, WD40, WD40 repeats	Back alignment and domain information

>gnl\|CDD\|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only]	Back alignment and domain information

Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		693
KOG1310		758	consensus WD40 repeat protein [General function pr	100.0
KOG1334		559	consensus WD40 repeat protein [General function pr	100.0
KOG0271		480	consensus Notchless-like WD40 repeat-containing pr	100.0
KOG0272		459	consensus U4/U6 small nuclear ribonucleoprotein Pr	99.98
KOG0271		480	consensus Notchless-like WD40 repeat-containing pr	99.97
KOG0286		343	consensus G-protein beta subunit [General function	99.97
KOG0263		707	consensus Transcription initiation factor TFIID, s	99.97
KOG0272		459	consensus U4/U6 small nuclear ribonucleoprotein Pr	99.97
KOG0279		315	consensus G protein beta subunit-like protein [Sig	99.96
KOG0279		315	consensus G protein beta subunit-like protein [Sig	99.96
KOG0315		311	consensus G-protein beta subunit-like protein (con	99.95
KOG0291		893	consensus WD40-repeat-containing subunit of the 18	99.95
KOG0263		707	consensus Transcription initiation factor TFIID, s	99.95
KOG0295		406	consensus WD40 repeat-containing protein [Function	99.95
KOG0265		338	consensus U5 snRNP-specific protein-like factor an	99.95
KOG0286		343	consensus G-protein beta subunit [General function	99.95
KOG0284		464	consensus Polyadenylation factor I complex, subuni	99.95
KOG0315		311	consensus G-protein beta subunit-like protein (con	99.95
KOG0316		307	consensus Conserved WD40 repeat-containing protein	99.95
KOG0266		456	consensus WD40 repeat-containing protein [General	99.95
KOG0293		519	consensus WD40 repeat-containing protein [Function	99.94
KOG0273		524	consensus Beta-transducin family (WD-40 repeat) pr	99.94
KOG0285		460	consensus Pleiotropic regulator 1 [RNA processing	99.94
KOG0645		312	consensus WD40 repeat protein [General function pr	99.94
PTZ00421		493	coronin; Provisional	99.94
KOG0319		775	consensus WD40-repeat-containing subunit of the 18	99.94
KOG0282		503	consensus mRNA splicing factor [Function unknown]	99.94
KOG0284		464	consensus Polyadenylation factor I complex, subuni	99.94
KOG0281		499	consensus Beta-TrCP (transducin repeats containing	99.94
KOG0292		1202	consensus Vesicle coat complex COPI, alpha subunit	99.94
KOG0318		603	consensus WD40 repeat stress protein/actin interac	99.94
KOG0283		712	consensus WD40 repeat-containing protein [Function	99.93
KOG0266		456	consensus WD40 repeat-containing protein [General	99.93
KOG0277		311	consensus Peroxisomal targeting signal type 2 rece	99.93
KOG0285		460	consensus Pleiotropic regulator 1 [RNA processing	99.93
KOG0276		794	consensus Vesicle coat complex COPI, beta' subunit	99.92
KOG0291		893	consensus WD40-repeat-containing subunit of the 18	99.92
PTZ00420		568	coronin; Provisional	99.92
KOG0277		311	consensus Peroxisomal targeting signal type 2 rece	99.92
KOG0640		430	consensus mRNA cleavage stimulating factor complex	99.92
cd00200		289	WD40 WD40 domain, found in a number of eukaryotic	99.92
KOG1446		311	consensus Histone H3 (Lys4) methyltransferase comp	99.92
KOG1407		313	consensus WD40 repeat protein [Function unknown]	99.92
KOG0282		503	consensus mRNA splicing factor [Function unknown]	99.92
KOG0296		399	consensus Angio-associated migratory cell protein	99.91
KOG0645		312	consensus WD40 repeat protein [General function pr	99.91
KOG0273		524	consensus Beta-transducin family (WD-40 repeat) pr	99.91
KOG0276		794	consensus Vesicle coat complex COPI, beta' subunit	99.91
cd00200		289	WD40 WD40 domain, found in a number of eukaryotic	99.91
KOG0288		459	consensus WD40 repeat protein TipD [General functi	99.91
KOG0772		641	consensus Uncharacterized conserved protein, conta	99.91
PLN00181		793	protein SPA1-RELATED; Provisional	99.91
KOG0264		422	consensus Nucleosome remodeling factor, subunit CA	99.91
KOG0275		508	consensus Conserved WD40 repeat-containing protein	99.91
PLN00181		793	protein SPA1-RELATED; Provisional	99.9
KOG0278		334	consensus Serine/threonine kinase receptor-associa	99.9
KOG0268		433	consensus Sof1-like rRNA processing protein (conta	99.9
KOG0295		406	consensus WD40 repeat-containing protein [Function	99.9
KOG0264		422	consensus Nucleosome remodeling factor, subunit CA	99.9
KOG0647		347	consensus mRNA export protein (contains WD40 repea	99.9
KOG0281		499	consensus Beta-TrCP (transducin repeats containing	99.9
KOG0265		338	consensus U5 snRNP-specific protein-like factor an	99.89
KOG0310		487	consensus Conserved WD40 repeat-containing protein	99.89
KOG0313		423	consensus Microtubule binding protein YTM1 (contai	99.89
KOG0643		327	consensus Translation initiation factor 3, subunit	99.89
KOG0318		603	consensus WD40 repeat stress protein/actin interac	99.89
KOG1332		299	consensus Vesicle coat complex COPII, subunit SEC1	99.89
KOG0305		484	consensus Anaphase promoting complex, Cdc20, Cdh1,	99.89
KOG0973		942	consensus Histone transcription regulator HIRA, WD	99.88
KOG0294		362	consensus WD40 repeat-containing protein [Function	99.88
KOG0319		775	consensus WD40-repeat-containing subunit of the 18	99.88
KOG0293		519	consensus WD40 repeat-containing protein [Function	99.88
KOG0643		327	consensus Translation initiation factor 3, subunit	99.88
KOG0289		506	consensus mRNA splicing factor [General function p	99.88
KOG0292		1202	consensus Vesicle coat complex COPI, alpha subunit	99.88
PTZ00421		493	coronin; Provisional	99.88
PTZ00420		568	coronin; Provisional	99.88
KOG0274		537	consensus Cdc4 and related F-box and WD-40 protein	99.88
KOG0300		481	consensus WD40 repeat-containing protein [Function	99.88
KOG0310		487	consensus Conserved WD40 repeat-containing protein	99.88
KOG0313		423	consensus Microtubule binding protein YTM1 (contai	99.88
KOG0269		839	consensus WD40 repeat-containing protein [Function	99.88
KOG0302		440	consensus Ribosome Assembly protein [General funct	99.87
KOG0275		508	consensus Conserved WD40 repeat-containing protein	99.87
KOG0641		350	consensus WD40 repeat protein [General function pr	99.87
KOG0646		476	consensus WD40 repeat protein [General function pr	99.87
KOG0299		479	consensus U3 snoRNP-associated protein (contains W	99.87
KOG0316		307	consensus Conserved WD40 repeat-containing protein	99.87
KOG0553		304	consensus TPR repeat-containing protein [General f	99.87
KOG0308		735	consensus Conserved WD40 repeat-containing protein	99.87
KOG0300		481	consensus WD40 repeat-containing protein [Function	99.86
KOG4234		271	consensus TPR repeat-containing protein [General f	99.86
KOG0772		641	consensus Uncharacterized conserved protein, conta	99.86
KOG0305		484	consensus Anaphase promoting complex, Cdc20, Cdh1,	99.86
KOG0296		399	consensus Angio-associated migratory cell protein	99.86
KOG1036		323	consensus Mitotic spindle checkpoint protein BUB3,	99.86
KOG0289		506	consensus mRNA splicing factor [General function p	99.86
KOG0306		888	consensus WD40-repeat-containing subunit of the 18	99.85
KOG0308		735	consensus Conserved WD40 repeat-containing protein	99.85
KOG0288		459	consensus WD40 repeat protein TipD [General functi	99.84
KOG2445		361	consensus Nuclear pore complex component (sc Seh1)	99.84
KOG0301		745	consensus Phospholipase A2-activating protein (con	99.84
KOG4227		609	consensus WD40 repeat protein [General function pr	99.84
KOG4283		397	consensus Transcription-coupled repair protein CSA	99.84
KOG0973		942	consensus Histone transcription regulator HIRA, WD	99.84
KOG0270		463	consensus WD40 repeat-containing protein [Function	99.83
KOG0306		888	consensus WD40-repeat-containing subunit of the 18	99.83
KOG0274		537	consensus Cdc4 and related F-box and WD-40 protein	99.83
KOG1332		299	consensus Vesicle coat complex COPII, subunit SEC1	99.83
KOG0268		433	consensus Sof1-like rRNA processing protein (conta	99.83
KOG0269		839	consensus WD40 repeat-containing protein [Function	99.82
KOG0302		440	consensus Ribosome Assembly protein [General funct	99.82
KOG0267		825	consensus Microtubule severing protein katanin p80	99.82
KOG0299		479	consensus U3 snoRNP-associated protein (contains W	99.81
KOG4328		498	consensus WD40 protein [Function unknown]	99.81
KOG0267		825	consensus Microtubule severing protein katanin p80	99.81
KOG1408		1080	consensus WD40 repeat protein [Function unknown]	99.81
KOG0301		745	consensus Phospholipase A2-activating protein (con	99.81
KOG1273		405	consensus WD40 repeat protein [General function pr	99.81
KOG0641		350	consensus WD40 repeat protein [General function pr	99.81
KOG0278		334	consensus Serine/threonine kinase receptor-associa	99.8
KOG0321		720	consensus WD40 repeat-containing protein L2DTL [Fu	99.8
KOG1407		313	consensus WD40 repeat protein [Function unknown]	99.8
KOG0647		347	consensus mRNA export protein (contains WD40 repea	99.8
KOG4283		397	consensus Transcription-coupled repair protein CSA	99.8
KOG0640		430	consensus mRNA cleavage stimulating factor complex	99.79
KOG0283		712	consensus WD40 repeat-containing protein [Function	99.79
KOG2096		420	consensus WD40 repeat protein [General function pr	99.79
KOG1274		933	consensus WD40 repeat protein [General function pr	99.78
KOG0642		577	consensus Cell-cycle nuclear protein, contains WD-	99.78
KOG0270		463	consensus WD40 repeat-containing protein [Function	99.78
KOG4378		673	consensus Nuclear protein COP1 [Signal transductio	99.78
KOG0543		397	consensus FKBP-type peptidyl-prolyl cis-trans isom	99.77
KOG0321		720	consensus WD40 repeat-containing protein L2DTL [Fu	99.76
KOG1539		910	consensus WD repeat protein [General function pred	99.76
KOG1007		370	consensus WD repeat protein TSSC1, WD repeat super	99.75
KOG0307		1049	consensus Vesicle coat complex COPII, subunit SEC3	99.74
KOG0303		472	consensus Actin-binding protein Coronin, contains	99.74
KOG1036		323	consensus Mitotic spindle checkpoint protein BUB3,	99.74
KOG4648		536	consensus Uncharacterized conserved protein, conta	99.74
KOG0548		539	consensus Molecular co-chaperone STI1 [Posttransla	99.74
KOG0639		705	consensus Transducin-like enhancer of split protei	99.73
KOG0290		364	consensus Conserved WD40 repeat-containing protein	99.73
KOG1446		311	consensus Histone H3 (Lys4) methyltransferase comp	99.73
KOG0639		705	consensus Transducin-like enhancer of split protei	99.73
KOG0547		606	consensus Translocase of outer mitochondrial membr	99.72
KOG0307		1049	consensus Vesicle coat complex COPII, subunit SEC3	99.72
KOG0646		476	consensus WD40 repeat protein [General function pr	99.71
KOG4328		498	consensus WD40 protein [Function unknown]	99.7
KOG0303		472	consensus Actin-binding protein Coronin, contains	99.7
KOG0644		1113	consensus Uncharacterized conserved protein, conta	99.7
KOG1408		1080	consensus WD40 repeat protein [Function unknown]	99.7
KOG0294		362	consensus WD40 repeat-containing protein [Function	99.7
TIGR03866		300	PQQ_ABC_repeats PQQ-dependent catabolism-associate	99.7
KOG1034		385	consensus Transcriptional repressor EED/ESC/FIE, r	99.69
KOG2106		626	consensus Uncharacterized conserved protein, conta	99.69
KOG0650		733	consensus WD40 repeat nucleolar protein Bop1, invo	99.68
KOG1063		764	consensus RNA polymerase II elongator complex, sub	99.68
KOG4378		673	consensus Nuclear protein COP1 [Signal transductio	99.68
KOG1539		910	consensus WD repeat protein [General function pred	99.68
KOG1009		434	consensus Chromatin assembly complex 1 subunit B/C	99.67
KOG1273		405	consensus WD40 repeat protein [General function pr	99.66
KOG0550		486	consensus Molecular chaperone (DnaJ superfamily) [	99.66
KOG1188		376	consensus WD40 repeat protein [General function pr	99.66
KOG2055		514	consensus WD40 repeat protein [General function pr	99.66
KOG1538		1081	consensus Uncharacterized conserved protein WDR10,	99.65
KOG0551		390	consensus Hsp90 co-chaperone CNS1 (contains TPR re	99.65
KOG1063		764	consensus RNA polymerase II elongator complex, sub	99.64
KOG2048		691	consensus WD40 repeat protein [General function pr	99.64
KOG0290		364	consensus Conserved WD40 repeat-containing protein	99.64
KOG2055		514	consensus WD40 repeat protein [General function pr	99.64
KOG1188		376	consensus WD40 repeat protein [General function pr	99.63
KOG1007		370	consensus WD repeat protein TSSC1, WD repeat super	99.63
KOG2048		691	consensus WD40 repeat protein [General function pr	99.62
KOG1034		385	consensus Transcriptional repressor EED/ESC/FIE, r	99.62
KOG0376		476	consensus Serine-threonine phosphatase 2A, catalyt	99.62
KOG1274		933	consensus WD40 repeat protein [General function pr	99.61
TIGR03866		300	PQQ_ABC_repeats PQQ-dependent catabolism-associate	99.61
KOG1587		555	consensus Cytoplasmic dynein intermediate chain [C	99.61
KOG2919		406	consensus Guanine nucleotide-binding protein [Gene	99.61
KOG1524		737	consensus WD40 repeat-containing protein CHE-2 [Ge	99.6
KOG0548		539	consensus Molecular co-chaperone STI1 [Posttransla	99.59
KOG0322		323	consensus G-protein beta subunit-like protein GNB1	99.59
KOG1523		361	consensus Actin-related protein Arp2/3 complex, su	99.59
KOG1310		758	consensus WD40 repeat protein [General function pr	99.59
KOG2096		420	consensus WD40 repeat protein [General function pr	99.58
KOG0771		398	consensus Prolactin regulatory element-binding pro	99.58
KOG2919		406	consensus Guanine nucleotide-binding protein [Gene	99.57
KOG1517		1387	consensus Guanine nucleotide binding protein MIP1	99.57
KOG2445		361	consensus Nuclear pore complex component (sc Seh1)	99.56
KOG1009		434	consensus Chromatin assembly complex 1 subunit B/C	99.56
KOG1445		1012	consensus Tumor-specific antigen (contains WD repe	99.55
KOG0649		325	consensus WD40 repeat protein [General function pr	99.53
KOG2106		626	consensus Uncharacterized conserved protein, conta	99.52
KOG1240		1431	consensus Protein kinase containing WD40 repeats [	99.5
KOG1445		1012	consensus Tumor-specific antigen (contains WD repe	99.49
KOG2110		391	consensus Uncharacterized conserved protein, conta	99.48
COG2319		466	FOG: WD40 repeat [General function prediction only	99.48
KOG1517		1387	consensus Guanine nucleotide binding protein MIP1	99.47
KOG4227		609	consensus WD40 repeat protein [General function pr	99.47
PRK01742		429	tolB translocation protein TolB; Provisional	99.46
COG2319		466	FOG: WD40 repeat [General function prediction only	99.45
KOG0642		577	consensus Cell-cycle nuclear protein, contains WD-	99.45
KOG4642		284	consensus Chaperone-dependent E3 ubiquitin protein	99.45
KOG0545		329	consensus Aryl-hydrocarbon receptor-interacting pr	99.44
KOG0649		325	consensus WD40 repeat protein [General function pr	99.44
KOG1538		1081	consensus Uncharacterized conserved protein WDR10,	99.42
KOG1587		555	consensus Cytoplasmic dynein intermediate chain [C	99.41
PLN03088		356	SGT1, suppressor of G2 allele of SKP1; Provisional	99.41
KOG1523		361	consensus Actin-related protein Arp2/3 complex, su	99.41
KOG0650		733	consensus WD40 repeat nucleolar protein Bop1, invo	99.4
PRK11028		330	6-phosphogluconolactonase; Provisional	99.39
KOG0644		1113	consensus Uncharacterized conserved protein, conta	99.39
KOG2321		703	consensus WD40 repeat protein [General function pr	99.38
KOG2110		391	consensus Uncharacterized conserved protein, conta	99.36
KOG1963		792	consensus WD40 repeat protein [General function pr	99.35
KOG2139		445	consensus WD40 repeat protein [General function pr	99.32
KOG1272		545	consensus WD40-repeat-containing subunit of the 18	99.3
KOG0771		398	consensus Prolactin regulatory element-binding pro	99.3
PRK04922		433	tolB translocation protein TolB; Provisional	99.27
KOG2394		636	consensus WD40 protein DMR-N9 [General function pr	99.26
KOG2111		346	consensus Uncharacterized conserved protein, conta	99.26
KOG2139		445	consensus WD40 repeat protein [General function pr	99.26
KOG3881		412	consensus Uncharacterized conserved protein [Funct	99.26
PRK02889		427	tolB translocation protein TolB; Provisional	99.26
PRK05137		435	tolB translocation protein TolB; Provisional	99.25
KOG1354		433	consensus Serine/threonine protein phosphatase 2A,	99.25
KOG1963		792	consensus WD40 repeat protein [General function pr	99.24
PRK03629		429	tolB translocation protein TolB; Provisional	99.24
KOG0322		323	consensus G-protein beta subunit-like protein GNB1	99.23
KOG4497		447	consensus Uncharacterized conserved protein WDR8,	99.23
KOG1524		737	consensus WD40 repeat-containing protein CHE-2 [Ge	99.19
KOG1334		559	consensus WD40 repeat protein [General function pr	99.19
KOG2111		346	consensus Uncharacterized conserved protein, conta	99.18
KOG1240		1431	consensus Protein kinase containing WD40 repeats [	99.18
KOG1272		545	consensus WD40-repeat-containing subunit of the 18	99.17
PRK11028		330	6-phosphogluconolactonase; Provisional	99.16
KOG0280		339	consensus Uncharacterized conserved protein [Amino	99.14
KOG2394		636	consensus WD40 protein DMR-N9 [General function pr	99.13
PF08662		194	eIF2A: Eukaryotic translation initiation factor eI	99.12
TIGR00990		615	3a0801s09 mitochondrial precursor proteins import	99.12
PRK15359		144	type III secretion system chaperone protein SscB;	99.11
KOG0280		339	consensus Uncharacterized conserved protein [Amino	99.08
PRK01742		429	tolB translocation protein TolB; Provisional	99.08
TIGR02800		417	propeller_TolB tol-pal system beta propeller repea	99.05
KOG3881		412	consensus Uncharacterized conserved protein [Funct	99.03
KOG0974		967	consensus WD-repeat protein WDR6, WD repeat superf	99.01
PF08662		194	eIF2A: Eukaryotic translation initiation factor eI	99.01
KOG1064		2439	consensus RAVE (regulator of V-ATPase assembly) co	98.99
TIGR02552		135	LcrH_SycD type III secretion low calcium response	98.99
KOG2321		703	consensus WD40 repeat protein [General function pr	98.99
KOG1409		404	consensus Uncharacterized conserved protein, conta	98.98
PRK05137		435	tolB translocation protein TolB; Provisional	98.98
PRK04922		433	tolB translocation protein TolB; Provisional	98.97
PRK00178		430	tolB translocation protein TolB; Provisional	98.97
KOG1308		377	consensus Hsp70-interacting protein Hip/Transient	98.96
PRK15363		157	pathogenicity island 2 chaperone protein SscA; Pro	98.95
PRK04792		448	tolB translocation protein TolB; Provisional	98.93
KOG0974		967	consensus WD-repeat protein WDR6, WD repeat superf	98.93
PRK02889		427	tolB translocation protein TolB; Provisional	98.9
KOG4190		1034	consensus Uncharacterized conserved protein [Funct	98.87
PRK03629		429	tolB translocation protein TolB; Provisional	98.87
KOG4497		447	consensus Uncharacterized conserved protein WDR8,	98.85
COG5170		460	CDC55 Serine/threonine protein phosphatase 2A, reg	98.85
KOG1354		433	consensus Serine/threonine protein phosphatase 2A,	98.84
PRK01029		428	tolB translocation protein TolB; Provisional	98.82
KOG0309		1081	consensus Conserved WD40 repeat-containing protein	98.81
KOG0624		504	consensus dsRNA-activated protein kinase inhibitor	98.81
TIGR02800		417	propeller_TolB tol-pal system beta propeller repea	98.81
PRK10370		198	formate-dependent nitrite reductase complex subuni	98.81
KOG4714		319	consensus Nucleoporin [Nuclear structure]	98.77
KOG1409		404	consensus Uncharacterized conserved protein, conta	98.75
KOG0546		372	consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos	98.75
PF13414		69	TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A	98.72
KOG4547		541	consensus WD40 repeat-containing protein [General	98.72
KOG0624		504	consensus dsRNA-activated protein kinase inhibitor	98.7
KOG0550		486	consensus Molecular chaperone (DnaJ superfamily) [	98.69
PRK11189		296	lipoprotein NlpI; Provisional	98.68
PF02239		369	Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO	98.67
KOG4532		344	consensus WD40-like repeat containing protein [Gen	98.67
PF02239		369	Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO	98.66
PF10282		345	Lactonase: Lactonase, 7-bladed beta-propeller; Int	98.62
PRK00178		430	tolB translocation protein TolB; Provisional	98.6
KOG0309		1081	consensus Conserved WD40 repeat-containing protein	98.6
PF10282		345	Lactonase: Lactonase, 7-bladed beta-propeller; Int	98.59
PF00400		39	WD40: WD domain, G-beta repeat; InterPro: IPR01978	98.59
KOG3914		390	consensus WD repeat protein WDR4 [Function unknown	98.59
TIGR02795		119	tol_pal_ybgF tol-pal system protein YbgF. Members	98.58
PLN02919		1057	haloacid dehalogenase-like hydrolase family protei	98.55
KOG0882		558	consensus Cyclophilin-related peptidyl-prolyl cis-	98.54
PF13414		69	TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A	98.54
KOG2114		933	consensus Vacuolar assembly/sorting protein PEP5/V	98.53
KOG4626		966	consensus O-linked N-acetylglucosamine transferase	98.51
KOG1064		2439	consensus RAVE (regulator of V-ATPase assembly) co	98.49
KOG4555		175	consensus TPR repeat-containing protein [Function	98.48
PRK04792		448	tolB translocation protein TolB; Provisional	98.48
PRK15331		165	chaperone protein SicA; Provisional	98.47
KOG4626		966	consensus O-linked N-acetylglucosamine transferase	98.45
KOG1275		1118	consensus PAB-dependent poly(A) ribonuclease, subu	98.44
PF15492		282	Nbas_N: Neuroblastoma-amplified sequence, N termin	98.44
KOG4532		344	consensus WD40-like repeat containing protein [Gen	98.43
TIGR02658		352	TTQ_MADH_Hv methylamine dehydrogenase heavy chain.	98.39
cd00189		100	TPR Tetratricopeptide repeat domain; typically con	98.39
KOG4714		319	consensus Nucleoporin [Nuclear structure]	98.39
PLN02919		1057	haloacid dehalogenase-like hydrolase family protei	98.38
KOG2041		1189	consensus WD40 repeat protein [General function pr	98.38
KOG1832		1516	consensus HIV-1 Vpr-binding protein [Cell cycle co	98.37
COG2706		346	3-carboxymuconate cyclase [Carbohydrate transport	98.36
KOG3914		390	consensus WD repeat protein WDR4 [Function unknown	98.36
COG4946		668	Uncharacterized protein related to the periplasmic	98.35
PF12895		84	Apc3: Anaphase-promoting complex, cyclosome, subun	98.35
KOG0547		606	consensus Translocase of outer mitochondrial membr	98.35
KOG2315		566	consensus Predicted translation initiation factor	98.35
TIGR00990		615	3a0801s09 mitochondrial precursor proteins import	98.34
KOG2695		425	consensus WD40 repeat protein [General function pr	98.33
PF15492		282	Nbas_N: Neuroblastoma-amplified sequence, N termin	98.32
KOG2695		425	consensus WD40 repeat protein [General function pr	98.32
KOG4190		1034	consensus Uncharacterized conserved protein [Funct	98.32
PF13432		65	TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL	98.3
KOG4547		541	consensus WD40 repeat-containing protein [General	98.3
KOG2041		1189	consensus WD40 repeat protein [General function pr	98.29
KOG1912		1062	consensus WD40 repeat protein [General function pr	98.26
PRK09782		987	bacteriophage N4 receptor, outer membrane subunit;	98.26
COG5170		460	CDC55 Serine/threonine protein phosphatase 2A, reg	98.26
PRK15359		144	type III secretion system chaperone protein SscB;	98.23
PRK02603		172	photosystem I assembly protein Ycf3; Provisional	98.23
PF13512		142	TPR_18: Tetratricopeptide repeat	98.21
COG4235		287	Cytochrome c biogenesis factor [Posttranslational	98.21
PF13371		73	TPR_9: Tetratricopeptide repeat	98.2
TIGR03302		235	OM_YfiO outer membrane assembly lipoprotein YfiO.	98.18
KOG1645		463	consensus RING-finger-containing E3 ubiquitin liga	98.17
PF00400		39	WD40: WD domain, G-beta repeat; InterPro: IPR01978	98.16
CHL00033		168	ycf3 photosystem I assembly protein Ycf3	98.15
PRK04043		419	tolB translocation protein TolB; Provisional	98.15
PRK15179		694	Vi polysaccharide biosynthesis protein TviE; Provi	98.14
PRK10049		765	pgaA outer membrane protein PgaA; Provisional	98.14
KOG1125		579	consensus TPR repeat-containing protein [General f	98.13
PRK11189		296	lipoprotein NlpI; Provisional	98.12
TIGR02658		352	TTQ_MADH_Hv methylamine dehydrogenase heavy chain.	98.11
PRK10803		263	tol-pal system protein YbgF; Provisional	98.11
KOG4151		748	consensus Myosin assembly protein/sexual cycle pro	98.11
KOG1912		1062	consensus WD40 repeat protein [General function pr	98.1
PRK12370		553	invasion protein regulator; Provisional	98.1
KOG2066		846	consensus Vacuolar assembly/sorting protein VPS41	98.09
COG4946		668	Uncharacterized protein related to the periplasmic	98.03
PRK01029		428	tolB translocation protein TolB; Provisional	98.02
PRK12370		553	invasion protein regulator; Provisional	98.0
COG2706		346	3-carboxymuconate cyclase [Carbohydrate transport	97.98
KOG2314		698	consensus Translation initiation factor 3, subunit	97.98
PF14559		68	TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN	97.98
PF04762		928	IKI3: IKI3 family; InterPro: IPR006849 Members of	97.97
PF13525		203	YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M	97.97
PRK10866		243	outer membrane biogenesis protein BamD; Provisiona	97.96
PLN02789		320	farnesyltranstransferase	97.96
TIGR02521		234	type_IV_pilW type IV pilus biogenesis/stability pr	97.94
KOG0882		558	consensus Cyclophilin-related peptidyl-prolyl cis-	97.93
PF08450		246	SGL: SMP-30/Gluconolaconase/LRE-like region; Inter	97.93
PRK09782		987	bacteriophage N4 receptor, outer membrane subunit;	97.92
KOG4648		536	consensus Uncharacterized conserved protein, conta	97.91
PRK15174		656	Vi polysaccharide export protein VexE; Provisional	97.91
TIGR02552		135	LcrH_SycD type III secretion low calcium response	97.91
PRK15174		656	Vi polysaccharide export protein VexE; Provisional	97.9
KOG1008		783	consensus Uncharacterized conserved protein, conta	97.89
COG5354		561	Uncharacterized protein, contains Trp-Asp (WD) rep	97.89
PLN03098		453	LPA1 LOW PSII ACCUMULATION1; Provisional	97.88
KOG2315		566	consensus Predicted translation initiation factor	97.88
PF11768		545	DUF3312: Protein of unknown function (DUF3312); In	97.86
TIGR02521		234	type_IV_pilW type IV pilus biogenesis/stability pr	97.86
KOG1275		1118	consensus PAB-dependent poly(A) ribonuclease, subu	97.84
KOG1126		638	consensus DNA-binding cell division cycle control	97.84
COG5354		561	Uncharacterized protein, contains Trp-Asp (WD) rep	97.82
PF04762		928	IKI3: IKI3 family; InterPro: IPR006849 Members of	97.82
PRK15179		694	Vi polysaccharide biosynthesis protein TviE; Provi	97.8
KOG2314		698	consensus Translation initiation factor 3, subunit	97.8
KOG1008		783	consensus Uncharacterized conserved protein, conta	97.79
PRK10370		198	formate-dependent nitrite reductase complex subuni	97.79
PF07433		305	DUF1513: Protein of unknown function (DUF1513); In	97.77
PF08450		246	SGL: SMP-30/Gluconolaconase/LRE-like region; Inter	97.75
PRK04043		419	tolB translocation protein TolB; Provisional	97.74
PLN02789		320	farnesyltranstransferase	97.72
KOG1155		559	consensus Anaphase-promoting complex (APC), Cdc23	97.72
COG5010		257	TadD Flp pilus assembly protein TadD, contains TPR	97.71
PF04841		410	Vps16_N: Vps16, N-terminal region; InterPro: IPR00	97.7
PRK10049		765	pgaA outer membrane protein PgaA; Provisional	97.69
KOG1126		638	consensus DNA-binding cell division cycle control	97.69
COG3063		250	PilF Tfp pilus assembly protein PilF [Cell motilit	97.68
PRK11447		1157	cellulose synthase subunit BcsC; Provisional	97.67
PF06977		248	SdiA-regulated: SdiA-regulated; InterPro: IPR00972	97.65
PF06552		186	TOM20_plant: Plant specific mitochondrial import r	97.65
KOG4162		799	consensus Predicted calmodulin-binding protein [Si	97.64
KOG2066		846	consensus Vacuolar assembly/sorting protein VPS41	97.62
KOG1645		463	consensus RING-finger-containing E3 ubiquitin liga	97.61
PF04053		443	Coatomer_WDAD: Coatomer WD associated region ; Int	97.61
PF13431		34	TPR_17: Tetratricopeptide repeat	97.6
KOG1155		559	consensus Anaphase-promoting complex (APC), Cdc23	97.6
PRK11788		389	tetratricopeptide repeat protein; Provisional	97.58
TIGR02917		899	PEP_TPR_lipo putative PEP-CTERM system TPR-repeat	97.56
PLN03098		453	LPA1 LOW PSII ACCUMULATION1; Provisional	97.56
KOG3621		726	consensus WD40 repeat-containing protein [General	97.51
TIGR03302		235	OM_YfiO outer membrane assembly lipoprotein YfiO.	97.5
PF13371		73	TPR_9: Tetratricopeptide repeat	97.49
COG1729		262	Uncharacterized protein conserved in bacteria [Fun	97.48
smart00320		40	WD40 WD40 repeats. Note that these repeats are per	97.46
PF00515		34	TPR_1: Tetratricopeptide repeat; InterPro: IPR0014	97.44
KOG0553		304	consensus TPR repeat-containing protein [General f	97.42
cd00189		100	TPR Tetratricopeptide repeat domain; typically con	97.41
TIGR03300		377	assembly_YfgL outer membrane assembly lipoprotein	97.41
PF13429		280	TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2	97.39
PF11768		545	DUF3312: Protein of unknown function (DUF3312); In	97.39
TIGR02917		899	PEP_TPR_lipo putative PEP-CTERM system TPR-repeat	97.39
KOG1832		1516	consensus HIV-1 Vpr-binding protein [Cell cycle co	97.38
PF13432		65	TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL	97.36
PRK11447		1157	cellulose synthase subunit BcsC; Provisional	97.36
PF12968		144	DUF3856: Domain of Unknown Function (DUF3856); Int	97.36
PRK11788		389	tetratricopeptide repeat protein; Provisional	97.33
PRK11906		458	transcriptional regulator; Provisional	97.33
KOG1173		611	consensus Anaphase-promoting complex (APC), Cdc16	97.32
PRK10153		517	DNA-binding transcriptional activator CadC; Provis	97.31
PF15015		569	NYD-SP12_N: Spermatogenesis-associated, N-terminal	97.3
COG3063		250	PilF Tfp pilus assembly protein PilF [Cell motilit	97.27
PF13360		238	PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A	97.26
PLN03088		356	SGT1, suppressor of G2 allele of SKP1; Provisional	97.25
PF07719		34	TPR_2: Tetratricopeptide repeat; InterPro: IPR0131	97.22
CHL00033		168	ycf3 photosystem I assembly protein Ycf3	97.22
COG4783		484	Putative Zn-dependent protease, contains TPR repea	97.21
COG2956		389	Predicted N-acetylglucosaminyl transferase [Carboh	97.2
TIGR02795		119	tol_pal_ybgF tol-pal system protein YbgF. Members	97.18
PF07433		305	DUF1513: Protein of unknown function (DUF1513); In	97.17
KOG1920		1265	consensus IkappaB kinase complex, IKAP component [	97.16
PF14853		53	Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe	97.15
KOG2076		895	consensus RNA polymerase III transcription factor	97.12
KOG2114		933	consensus Vacuolar assembly/sorting protein PEP5/V	97.12
TIGR03300		377	assembly_YfgL outer membrane assembly lipoprotein	97.1
KOG3617		1416	consensus WD40 and TPR repeat-containing protein [	97.09
COG4785		297	NlpI Lipoprotein NlpI, contains TPR repeats [Gener	97.09
PF14559		68	TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN	97.09
PF09976		145	TPR_21: Tetratricopeptide repeat; InterPro: IPR018	97.07
PF13424		78	TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15	97.03
PRK14574		822	hmsH outer membrane protein; Provisional	97.03
PF09295		395	ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter	97.0
COG4783		484	Putative Zn-dependent protease, contains TPR repea	96.98
PF03704		146	BTAD: Bacterial transcriptional activator domain;	96.95
PF14783		111	BBS2_Mid: Ciliary BBSome complex subunit 2, middle	96.95
PRK02603		172	photosystem I assembly protein Ycf3; Provisional	96.93
COG3204		316	Uncharacterized protein conserved in bacteria [Fun	96.91
KOG3617		1416	consensus WD40 and TPR repeat-containing protein [	96.9
PF08553		794	VID27: VID27 cytoplasmic protein; InterPro: IPR013	96.88
KOG2076		895	consensus RNA polymerase III transcription factor	96.85
PF00515		34	TPR_1: Tetratricopeptide repeat; InterPro: IPR0014	96.84
PF13360		238	PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A	96.84
cd05804		355	StaR_like StaR_like; a well-conserved protein foun	96.82
KOG2003		840	consensus TPR repeat-containing protein [General f	96.82
PF14783		111	BBS2_Mid: Ciliary BBSome complex subunit 2, middle	96.81
PF13429		280	TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2	96.77
KOG3060		289	consensus Uncharacterized conserved protein [Funct	96.71
PF13428		44	TPR_14: Tetratricopeptide repeat	96.68
PRK14574		822	hmsH outer membrane protein; Provisional	96.66
KOG4640		665	consensus Anaphase-promoting complex (APC), subuni	96.64
KOG2002		1018	consensus TPR-containing nuclear phosphoprotein th	96.64
PF12688		120	TPR_5: Tetratrico peptide repeat	96.63
PF08596		395	Lgl_C: Lethal giant larvae(Lgl) like, C-terminal;	96.59
cd05804		355	StaR_like StaR_like; a well-conserved protein foun	96.54
smart00320		40	WD40 WD40 repeats. Note that these repeats are per	96.49
PRK15363		157	pathogenicity island 2 chaperone protein SscA; Pro	96.48
PF14938		282	SNAP: Soluble NSF attachment protein, SNAP; PDB: 1	96.47
KOG0543		397	consensus FKBP-type peptidyl-prolyl cis-trans isom	96.45
KOG1174		564	consensus Anaphase-promoting complex (APC), subuni	96.45
PRK14720		906	transcript cleavage factor/unknown domain fusion p	96.44
COG5010		257	TadD Flp pilus assembly protein TadD, contains TPR	96.43
KOG1920		1265	consensus IkappaB kinase complex, IKAP component [	96.34
COG4105		254	ComL DNA uptake lipoprotein [General function pred	96.28
PF13181		34	TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_	96.24
PF03178		321	CPSF_A: CPSF A subunit region; InterPro: IPR004871	96.23
PRK10803		263	tol-pal system protein YbgF; Provisional	96.22
PRK02888		635	nitrous-oxide reductase; Validated	96.22
KOG4649		354	consensus PQQ (pyrrolo-quinoline quinone) repeat p	96.16
KOG1128		777	consensus Uncharacterized conserved protein, conta	96.14
PF09976		145	TPR_21: Tetratricopeptide repeat; InterPro: IPR018	96.09
PF08553		794	VID27: VID27 cytoplasmic protein; InterPro: IPR013	96.07
PRK11138		394	outer membrane biogenesis protein BamB; Provisiona	96.07
PRK11138		394	outer membrane biogenesis protein BamB; Provisiona	96.03
KOG1128		777	consensus Uncharacterized conserved protein, conta	96.01
KOG1174		564	consensus Anaphase-promoting complex (APC), subuni	95.96
KOG1840		508	consensus Kinesin light chain [Cytoskeleton]	95.95
PRK02888		635	nitrous-oxide reductase; Validated	95.91
PF03178		321	CPSF_A: CPSF A subunit region; InterPro: IPR004871	95.89
KOG2002		1018	consensus TPR-containing nuclear phosphoprotein th	95.83
PF13174		33	TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_	95.82
PRK10747		398	putative protoheme IX biogenesis protein; Provisio	95.78
KOG4234		271	consensus TPR repeat-containing protein [General f	95.77
PRK11906		458	transcriptional regulator; Provisional	95.76
PF13424		78	TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15	95.76
KOG4640		665	consensus Anaphase-promoting complex (APC), subuni	95.73
COG0823		425	TolB Periplasmic component of the Tol biopolymer t	95.72
PF12895		84	Apc3: Anaphase-promoting complex, cyclosome, subun	95.71
KOG3621		726	consensus WD40 repeat-containing protein [General	95.71
KOG2003		840	consensus TPR repeat-containing protein [General f	95.64
COG3391		381	Uncharacterized conserved protein [Function unknow	95.61
PRK10941		269	hypothetical protein; Provisional	95.6
TIGR00540		409	hemY_coli hemY protein. This is an uncharacterized	95.6

>KOG1310 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

Probab=100.00  E-value=2.3e-101  Score=791.54  Aligned_cols=653  Identities=37%  Similarity=0.510  Sum_probs=551.2

Q ss_pred             CCCCCCcCcchhhhhcccccCCCCCcCcccccchhhhcccceeEEeccCCCcEEEEEECCCCCEEEEEeCCCcEEEEECC
Q 005506            1 MENFPFHDGSIYDMLDTRHTDTRPDVNHSLQMHSSLVRRLSQERELEGHQGCVNAISWNSKGSLLISGSDDTHINVWSYS   80 (693)
Q Consensus         1 ~~~~~~~~~~~~~~~~~r~~~~~~~~~~~l~~~~~~i~~l~~~~~l~gH~~~V~~l~~s~~g~~LaSgs~Dg~I~IWd~~   80 (693)
                      |++..|.+++|.+.|..|...+.....+...+.+.+++++.++++|+||+|||+||+|+.+|.+|+|||+|..+.|||+.
T Consensus         1 M~~vs~s~~~i~rql~~r~~~~~h~~rq~y~~~s~~lrrL~lE~eL~GH~GCVN~LeWn~dG~lL~SGSDD~r~ivWd~~   80 (758)
T KOG1310|consen    1 MSGVSLSDGNILRQLDYRDAFQLHISRQIYMGNSTWLRRLDLEAELTGHTGCVNCLEWNADGELLASGSDDTRLIVWDPF   80 (758)
T ss_pred             CCceeccchhHhhhccccccchhhhHHHHhccccHHHhhcchhhhhccccceecceeecCCCCEEeecCCcceEEeecch
Confidence            78899999999999999887766555554558899999999999999999999999999999999999999999999999


Q ss_pred             CCcEEEEeccCCCcceEEEEEeeCCCCCEEEEEeCCCcEEEEEcCCCCCCCCCCCCCCCceeeccCCCCeEEEEEecCCC
Q 005506           81 SRKLLHSIETGHSANVFCTKFVPETSDELVVSGAGDAEVRLFNLSRFSGRGLDDNAITPSALYQCHTRRVKKLAVEVGNP  160 (693)
Q Consensus        81 ~~~~~~~l~~~h~~~I~sv~f~p~~~~~~l~sgs~Dg~V~vwdl~~~~~~~~~~~~~~~~~~~~~h~~~V~~la~sp~~~  160 (693)
                      ..++++.+.++|.++|+|++|.|.+++.+++||+.|..|++||+...++...+.+...+...+.+|..+|+.|+..|.+|
T Consensus        81 ~~KllhsI~TgHtaNIFsvKFvP~tnnriv~sgAgDk~i~lfdl~~~~~~~~d~~~~~~~~~~~cht~rVKria~~p~~P  160 (758)
T KOG1310|consen   81 EYKLLHSISTGHTANIFSVKFVPYTNNRIVLSGAGDKLIKLFDLDSSKEGGMDHGMEETTRCWSCHTDRVKRIATAPNGP  160 (758)
T ss_pred             hcceeeeeecccccceeEEeeeccCCCeEEEeccCcceEEEEecccccccccccCccchhhhhhhhhhhhhheecCCCCC
Confidence            99999999999999999999999998899999999999999999988888888888889999999999999999999999


Q ss_pred             cEEEEEeCCCcEEEEeCCCCCCCCCCCCCCcccceEEEeccCCceeeecCCCCCccceEEEEEcCCCCcEEEEEeCCCcE
Q 005506          161 HVVWSASEDGTLRQHDFRQGSSCPPAGSSHQECRNILLDLRCGAKRSLADPPKQTLSLKSCDISSTRPHLLLVGGSDAFA  240 (693)
Q Consensus       161 ~~l~Sgs~Dg~V~lwDlr~~~~~~~~~~~~~~~~~~l~~~~~~~~~~l~~~~~~~~~v~sl~~sp~~~~~Latgs~Dg~I  240 (693)
                      +.||++++||+|+++|+|.++.|++....+..+.+...+               ....+|++++|.++.+|++|+.|..+
T Consensus       161 htfwsasEDGtirQyDiREph~c~p~~~~~~~l~ny~~~---------------lielk~ltisp~rp~~laVGgsdpfa  225 (758)
T KOG1310|consen  161 HTFWSASEDGTIRQYDIREPHVCNPDEDCPSILVNYNPQ---------------LIELKCLTISPSRPYYLAVGGSDPFA  225 (758)
T ss_pred             ceEEEecCCcceeeecccCCccCCccccccHHHHHhchh---------------hheeeeeeecCCCCceEEecCCCchh
Confidence            999999999999999999999887666555555444322               35789999999999999999999999


Q ss_pred             EEEec-CCCCCCcccccCCCCC----CcccccccCccc-cCCC-Cc--cceEEEEEcCCCCEEEEEecCCcEEEEECCCC
Q 005506          241 RLYDR-RMLPPLTSCQKRMSPP----PCVNYFCPMHLS-EHGR-SS--LHLTHVTFSPNGEEVLLSYSGEHVYLMDVNHA  311 (693)
Q Consensus       241 riwD~-r~~~~~~~~~~~~~~~----~~~~~~~~~~~~-~~~~-~~--~~V~~v~fspdg~~L~sgs~Dg~V~lwdl~~~  311 (693)
                      ++||+ ++.++...-...+.++    .|+++|+|+|+. ..+. ..  .-++.++|+|+|..|+++.+..+||+||++.+
T Consensus       226 rLYD~Rr~lks~~s~~~~~~~pp~~~~cv~yf~p~hlkn~~gn~~~~~~~~t~vtfnpNGtElLvs~~gEhVYlfdvn~~  305 (758)
T KOG1310|consen  226 RLYDRRRVLKSFRSDGTMNTCPPKDCRCVRYFSPGHLKNSQGNLDRYITCCTYVTFNPNGTELLVSWGGEHVYLFDVNED  305 (758)
T ss_pred             hhhhhhhhccCCCCCccccCCCCcccchhheecCccccCcccccccceeeeEEEEECCCCcEEEEeeCCeEEEEEeecCC
Confidence            99994 4555555444433333    499999999993 3331 11  12688999999999999999999999999996


Q ss_pred             CcceEEeecC-----CCce-eEEec-c--CCCcccccCC--cccccccccccccc------cccCcchhhhHHHHHHhhh
Q 005506          312 GGRAMRYTVG-----DASK-IMSFT-P--TLNGLELQPP--IHDFLQTNIRVRGE------VATGLGKCRMLVEIARNSL  374 (693)
Q Consensus       312 ~~~~~~~~~~-----~~~~-~~~~~-p--~~~g~~~~~~--~~~~~~~~~~~~~~------~~~~~~~a~~lk~~gn~~~  374 (693)
                      +.+...+.+-     .+.. ...|. |  ..+.+....+  ......++.++.++      ....++.++..+++||..|
T Consensus       306 ~~~~~y~~~~~~~~~~~~~~~~lfT~~~~~sN~lh~~en~~~~~tP~sr~hrsp~~a~~~~~~eL~e~ie~~~~egnd~l  385 (758)
T KOG1310|consen  306 KSPTPYFLPIEDSNKKPSKPSLLFTQPLKRSNYLHWYENNFGASTPASRVHRSPYTAAQPRFYELPENIEKFKTEGNDGL  385 (758)
T ss_pred             CCceeecCcccccccCCCCcchhhccccccccccccccCCccccCCccccccCcccccccchhhchHHHHHHHhhccchh
Confidence            6444333320     0100 00111 0  0111111111  01111222222211      3457788899999999999


Q ss_pred             hcCCChhHHHHhhHHHHhcccCCCCCcchhhhhhhHHHHHHhccccCcHHHHHHhHhHhhccCCCCcchhhhHHHHHHHh
Q 005506          375 EEGKHPYYGIEACNEVLEGHLSGIGPMLRHECLCIRAALLLKRKWKNDAQMAIRDCYNARRIDSSSFRAHLYMSEALEQL  454 (693)
Q Consensus       375 ~~g~~y~~Ai~~Y~~ai~~~~~~~~~~~~~~~~~NRA~~~lk~~~~~d~~~Al~Dc~~Al~l~p~~~KA~~r~a~al~~l  454 (693)
                      ..+. +..||..|+++|++.|..      +.||.|||+++|||+|.||.++|++||..||++||.+.|||||+++||.+|
T Consensus       386 y~~~-~~~~i~~~s~a~q~~~~~------~~~l~nraa~lmkRkW~~d~~~AlrDch~Alrln~s~~kah~~la~aL~el  458 (758)
T KOG1310|consen  386 YESI-VSGAISHYSRAIQYVPDA------IYLLENRAAALMKRKWRGDSYLALRDCHVALRLNPSIQKAHFRLARALNEL  458 (758)
T ss_pred             hhHH-HHHHHHHHHHHhhhccch------hHHHHhHHHHHHhhhccccHHHHHHhHHhhccCChHHHHHHHHHHHHHHHH
Confidence            9999 999999999999998776      789999999999999999999999999999999999999999999999999


Q ss_pred             ccHHHHHHHHHHHcccCCCCchhHHHHHHHHHHHHHHHHhhcccCCCCCCCCCCCCCcccccchhhhccccCCCCCCCCC
Q 005506          455 CKYKEALDFAIAAQCLDPSNSVMAEKVENIKKHIAAAETEKNNKANDGGARSEPRTGRVLSLSDIIYRSEANSDASQDGP  534 (693)
Q Consensus       455 ~~~~eA~~~~~~~~~~~p~~~~~~~~~~~l~~~i~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~  534 (693)
                      +++.||+++..+++..+|.+.+.+..+..+.++|++|.+++.+..-.+.+       ||.+.++++.|.+...+.+.+-.
T Consensus       459 ~r~~eal~~~~alq~~~Ptd~a~~~~v~~l~rDi~aa~~~~~~e~~~~~~-------ri~t~~~~~~r~~~~~~~~~~~~  531 (758)
T KOG1310|consen  459 TRYLEALSCHWALQMSFPTDVARQNFVLCLPRDISAALFSNPSEMIRAFA-------RIDTDLSSVRRFFWIHKVLRGCL  531 (758)
T ss_pred             hhHHHhhhhHHHHhhcCchhhhhhhhhhccccchHHHhccCchhhhhhhh-------eeccchhhhhhhhhhhhhhhhhh
Confidence            99999999999999999998888889999999999999887765543333       99999999999999999888888


Q ss_pred             CCCCCCCCchhhhhhcccCCCCCCCCCccccccccCCcceeecccCCCcccccccCCCCCCCCCCCCCCCCCCCCccccc
Q 005506          535 RSEREDSDYDEEVEVDFHTSVPGDEGRDVEANFLHGSLNVRIHRRGDSARETVDANGSSGSPSSSSQNDRIPYQPETVID  614 (693)
Q Consensus       535 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  614 (693)
                      +.+++|+++|+|.++|.+++..+++.|+.|+|-+.++|++++++-++..+-..+...+.....|+..+|+..|+++.+.|
T Consensus       532 ~l~s~d~~~e~e~p~d~qts~vds~~R~dd~n~~~~~l~~~v~~~~~~~~~~~~~~~~~~~~~ssl~nDe~dyq~E~syd  611 (758)
T KOG1310|consen  532 LLISSDIYWEQEQPWDSQTSDVDSSQRLDDENGFLTLLEPPVNYENEVESSSGENIVSMYTGHSSLNNDEDDYQDEESYD  611 (758)
T ss_pred             hhhcccccccccCCCCCCceeccccccccccccccccccCccccccccccccccccccccccccccccchhhcccchhhh
Confidence            89999999999999999999999999999999999999999999999865555555554444555589999999999999


Q ss_pred             cccccccccccccCceeeeeecCCCCEEEeccCCCcEEEEecCccceeeeeecCCee-eeeecccccch
Q 005506          615 MKQRYVGHCNVGTDIKQASFLGQRGDYIASGSDDGRWFIWEKQTGRLIKMLLGDEAG-NVISSMEECGL  682 (693)
Q Consensus       615 ~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~gs~~~~~~~w~~~~~~~~~~~~~~~~~-~~~~~~~~~~~  682 (693)
                      |.+||+||||++||||||||||.+||||+||||||++|||++.||+|+.++.||+++ ||||---.|-.
T Consensus       612 y~~rYvGHCNv~TDIKeanFlGqrgeyiasgSddgr~fiwek~tg~i~av~~gdssivnciqghP~~~~  680 (758)
T KOG1310|consen  612 YASRYVGHCNVTTDIKEANFLGQRGEYIASGSDDGRFFIWEKLTGSILAVIHGDSSIVNCIQGHPRCPT  680 (758)
T ss_pred             HHhhhccccccccccccccccccCCCeeeEecCCCceEEeecCCcceEEEeeCchhheeeccCCCCCce
Confidence            999999999999999999999999999999999999999999999999999999965 99997766643

>KOG1334 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0286 consensus G-protein beta subunit [General function prediction only]	Back alignment and domain information

>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription]	Back alignment and domain information

>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms]	Back alignment and domain information

>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms]	Back alignment and domain information

>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only]	Back alignment and domain information

>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription]	Back alignment and domain information

>KOG0295 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification]	Back alignment and domain information

>KOG0286 consensus G-protein beta subunit [General function prediction only]	Back alignment and domain information

>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification]	Back alignment and domain information

>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only]	Back alignment and domain information

>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0266 consensus WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG0293 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics]	Back alignment and domain information

>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification]	Back alignment and domain information

>KOG0645 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PTZ00421 coronin; Provisional	Back alignment and domain information

>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0282 consensus mRNA splicing factor [Function unknown]	Back alignment and domain information

>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification]	Back alignment and domain information

>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown]	Back alignment and domain information

>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton]	Back alignment and domain information

>KOG0283 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0266 consensus WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification]	Back alignment and domain information

>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>PTZ00420 coronin; Provisional	Back alignment and domain information

>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification]	Back alignment and domain information

>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto

Back alignment and domain information

>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1407 consensus WD40 repeat protein [Function unknown]	Back alignment and domain information

>KOG0282 consensus mRNA splicing factor [Function unknown]	Back alignment and domain information

>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown]	Back alignment and domain information

>KOG0645 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics]	Back alignment and domain information

>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

Back alignment and domain information

>KOG0288 consensus WD40 repeat protein TipD [General function prediction only]	Back alignment and domain information

>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown]	Back alignment and domain information

>PLN00181 protein SPA1-RELATED; Provisional	Back alignment and domain information

>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics]	Back alignment and domain information

>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>PLN00181 protein SPA1-RELATED; Provisional	Back alignment and domain information

>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism]	Back alignment and domain information

>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG0295 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics]	Back alignment and domain information

>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown]	Back alignment and domain information

>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification]	Back alignment and domain information

>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms]	Back alignment and domain information

>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton]	Back alignment and domain information

>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription]	Back alignment and domain information

>KOG0294 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0293 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms]	Back alignment and domain information

>KOG0289 consensus mRNA splicing factor [General function prediction only]	Back alignment and domain information

>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PTZ00421 coronin; Provisional	Back alignment and domain information

>PTZ00420 coronin; Provisional	Back alignment and domain information

>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only]	Back alignment and domain information

>KOG0300 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0269 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0302 consensus Ribosome Assembly protein [General function prediction only]	Back alignment and domain information

>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG0641 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0646 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0553 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0300 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG4234 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown]	Back alignment and domain information

>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown]	Back alignment and domain information

>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0289 consensus mRNA splicing factor [General function prediction only]	Back alignment and domain information

>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0288 consensus WD40 repeat protein TipD [General function prediction only]	Back alignment and domain information

>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism]	Back alignment and domain information

>KOG4227 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair]	Back alignment and domain information

>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription]	Back alignment and domain information

>KOG0270 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only]	Back alignment and domain information

>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG0269 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0302 consensus Ribosome Assembly protein [General function prediction only]	Back alignment and domain information

>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG4328 consensus WD40 protein [Function unknown]	Back alignment and domain information

>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG1408 consensus WD40 repeat protein [Function unknown]	Back alignment and domain information

>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism]	Back alignment and domain information

>KOG1273 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0641 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism]	Back alignment and domain information

>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown]	Back alignment and domain information

>KOG1407 consensus WD40 repeat protein [Function unknown]	Back alignment and domain information

>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification]	Back alignment and domain information

>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair]	Back alignment and domain information

>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification]	Back alignment and domain information

>KOG0283 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG2096 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1274 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0270 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown]	Back alignment and domain information

>KOG1539 consensus WD repeat protein [General function prediction only]	Back alignment and domain information

>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown]	Back alignment and domain information

>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton]	Back alignment and domain information

>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown]	Back alignment and domain information

>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics]	Back alignment and domain information

>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown]	Back alignment and domain information

>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics]	Back alignment and domain information

>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0646 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG4328 consensus WD40 protein [Function unknown]	Back alignment and domain information

>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton]	Back alignment and domain information

>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only]	Back alignment and domain information

>KOG1408 consensus WD40 repeat protein [Function unknown]	Back alignment and domain information

>KOG0294 consensus WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein	Back alignment and domain information

>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription]	Back alignment and domain information

>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown]	Back alignment and domain information

>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription]	Back alignment and domain information

>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG1539 consensus WD repeat protein [General function prediction only]	Back alignment and domain information

>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair]	Back alignment and domain information

>KOG1273 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1188 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG2055 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only]	Back alignment and domain information

>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription]	Back alignment and domain information

>KOG2048 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown]	Back alignment and domain information

>KOG2055 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1188 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown]	Back alignment and domain information

>KOG2048 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription]	Back alignment and domain information

>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only]	Back alignment and domain information

>KOG1274 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein	Back alignment and domain information

>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton]	Back alignment and domain information

>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only]	Back alignment and domain information

>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only]	Back alignment and domain information

>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only]	Back alignment and domain information

>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton]	Back alignment and domain information

>KOG1310 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG2096 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only]	Back alignment and domain information

>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair]	Back alignment and domain information

>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton]	Back alignment and domain information

>KOG0649 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown]	Back alignment and domain information

>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms]	Back alignment and domain information

>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton]	Back alignment and domain information

>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown]	Back alignment and domain information

>COG2319 FOG: WD40 repeat [General function prediction only]	Back alignment and domain information

>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG4227 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PRK01742 tolB translocation protein TolB; Provisional	Back alignment and domain information

>COG2319 FOG: WD40 repeat [General function prediction only]	Back alignment and domain information

>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0649 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only]	Back alignment and domain information

>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton]	Back alignment and domain information

>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional	Back alignment and domain information

>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton]	Back alignment and domain information

>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK11028 6-phosphogluconolactonase; Provisional	Back alignment and domain information

>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only]	Back alignment and domain information

>KOG2321 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown]	Back alignment and domain information

>KOG1963 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG2139 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK04922 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only]	Back alignment and domain information

>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown]	Back alignment and domain information

>KOG2139 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG3881 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK02889 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK05137 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms]	Back alignment and domain information

>KOG1963 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PRK03629 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only]	Back alignment and domain information

>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only]	Back alignment and domain information

>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only]	Back alignment and domain information

>KOG1334 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown]	Back alignment and domain information

>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms]	Back alignment and domain information

>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification]	Back alignment and domain information

>PRK11028 6-phosphogluconolactonase; Provisional	Back alignment and domain information

>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism]	Back alignment and domain information

>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only]	Back alignment and domain information

>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins	Back alignment and domain information

>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70)	Back alignment and domain information

>PRK15359 type III secretion system chaperone protein SscB; Provisional	Back alignment and domain information

>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism]	Back alignment and domain information

>PRK01742 tolB translocation protein TolB; Provisional	Back alignment and domain information

>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB	Back alignment and domain information

>KOG3881 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only]	Back alignment and domain information

>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins	Back alignment and domain information

>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only]	Back alignment and domain information

>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD	Back alignment and domain information

>KOG2321 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown]	Back alignment and domain information

>PRK05137 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK04922 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK00178 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional	Back alignment and domain information

>PRK04792 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only]	Back alignment and domain information

>PRK02889 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG4190 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK03629 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only]	Back alignment and domain information

>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms]	Back alignment and domain information

>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms]	Back alignment and domain information

>PRK01029 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms]	Back alignment and domain information

>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB	Back alignment and domain information

>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional	Back alignment and domain information

>KOG4714 consensus Nucleoporin [Nuclear structure]	Back alignment and domain information

>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown]	Back alignment and domain information

>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A	Back alignment and domain information

>KOG4547 consensus WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms]	Back alignment and domain information

>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK11189 lipoprotein NlpI; Provisional	Back alignment and domain information

>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A	Back alignment and domain information

>KOG4532 consensus WD40-like repeat containing protein [General function prediction only]	Back alignment and domain information

>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A	Back alignment and domain information

>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3	Back alignment and domain information

>PRK00178 tolB translocation protein TolB; Provisional	Back alignment and domain information

>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3	Back alignment and domain information

>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide	Back alignment and domain information

>KOG3914 consensus WD repeat protein WDR4 [Function unknown]	Back alignment and domain information

>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF	Back alignment and domain information

>PLN02919 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A	Back alignment and domain information

>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only]	Back alignment and domain information

>KOG4555 consensus TPR repeat-containing protein [Function unknown]	Back alignment and domain information

>PRK04792 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK15331 chaperone protein SicA; Provisional	Back alignment and domain information

>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms]	Back alignment and domain information

>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair]	Back alignment and domain information

>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal	Back alignment and domain information

>KOG4532 consensus WD40-like repeat containing protein [General function prediction only]	Back alignment and domain information

>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain	Back alignment and domain information

>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C

Back alignment and domain information

>KOG4714 consensus Nucleoporin [Nuclear structure]	Back alignment and domain information

>PLN02919 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>KOG2041 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism]	Back alignment and domain information

>KOG3914 consensus WD repeat protein WDR4 [Function unknown]	Back alignment and domain information

>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown]	Back alignment and domain information

>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A	Back alignment and domain information

>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70)	Back alignment and domain information

>KOG2695 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal	Back alignment and domain information

>KOG2695 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG4190 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B	Back alignment and domain information

>KOG4547 consensus WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG2041 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>KOG1912 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional	Back alignment and domain information

>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms]	Back alignment and domain information

>PRK15359 type III secretion system chaperone protein SscB; Provisional	Back alignment and domain information

>PRK02603 photosystem I assembly protein Ycf3; Provisional	Back alignment and domain information

>PF13512 TPR_18: Tetratricopeptide repeat	Back alignment and domain information

>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13371 TPR_9: Tetratricopeptide repeat	Back alignment and domain information

>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO	Back alignment and domain information

>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide	Back alignment and domain information

>CHL00033 ycf3 photosystem I assembly protein Ycf3	Back alignment and domain information

>PRK04043 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional	Back alignment and domain information

>PRK10049 pgaA outer membrane protein PgaA; Provisional	Back alignment and domain information

>KOG1125 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>PRK11189 lipoprotein NlpI; Provisional	Back alignment and domain information

>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain	Back alignment and domain information

>PRK10803 tol-pal system protein YbgF; Provisional	Back alignment and domain information

>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG1912 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PRK12370 invasion protein regulator; Provisional	Back alignment and domain information

>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown]	Back alignment and domain information

>PRK01029 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK12370 invasion protein regulator; Provisional	Back alignment and domain information

>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism]	Back alignment and domain information

>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A	Back alignment and domain information

>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation []	Back alignment and domain information

>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A	Back alignment and domain information

>PRK10866 outer membrane biogenesis protein BamD; Provisional	Back alignment and domain information

>PLN02789 farnesyltranstransferase	Back alignment and domain information

>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW	Back alignment and domain information

>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species	Back alignment and domain information

>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional	Back alignment and domain information

>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown]	Back alignment and domain information

>PRK15174 Vi polysaccharide export protein VexE; Provisional	Back alignment and domain information

>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD	Back alignment and domain information

>PRK15174 Vi polysaccharide export protein VexE; Provisional	Back alignment and domain information

>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown]	Back alignment and domain information

>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only]	Back alignment and domain information

>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional	Back alignment and domain information

>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats	Back alignment and domain information

>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW	Back alignment and domain information

>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair]	Back alignment and domain information

>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only]	Back alignment and domain information

>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation []	Back alignment and domain information

>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional	Back alignment and domain information

>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown]	Back alignment and domain information

>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional	Back alignment and domain information

>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function	Back alignment and domain information

>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species	Back alignment and domain information

>PRK04043 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PLN02789 farnesyltranstransferase	Back alignment and domain information

>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion]	Back alignment and domain information

>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex	Back alignment and domain information

>PRK10049 pgaA outer membrane protein PgaA; Provisional	Back alignment and domain information

>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>PRK11447 cellulose synthase subunit BcsC; Provisional	Back alignment and domain information

>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators []	Back alignment and domain information

>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins	Back alignment and domain information

>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms]	Back alignment and domain information

>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>PF13431 TPR_17: Tetratricopeptide repeat	Back alignment and domain information

>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK11788 tetratricopeptide repeat protein; Provisional	Back alignment and domain information

>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein	Back alignment and domain information

>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional	Back alignment and domain information

>KOG3621 consensus WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO	Back alignment and domain information

>PF13371 TPR_9: Tetratricopeptide repeat	Back alignment and domain information

>COG1729 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>smart00320 WD40 WD40 repeats	Back alignment and domain information

>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ]	Back alignment and domain information

>KOG0553 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

Back alignment and domain information

>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL	Back alignment and domain information

>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B	Back alignment and domain information

>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats	Back alignment and domain information

>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein	Back alignment and domain information

>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B	Back alignment and domain information

>PRK11447 cellulose synthase subunit BcsC; Provisional	Back alignment and domain information

>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT	Back alignment and domain information

>PRK11788 tetratricopeptide repeat protein; Provisional	Back alignment and domain information

>PRK11906 transcriptional regulator; Provisional	Back alignment and domain information

>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK10153 DNA-binding transcriptional activator CadC; Provisional	Back alignment and domain information

>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal	Back alignment and domain information

>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A	Back alignment and domain information

>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional	Back alignment and domain information

>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ]	Back alignment and domain information

>CHL00033 ycf3 photosystem I assembly protein Ycf3	Back alignment and domain information

>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only]	Back alignment and domain information

>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism]	Back alignment and domain information

>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF	Back alignment and domain information

>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function	Back alignment and domain information

>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription]	Back alignment and domain information

>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A	Back alignment and domain information

>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription]	Back alignment and domain information

>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL	Back alignment and domain information

>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only]	Back alignment and domain information

>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A	Back alignment and domain information

>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function	Back alignment and domain information

>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H	Back alignment and domain information

>PRK14574 hmsH outer membrane protein; Provisional	Back alignment and domain information

>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi	Back alignment and domain information

>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only]	Back alignment and domain information

>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production	Back alignment and domain information

>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region	Back alignment and domain information

>PRK02603 photosystem I assembly protein Ycf3; Provisional	Back alignment and domain information

>COG3204 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins	Back alignment and domain information

>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription]	Back alignment and domain information

>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ]	Back alignment and domain information

>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A	Back alignment and domain information

>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals	Back alignment and domain information

>KOG2003 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region	Back alignment and domain information

>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B	Back alignment and domain information

>KOG3060 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF13428 TPR_14: Tetratricopeptide repeat	Back alignment and domain information

>PRK14574 hmsH outer membrane protein; Provisional	Back alignment and domain information

>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism]	Back alignment and domain information

>PF12688 TPR_5: Tetratrico peptide repeat	Back alignment and domain information

>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals	Back alignment and domain information

>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals	Back alignment and domain information

>smart00320 WD40 WD40 repeats	Back alignment and domain information

>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional	Back alignment and domain information

>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A	Back alignment and domain information

>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional	Back alignment and domain information

>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion]	Back alignment and domain information

>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription]	Back alignment and domain information

>COG4105 ComL DNA uptake lipoprotein [General function prediction only]	Back alignment and domain information

>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A	Back alignment and domain information

>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit	Back alignment and domain information

>PRK10803 tol-pal system protein YbgF; Provisional	Back alignment and domain information

>PRK02888 nitrous-oxide reductase; Validated	Back alignment and domain information

>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only]	Back alignment and domain information

>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function	Back alignment and domain information

>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins	Back alignment and domain information

>PRK11138 outer membrane biogenesis protein BamB; Provisional	Back alignment and domain information

>PRK11138 outer membrane biogenesis protein BamB; Provisional	Back alignment and domain information

>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only]	Back alignment and domain information

>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1840 consensus Kinesin light chain [Cytoskeleton]	Back alignment and domain information

>PRK02888 nitrous-oxide reductase; Validated	Back alignment and domain information

>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit	Back alignment and domain information

>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism]	Back alignment and domain information

>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A	Back alignment and domain information

>PRK10747 putative protoheme IX biogenesis protein; Provisional	Back alignment and domain information

>KOG4234 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>PRK11906 transcriptional regulator; Provisional	Back alignment and domain information

>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H	Back alignment and domain information

>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion]	Back alignment and domain information

>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A	Back alignment and domain information

>KOG3621 consensus WD40 repeat-containing protein [General function prediction only]	Back alignment and domain information

>KOG2003 consensus TPR repeat-containing protein [General function prediction only]	Back alignment and domain information

>COG3391 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK10941 hypothetical protein; Provisional	Back alignment and domain information

>TIGR00540 hemY_coli hemY protein	Back alignment and domain information

Homologous Structure Templates