Citrus Sinensis ID: 005520

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690--
MAFSSTITTTVSSAASTSLSHLQQSCSVVSSLKLHPLLFSYSPPPFFKFRTRPKHHRFFHVRASSSNATLDSANGAVAAASEDQDSYGRQFFPLAAVVGQDAIKTALLLGAIDREIGGIAISGRRGTAKTVMARGLHAILPPIEVVVGSIANADPTCPDEWEDGLDEKAEYDTAGNLKTQIARSPFVQIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLAEAHRGVLYIDEINLLDEGISNLLLNVLTEGVNIVEREGISFKHPCKPLLIATYNPEEGVVREHLLDRIAINLSADLPMTFEDRVAAVGIATQFQERSNEVFKMVEEETDLAKTQIILAREYLKDVAIGREQLKYLVMEALRGGCQGHRAELYAARVAKCLAALEGREKVNVDDLKKAVELVILPRSIINETPPEQQNQQPPPPPPPQNQDSGEEEQNEEEDQEDENDEENEQQQEQLPEEFIFDAEGGLVDEKLLFFAQQAQRRRGKAGRAKNVIFSEDRGRYIKPMLPKGPIKRLAVDATLRAAAPYQKLRRERDTQKTRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTCRDQVSIIPFRGDSAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLSMVCRSVKPHHCGILTKKFLRCWWLLLSETIDERLNVANDFSSDYWNPTC
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHcccccEEEcccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccEEEEEccccccHHHHHHHHHHHHcccEEEEEcccccccccccEEEEEcccccccccHHHHHHHcEEEEEcccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHcccHHHHHHHHcccccccEEEcccccHHHHHHHccccEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEccccEEEEccccccHHHHHHHHcccccccccHHHHHHHHHHHHHccccccccccccccccEEEEEEEcccccccccccccccccccc
cccccccccHHcccccccccccccccccccccccccHHHcccccccccEEcccccccEEEEEEEEEEEEEccccccEccccccccccccccccEEEEEcHHHHHHHHHHHHccccccEEEEEcccccHHHHHHHHHHHHccccEEEccccccccccccHHccHHHHHHHHccccccccEEEEEccEEEEccccccccEEEEEcHHHHHHccccEEcccHHHHHcccEEEEEHHHHcHHHHHHHHHHHHHccccEEEEccEEEEcccEEEEEEccccccccccHHHHHHHEEEEEEcccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcHHHHHHHcccccccccEEEEEcccccEEcccccccccccEEEHHHHHHHHHHHHHHHHcccccccEEEEccHHHHHHHHHHccccEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEccccEEEEcccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcccHHccccccEEEEEEEEccccccccccccccccccc
MAFSSTITTTVSSAASTSLSHLQQSCSvvsslklhpllfsyspppffkfrtrpkhhrffhvrasssnatldsangavaaasedqdsygrqffplaAVVGQDAIKTALLLGAIDReiggiaisgrrgtAKTVMARglhailppieVVVGsianadptcpdewedgldekaeydtagnlktqiarspfvqiplgvtedrligsvdveesvktgttvfqpgllaeahrgvlyideINLLDEGISNLLLNVLTEGVniveregisfkhpckplliatynpeegvvREHLLDRIAInlsadlpmtfEDRVAAVGIATQFQERSNEVFKMVEEETDLAKTQIILAREYLKDVAIGREQLKYLVMEALRGGCQGHRAELYAARVAKCLAALEGREKVNVDDLKKAVELVIlprsiinetppeqqnqqpppppppqnqdsgeeeqneeedqedendeENEQQQeqlpeefifdaegglvdeKLLFFAQQAQRRrgkagraknvifsedrgryikpmlpkgpikrlAVDATLRAAAPYQKLRRERDTQKTRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESytcrdqvsiipfrgdsaevllppsrSIAMARKRLerlpcgggsplahglsmvcrsvkphhcgilTKKFLRCWWLLLSETIDERLNVandfssdywnptc
MAFSSTITTTVSSAASTSLSHLQQSCSVVSSLKLHPLLFSYSPPPFFKFRTRPKHHRFFHVrasssnatlDSANGAVAAASEDQDSYGRQFFPLAAVVGQDAIKTALLLGAIDreiggiaisgrrgTAKTVMARGLHAILPPIEVVVGSIANADPTCPDEWEDGLDEKAEYDTAGNlktqiarspfvqiplgvtEDRLIGSVDVEESVKtgttvfqpgllaeaHRGVLYIDEINLLDEGISNLLLNVLTEGVNIVERegisfkhpckPLLIATYNPEEGVVREHLLDRIAINLSADLPMTFEDRVAAVGIATQFQERSNEVFKMVEEETDLAKTQIILAREYLKDVAIGREQLKYLVMEALRGGCQGHRAELYAARVAKCLAALegrekvnvddlkKAVELVILPRSIINEtppeqqnqqpppPPPPQNQDSGEEEQNEEEDQEDENDEENEQQQEQLPEEFIFDAEGGLVDEKLLFFAQQAqrrrgkagraknvifsedrgryikpmlpkgpikrlavdATLRaaapyqklrrerdtqktrkvfvektdmrakrmarkagaLVIFVVDASGSMALNRMQNAKGAALKLLAESYTCRDQVSIIpfrgdsaevllpPSRSIAMARKRLERLPCGGGSPLAHGLSMVCRSVKPHHCGILTKKFLRCWWLLLSETIDERlnvandfssdywnptc
MAFsstitttvssaastslshlqqsCSVVSSLKLHpllfsyspppffkfrtrpkHHRFFHVRASSSNATLDSANGAVAAASEDQDSYGRQFFPLAAVVGQDAIKTALLLGAIDREIGGIAISGRRGTAKTVMARGLHAILPPIEVVVGSIANADPTCPDEWEDGLDEKAEYDTAGNLKTQIARSPFVQIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLAEAHRGVLYIDEINLLDEGISNLLLNVLTEGVNIVEREGISFKHPCKPLLIATYNPEEGVVREHLLDRIAINLSADLPMTFEDRVAAVGIATQFQERSNEVFKMVEEETDLAKTQIILAREYLKDVAIGREQLKYLVMEALRGGCQGHRAELYAARVAKCLAALEGREKVNVDDLKKAVELVILPRSIINETppeqqnqqpppppppqnqdsgeeeqneeedqedendeeneqqqeqlpeeFIFDAEGGLVDEKLLFFaqqaqrrrgkagrakNVIFSEDRGRYIKPMLPKGPIKRLAVDATLRAAAPYQKLRRERDTQKTRKVFVEKTDmrakrmarkaGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTCRDQVSIIPFRGDSAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLSMVCRSVKPHHCGILTKKFLRCWWLLLSETIDERLNVANDFSSDYWNPTC
*************************CSVVSSLKLHPLLFSYSPPPFFKFRTRPKHHRFFHV*************************YGRQFFPLAAVVGQDAIKTALLLGAIDREIGGIAISGRRGTAKTVMARGLHAILPPIEVVVGSIANADPTCPDEWEDGLDEKAEYDTAGNLKTQIARSPFVQIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLAEAHRGVLYIDEINLLDEGISNLLLNVLTEGVNIVEREGISFKHPCKPLLIATYNPEEGVVREHLLDRIAINLSADLPMTFEDRVAAVGIATQFQERSNEVFKMVEEETDLAKTQIILAREYLKDVAIGREQLKYLVMEALRGGCQGHRAELYAARVAKCLAALEGREKVNVDDLKKAVELVILPRSII****************************************************FIFDAEGGLVDEKLLFFAQQA*********AKNVIFSEDRGRYIKPMLPKGPIKRLAVDATLRAAA****************************MARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTCRDQVSIIPFRGDSAEVLLP****IAMARKRLERLPCGGGSPLAHGLSMVCRSVKPHHCGILTKKFLRCWWLLLSETIDERLNVANDFSSDYW****
*******************************************************************************************FPLAAVVGQDAIKTALLLGAIDREIGGIAISGRRGTAKTVMARGLHAILPPIEVVVGSIANADPTCPDEWEDGLDEKAE*********QIARSPFVQIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLAEAHRGVLYIDEINLLDEGISNLLLNVLTEGVNIVEREGISFKHPCKPLLIATYNPEEGVVREHLLDRIAINLSADLPMTFEDRVAAVGIATQFQERSNEVFKMVEEETDLAKTQIILAREYLKDVAIGREQLKYLVMEALRGGCQGHRAELYAARVAKCLAALEGREKVNVDDLKKAVELVIL********************************************************************************************************************ATLRAAAPY****************VEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTCRDQVSIIPFRGDSAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLSMVCRSVKPHHC********RCWWLLLSETIDERLNV*************
**************************SVVSSLKLHPLLFSYSPPPFFKFRTRPKHHRFFHVRASSSNATLD************QDSYGRQFFPLAAVVGQDAIKTALLLGAIDREIGGIAISGRRGTAKTVMARGLHAILPPIEVVVGSIANADPTCPDEWEDGLDEKAEYDTAGNLKTQIARSPFVQIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLAEAHRGVLYIDEINLLDEGISNLLLNVLTEGVNIVEREGISFKHPCKPLLIATYNPEEGVVREHLLDRIAINLSADLPMTFEDRVAAVGIATQFQERSNEVFKMVEEETDLAKTQIILAREYLKDVAIGREQLKYLVMEALRGGCQGHRAELYAARVAKCLAALEGREKVNVDDLKKAVELVILPRSIINET********************************************QLPEEFIFDAEGGLVDEKLLFFAQQ**********AKNVIFSEDRGRYIKPMLPKGPIKRLAVDATLRAAAPYQKLRRERDTQKTRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTCRDQVSIIPFRGDSAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLSMVCRSVKPHHCGILTKKFLRCWWLLLSETIDERLNVANDFSSDYWNPTC
*****************************SSLKLHPLLFSYSPPPFFKFRTRPKHHRFFHVRASSSNATLDSANGA************RQFFPLAAVVGQDAIKTALLLGAIDREIGGIAISGRRGTAKTVMARGLHAILPPIEVVVGSIANADPTCPDEWEDGLDEKAEYDTAGNLKTQIARSPFVQIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLAEAHRGVLYIDEINLLDEGISNLLLNVLTEGVNIVEREGISFKHPCKPLLIATYNPEEGVVREHLLDRIAINLSADLPMTFEDRVAAVGIATQFQERSNEVFKMVEEETDLAKTQIILAREYLKDVAIGREQLKYLVMEALRGGCQGHRAELYAARVAKCLAALEGREKVNVDDLKKAVELVILPR**************************************************************GLVDEKLLFFAQQAQRR*****RAKNVIFSEDRGRYIKPMLPKGPIKRLAVDATLRAAAPYQKLRRERDTQKTRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNR*QNAKGAALKLLAESYTCRDQVSIIPFRGDSAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLSMVCRSVKPHHCGILTKKFLRCWWLLLSETIDERLNV*************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAFSSTITTTVSSAASTSLSHLQQSCSVVSSLKLHPLLFSYSPPPFFKFRTRPKHHRFFHVRASSSNATLDSANGAVAAASEDQDSYGRQFFPLAAVVGQDAIKTALLLGAIDREIGGIAISGRRGTAKTVMARGLHAILPPIEVVVGSIANADPTCPDEWEDGLDEKAEYDTAGNLKTQIARSPFVQIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLAEAHRGVLYIDEINLLDEGISNLLLNVLTEGVNIVEREGISFKHPCKPLLIATYNPEEGVVREHLLDRIAINLSADLPMTFEDRVAAVGIATQFQERSNEVFKMVEEETDLAKTQIILAREYLKDVAIGREQLKYLVMEALRGGCQGHRAELYAARVAKCLAALEGREKVNVDDLKKAVELVILPRSIINETPPEQQNQQPPPPPPPQNQDSxxxxxxxxxxxxxxxxxxxxxxxxxLPEEFIFDAEGGLVDEKLLFFAQQAQRRRGKAGRAKNVIFSEDRGRYIKPMLPKGPIKRLAVDATLRAAAPYQKLRRERDTQKTRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTCRDQVSIIPFRGDSAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLSMVCRSVKPHHCGILTKKFLRCWWLLLSETIDERLNVANDFSSDYWNPTC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query692 2.2.26 [Sep-21-2011]
O22437754 Magnesium-chelatase subun N/A no 0.950 0.872 0.752 0.0
Q9SJE1760 Magnesium-chelatase subun yes no 0.906 0.825 0.772 0.0
Q6ATS0754 Magnesium-chelatase subun yes no 0.901 0.827 0.783 0.0
B8AMB8754 Magnesium-chelatase subun N/A no 0.901 0.827 0.783 0.0
O24133758 Magnesium-chelatase subun N/A no 0.940 0.858 0.718 0.0
P72772676 Magnesium-chelatase subun N/A no 0.789 0.807 0.611 0.0
O07345677 Magnesium-chelatase subun yes no 0.793 0.810 0.606 1e-179
Q9ZGE6666 Magnesium-chelatase 67 kD N/A no 0.786 0.816 0.451 1e-120
Q93SW0620 Magnesium-chelatase 67 kD yes no 0.699 0.780 0.365 3e-79
O50313619 Magnesium-chelatase 67 kD yes no 0.712 0.796 0.366 5e-76
>sp|O22437|CHLD_PEA Magnesium-chelatase subunit ChlD, chloroplastic OS=Pisum sativum GN=CHLD PE=2 SV=1 Back     alignment and function desciption
 Score =  946 bits (2444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 509/676 (75%), Positives = 565/676 (83%), Gaps = 18/676 (2%)

Query: 18  SLSHLQQSCSVVS-SLKLHPLLFSYSPPPFFKFRTRPKHHRFFHVRASSSNATLDSANGA 76
           SL+H   + +  +  L+ H LL     PP F  +     H  F  + +       S NGA
Sbjct: 4   SLTHTPHTTASPNLQLRFHSLL-----PPSFTSQPFLSLHSTFPPKRTVPKLRAQSENGA 58

Query: 77  VAAASE---DQDSYGRQFFPLAAVVGQDAIKTALLLGAIDREIGGIAISGRRGTAKTVMA 133
           V  ASE   D  +YGRQ+FPLAAV+GQDAIKTALLLGA D  IGGIAISGRRGTAKT+MA
Sbjct: 59  VLQASEEKLDASNYGRQYFPLAAVIGQDAIKTALLLGATDPRIGGIAISGRRGTAKTIMA 118

Query: 134 RGLHAILPPIEVVVGSIANADPTCPDEWEDGLDEKAEYDTAGNLKTQIARSPFVQIPLGV 193
           RG+HAILPPIEVV GSIANADP+CP+EWEDGL ++ EYD+ GN+KT I +SPFVQIPLGV
Sbjct: 119 RGMHAILPPIEVVQGSIANADPSCPEEWEDGLYKRVEYDSDGNVKTHIIKSPFVQIPLGV 178

Query: 194 TEDRLIGSVDVEESVKTGTTVFQPGLLAEAHRGVLYIDEINLLDEGISNLLLNVLTEGVN 253
           TEDRLIGSVDVEESVKTGTTVFQPGLLAEAHRGVLY+DEINLLDEGISNLLLNVLTEGVN
Sbjct: 179 TEDRLIGSVDVEESVKTGTTVFQPGLLAEAHRGVLYVDEINLLDEGISNLLLNVLTEGVN 238

Query: 254 IVEREGISFKHPCKPLLIATYNPEEGVVREHLLDRIAINLSADLPMTFEDRVAAVGIATQ 313
           IVEREGISF+HPC+PLLIATYNP+EG VREHLLDRIAINLSADLPM+FE+RV AVGIAT+
Sbjct: 239 IVEREGISFRHPCRPLLIATYNPDEGSVREHLLDRIAINLSADLPMSFENRVEAVGIATE 298

Query: 314 FQERSNEVFKMVEEETDLAKTQIILAREYLKDVAIGREQLKYLVMEALRGGCQGHRAELY 373
           FQ+   +VFKMV+E+TD AKTQIILAREYLKDV I +EQLKYLV+EALRGG QGHRAELY
Sbjct: 299 FQDNCGQVFKMVDEDTDNAKTQIILAREYLKDVTISKEQLKYLVIEALRGGVQGHRAELY 358

Query: 374 AARVAKCLAALEGREKVNVDDLKKAVELVILPRSIINET---PPEQQNQQPPPPPPPQNQ 430
           AARVAKCLAALEGREKV VDDLKKAVELVILPRSII +T      Q    PPPP   ++ 
Sbjct: 359 AARVAKCLAALEGREKVYVDDLKKAVELVILPRSIITDTPPEQQNQPPPPPPPPQNQESN 418

Query: 431 DSGEEEQNEEEDQEDENDEENEQQQEQLPEEFIFDAEGGLVDEKLLFFAQQAQRRRGKAG 490
           +   EE+ +EE++ED+NDEENEQQQ+QLPEEFIFDAEGGLVDEKLLFFAQQAQRRRGKAG
Sbjct: 419 EEQNEEEEQEEEEEDDNDEENEQQQDQLPEEFIFDAEGGLVDEKLLFFAQQAQRRRGKAG 478

Query: 491 RAKNVIFSEDRGRYIKPMLPKGPIKRLAVDATLRAAAPYQKLRRERDTQKTRKVFVEKTD 550
           RAKNVIFSEDRGRYIKPMLPKGP+KRLAVDATLRAAAPYQKLRRE+DT+  RKV+VEKTD
Sbjct: 479 RAKNVIFSEDRGRYIKPMLPKGPVKRLAVDATLRAAAPYQKLRREKDTENRRKVYVEKTD 538

Query: 551 MRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTCRDQVSIIPFRGDSA 610
           MRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYT RDQVSIIPFRGDSA
Sbjct: 539 MRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTSRDQVSIIPFRGDSA 598

Query: 611 EVLLPPSRSIAMARKRLERLPCGGGSPLAHGLSMVCRSVKPHHCGILTKKFLRCWWLLLS 670
           EVLLPPSRSIAMARKRLERLPCGGGSPLAHGL+   R       G+  +K      +++ 
Sbjct: 599 EVLLPPSRSIAMARKRLERLPCGGGSPLAHGLTTAVR------VGLNAEKSGDVGRIMIV 652

Query: 671 ETIDERLNVANDFSSD 686
              D R N++   S+D
Sbjct: 653 AITDGRANISLKRSND 668
Involved in chlorophyll biosynthesis; introduces a magnesium ion into protoporphyrin IX to yield Mg-protoporphyrin IX.
Pisum sativum (taxid: 3888)
EC: 6EC: .EC: 6EC: .EC: 1EC: .EC: 1
>sp|Q9SJE1|CHLD_ARATH Magnesium-chelatase subunit ChlD, chloroplastic OS=Arabidopsis thaliana GN=CHLD PE=2 SV=3 Back     alignment and function description
>sp|Q6ATS0|CHLD_ORYSJ Magnesium-chelatase subunit ChlD, chloroplastic OS=Oryza sativa subsp. japonica GN=CHLD PE=1 SV=1 Back     alignment and function description
>sp|B8AMB8|CHLD_ORYSI Magnesium-chelatase subunit ChlD, chloroplastic OS=Oryza sativa subsp. indica GN=CHLD PE=3 SV=1 Back     alignment and function description
>sp|O24133|CHLD_TOBAC Magnesium-chelatase subunit ChlD, chloroplastic OS=Nicotiana tabacum GN=CHLD PE=2 SV=1 Back     alignment and function description
>sp|P72772|CHLD_SYNY3 Magnesium-chelatase subunit ChlD OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=chlD PE=3 SV=1 Back     alignment and function description
>sp|O07345|CHLD_SYNE7 Magnesium-chelatase subunit ChlD OS=Synechococcus elongatus (strain PCC 7942) GN=chlD PE=3 SV=2 Back     alignment and function description
>sp|Q9ZGE6|BCHD_HELMO Magnesium-chelatase 67 kDa subunit OS=Heliobacillus mobilis GN=bchD PE=3 SV=1 Back     alignment and function description
>sp|Q93SW0|BCHD_CHLTE Magnesium-chelatase 67 kDa subunit OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / TLS) GN=bchD PE=3 SV=1 Back     alignment and function description
>sp|O50313|BCHD_CHLP8 Magnesium-chelatase 67 kDa subunit OS=Chlorobaculum parvum (strain NCIB 8327) GN=bchD PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query692
255544946760 Magnesium-chelatase subunit chlD, chloro 0.969 0.882 0.795 0.0
224106223786 predicted protein [Populus trichocarpa] 0.940 0.828 0.787 0.0
449444887748 PREDICTED: magnesium-chelatase subunit C 0.937 0.867 0.779 0.0
3913218754 RecName: Full=Magnesium-chelatase subuni 0.950 0.872 0.752 0.0
30680676760 magnesium-chelatase subunit chlD [Arabid 0.906 0.825 0.772 0.0
413932686755 hypothetical protein ZEAMMB73_644992 [Ze 0.910 0.834 0.771 0.0
242037661755 hypothetical protein SORBIDRAFT_01g00386 0.953 0.874 0.744 0.0
413932685692 hypothetical protein ZEAMMB73_644992 [Ze 0.910 0.910 0.771 0.0
115456135754 Os03g0811100 [Oryza sativa Japonica Grou 0.901 0.827 0.783 0.0
71493349761 chloroplast Mg-chelatase subunit XANTHA- 0.955 0.868 0.735 0.0
>gi|255544946|ref|XP_002513534.1| Magnesium-chelatase subunit chlD, chloroplast precursor, putative [Ricinus communis] gi|223547442|gb|EEF48937.1| Magnesium-chelatase subunit chlD, chloroplast precursor, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1008 bits (2605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 550/691 (79%), Positives = 597/691 (86%), Gaps = 20/691 (2%)

Query: 1   MAFSSTITT--TVSSAASTSLSHLQQSCSVVSSLKLHPLLFSYSPPPFFKFRTRPKHHRF 58
           MAFS T  T  T+     TSLS LQ S   +   K H    S+  P     + RP  +R 
Sbjct: 1   MAFSPTAGTKFTLPYGVPTSLSQLQSSVLSIPCFKSHS--HSFKSP-----KRRPYSYRR 53

Query: 59  FHVRASSS-NATLDSANGAVAAASEDQD--SYGRQFFPLAAVVGQDAIKTALLLGAIDRE 115
           F V  SSS   TL S NGAV + S++ D  SYGRQ+FPLAAVVGQDAIKTALLLGAIDRE
Sbjct: 54  FGVIVSSSATPTLQSTNGAVVSPSQNPDSSSYGRQYFPLAAVVGQDAIKTALLLGAIDRE 113

Query: 116 IGGIAISGRRGTAKTVMARGLHAILPPIEVVVGSIANADPTCPDEWEDGLDEKAEYDTAG 175
           IGGIAISG+RGTAKTVMARGLHAILPPI+VVVGSIANADP+CP+EWEDGL E+ EYD+ G
Sbjct: 114 IGGIAISGKRGTAKTVMARGLHAILPPIDVVVGSIANADPSCPEEWEDGLAERVEYDSDG 173

Query: 176 NLKTQIARSPFVQIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLAEAHRGVLYIDEINL 235
           N+KT++ RSPFVQIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLAEAHRGVLY+DEINL
Sbjct: 174 NIKTEVVRSPFVQIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLAEAHRGVLYVDEINL 233

Query: 236 LDEGISNLLLNVLTEGVNIVEREGISFKHPCKPLLIATYNPEEGVVREHLLDRIAINLSA 295
           LDEGISNLLLNVLTEGVNIVEREGISF+HPCKPLLIATYNPEEG VREHLLDRIAINLSA
Sbjct: 234 LDEGISNLLLNVLTEGVNIVEREGISFRHPCKPLLIATYNPEEGAVREHLLDRIAINLSA 293

Query: 296 DLPMTFEDRVAAVGIATQFQERSNEVFKMVEEETDLAKTQIILAREYLKDVAIGREQLKY 355
           DLPM FEDRVAAVGIATQFQE   EVFKMVEEET+ AKTQIILAREYLKDV + R+QLKY
Sbjct: 294 DLPMNFEDRVAAVGIATQFQEHCTEVFKMVEEETEFAKTQIILAREYLKDVTVSRDQLKY 353

Query: 356 LVMEALRGGCQGHRAELYAARVAKCLAALEGREKVNVDDLKKAVELVILPRSIINETPPE 415
           LV+EALRGGCQGHRAELYAARVAKCLAALEGREKVNVDDLKKAVELVILPRSIINE+PPE
Sbjct: 354 LVLEALRGGCQGHRAELYAARVAKCLAALEGREKVNVDDLKKAVELVILPRSIINESPPE 413

Query: 416 QQNQQPPPPPPPQNQDSGEEEQNEEEDQEDENDEENEQQQEQLPEEFIFDAEGGLVDEKL 475
           QQNQQPPPPPPPQNQD G+E+  EE   +++NDE+NEQQQ+Q+PEEFIFDAEGG VDEKL
Sbjct: 414 QQNQQPPPPPPPQNQDPGDEQNEEE--DQEDNDEDNEQQQDQIPEEFIFDAEGGFVDEKL 471

Query: 476 LFFAQQAQRRRGKAGRAKNVIFSEDRGRYIKPMLPKGPIKRLAVDATLRAAAPYQKLRRE 535
           LFFAQQAQRRRGKAGRAKNVIFSEDRGRYIKPMLPKGP+KRLAVDATLRAAAPYQKLRRE
Sbjct: 472 LFFAQQAQRRRGKAGRAKNVIFSEDRGRYIKPMLPKGPVKRLAVDATLRAAAPYQKLRRE 531

Query: 536 RDTQKTRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYT 595
           +DTQK+RKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAA+KLLAESYT
Sbjct: 532 KDTQKSRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAAIKLLAESYT 591

Query: 596 CRDQVSIIPFRGDSAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLSMVCRSVKPHHCG 655
            RDQV+IIPFRGDSAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGL+   R       G
Sbjct: 592 SRDQVAIIPFRGDSAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLTTAVR------VG 645

Query: 656 ILTKKFLRCWWLLLSETIDERLNVANDFSSD 686
           +  +K      +++    D R N++   S+D
Sbjct: 646 LNAEKSGDVGRIMIVAITDGRANISLKRSTD 676

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224106223|ref|XP_002314091.1| predicted protein [Populus trichocarpa] gi|222850499|gb|EEE88046.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449444887|ref|XP_004140205.1| PREDICTED: magnesium-chelatase subunit ChlD, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|3913218|sp|O22437.1|CHLD_PEA RecName: Full=Magnesium-chelatase subunit ChlD, chloroplastic; Short=Mg-chelatase subunit D; AltName: Full=Mg-protoporphyrin IX chelatase subunit ChlD; Flags: Precursor gi|2318117|gb|AAB72194.1| Mg-chelatase subunit D [Pisum sativum] Back     alignment and taxonomy information
>gi|30680676|ref|NP_563821.2| magnesium-chelatase subunit chlD [Arabidopsis thaliana] gi|148886934|sp|Q9SJE1.3|CHLD_ARATH RecName: Full=Magnesium-chelatase subunit ChlD, chloroplastic; Short=Mg-chelatase subunit D; AltName: Full=Mg-protoporphyrin IX chelatase subunit ChlD; AltName: Full=Protein ALBINA 1; Flags: Precursor gi|17380694|gb|AAL36177.1| putative Mg-chelatase [Arabidopsis thaliana] gi|20259647|gb|AAM14341.1| putative Mg-chelatase [Arabidopsis thaliana] gi|110741163|dbj|BAE98674.1| Mg-chelatase like protein [Arabidopsis thaliana] gi|332190180|gb|AEE28301.1| magnesium-chelatase subunit chlD [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|413932686|gb|AFW67237.1| hypothetical protein ZEAMMB73_644992 [Zea mays] Back     alignment and taxonomy information
>gi|242037661|ref|XP_002466225.1| hypothetical protein SORBIDRAFT_01g003860 [Sorghum bicolor] gi|241920079|gb|EER93223.1| hypothetical protein SORBIDRAFT_01g003860 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|413932685|gb|AFW67236.1| hypothetical protein ZEAMMB73_644992 [Zea mays] Back     alignment and taxonomy information
>gi|115456135|ref|NP_001051668.1| Os03g0811100 [Oryza sativa Japonica Group] gi|75119877|sp|Q6ATS0.1|CHLD_ORYSJ RecName: Full=Magnesium-chelatase subunit ChlD, chloroplastic; Short=Mg-chelatase subunit D; AltName: Full=Mg-protoporphyrin IX chelatase subunit ChlD; AltName: Full=Protein CHLORINA 1; Flags: Precursor gi|403399750|sp|B8AMB8.1|CHLD_ORYSI RecName: Full=Magnesium-chelatase subunit ChlD, chloroplastic; Short=Mg-chelatase subunit D; AltName: Full=Mg-protoporphyrin IX chelatase subunit ChlD; AltName: Full=Protein CHLORINA 1; Flags: Precursor gi|50540744|gb|AAT77900.1| putative magnesium chelatase [Oryza sativa Japonica Group] gi|108711695|gb|ABF99490.1| magnesium chelatase ATPase subunit D family protein, expressed [Oryza sativa Japonica Group] gi|113550139|dbj|BAF13582.1| Os03g0811100 [Oryza sativa Japonica Group] gi|117956054|gb|ABK58606.1| magnesium chelatase subunit D [Oryza sativa Japonica Group] gi|117956056|gb|ABK58607.1| magnesium chelatase subunit D [Oryza sativa Japonica Group] gi|215704143|dbj|BAG92983.1| unnamed protein product [Oryza sativa Japonica Group] gi|218193962|gb|EEC76389.1| hypothetical protein OsI_14020 [Oryza sativa Indica Group] gi|222626024|gb|EEE60156.1| hypothetical protein OsJ_13066 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|71493349|gb|AAZ32779.1| chloroplast Mg-chelatase subunit XANTHA-G precursor [Hordeum vulgare] gi|326503464|dbj|BAJ86238.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326508943|dbj|BAJ86864.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query692
TAIR|locus:2201796760 ALB1 "ALBINA 1" [Arabidopsis t 0.510 0.464 0.830 1.4e-229
TAIR|locus:2005500424 CHLI1 [Arabidopsis thaliana (t 0.485 0.792 0.365 8e-53
TAIR|locus:2152405418 CHLI2 "magnesium chelatase i2" 0.476 0.789 0.380 5.6e-52
UNIPROTKB|Q4KAH8335 bchI "Magnesium chelatase, sub 0.364 0.752 0.322 2.5e-42
UNIPROTKB|P38022461 rocR "Arginine utilization reg 0.244 0.366 0.286 2.7e-06
UNIPROTKB|O69660358 moxR2 "Probable methanol dehyd 0.303 0.586 0.280 1.9e-05
UNIPROTKB|Q4K3V3497 PFL_6022 "Mg-chelatase subunit 0.099 0.138 0.364 2.8e-05
UNIPROTKB|Q605Y3485 MCA2139 "Mg chelatase-related 0.088 0.125 0.311 7.3e-05
TIGR_CMR|SPO_0402504 SPO_0402 "competence protein C 0.088 0.121 0.327 8.9e-05
UNIPROTKB|P71552459 Rv0958 "POSSIBLE MAGNESIUM CHE 0.276 0.416 0.268 0.00024
TAIR|locus:2201796 ALB1 "ALBINA 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1507 (535.5 bits), Expect = 1.4e-229, Sum P(2) = 1.4e-229
 Identities = 298/359 (83%), Positives = 326/359 (90%)

Query:    59 FHVRASSSNATLDSANGAVAAASE-----DQDSYGRQFFPLAAVVGQDAIKTALLLGAID 113
             F VRAS+ NAT++S NG  A+ S+     D  SYGRQFFPLAAVVGQ+ IKTALLLGA+D
Sbjct:    46 FTVRASA-NATVESPNGVPASTSDTDTETDTTSYGRQFFPLAAVVGQEGIKTALLLGAVD 104

Query:   114 REIGGIAISGRRGTAKTVMARGLHAILPPIEVVVGSIANADPTCPDEWEDGLDEKAEYDT 173
             REIGGIAISGRRGTAKTVMARGLH ILPPIEVVVGSI+NADP CPDEWED LDE+ EY+ 
Sbjct:   105 REIGGIAISGRRGTAKTVMARGLHEILPPIEVVVGSISNADPACPDEWEDDLDERIEYNA 164

Query:   174 AGNLKTQIARSPFVQIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLAEAHRGVLYIDEI 233
                +KT+I +SPF+QIPLGVTEDRLIGSVDVEESVK GTTVFQPGLLAEAHRGVLY+DEI
Sbjct:   165 DNTIKTEIVKSPFIQIPLGVTEDRLIGSVDVEESVKRGTTVFQPGLLAEAHRGVLYVDEI 224

Query:   234 NLLDEGISNLLLNVLTEGVNIVEREGISFKHPCKPLLIATYNPEEGVVREHLLDRIAINL 293
             NLLDEGISNLLLNVLT+GVNIVEREGISF+HPCKPLLIATYNPEEG VREHLLDR+AINL
Sbjct:   225 NLLDEGISNLLLNVLTDGVNIVEREGISFRHPCKPLLIATYNPEEGAVREHLLDRVAINL 284

Query:   294 SADLPMTFEDRVAAVGIATQFQERSNEVFKMVEEETDLAKTQIILAREYLKDVAIGREQL 353
             SADLPM+FEDRVAAVGIATQFQER NEVF+MV EET+ AKTQIILAREYLKDV I REQL
Sbjct:   285 SADLPMSFEDRVAAVGIATQFQERCNEVFRMVNEETETAKTQIILAREYLKDVKISREQL 344

Query:   354 KYLVMEALRGGCQGHRAELYAARVAKCLAALEGREKVNVDDLKKAVELVILPRSIINET 412
             KYLV+EA+RGG QGHRAELYAARVAKCLAA+EGREKV +DDL+KAVELVILPRS ++ET
Sbjct:   345 KYLVLEAVRGGVQGHRAELYAARVAKCLAAIEGREKVTIDDLRKAVELVILPRSSLDET 403
GO:0000166 "nucleotide binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0015979 "photosynthesis" evidence=IEA
GO:0015995 "chlorophyll biosynthetic process" evidence=IEA;TAS
GO:0016851 "magnesium chelatase activity" evidence=IEA
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0010007 "magnesium chelatase complex" evidence=TAS
GO:0009534 "chloroplast thylakoid" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0009690 "cytokinin metabolic process" evidence=RCA
GO:0019288 "isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway" evidence=RCA
TAIR|locus:2005500 CHLI1 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2152405 CHLI2 "magnesium chelatase i2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q4KAH8 bchI "Magnesium chelatase, subunit BchI" [Pseudomonas protegens Pf-5 (taxid:220664)] Back     alignment and assigned GO terms
UNIPROTKB|P38022 rocR "Arginine utilization regulatory protein RocR" [Bacillus subtilis subsp. subtilis str. 168 (taxid:224308)] Back     alignment and assigned GO terms
UNIPROTKB|O69660 moxR2 "Probable methanol dehydrogenase transcriptional regulatory protein MoxR2" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
UNIPROTKB|Q4K3V3 PFL_6022 "Mg-chelatase subunits D/I family, ComM subfamily protein" [Pseudomonas protegens Pf-5 (taxid:220664)] Back     alignment and assigned GO terms
UNIPROTKB|Q605Y3 MCA2139 "Mg chelatase-related protein" [Methylococcus capsulatus str. Bath (taxid:243233)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_0402 SPO_0402 "competence protein ComM" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
UNIPROTKB|P71552 Rv0958 "POSSIBLE MAGNESIUM CHELATASE" [Mycobacterium tuberculosis H37Rv (taxid:83332)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6ATS0CHLD_ORYSJ6, ., 6, ., 1, ., 10.78330.90170.8275yesno
B8AMB8CHLD_ORYSI6, ., 6, ., 1, ., 10.78330.90170.8275N/Ano
O07345CHLD_SYNE76, ., 6, ., 1, ., 10.60670.79330.8109yesno
O22437CHLD_PEA6, ., 6, ., 1, ., 10.75290.95080.8726N/Ano
Q9SJE1CHLD_ARATH6, ., 6, ., 1, ., 10.77270.90600.825yesno
O24133CHLD_TOBAC6, ., 6, ., 1, ., 10.71890.94070.8588N/Ano

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer6.6.1.10.991
3rd Layer6.6.10.976

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query692
TIGR02031589 TIGR02031, BchD-ChlD, magnesium chelatase ATPase s 0.0
TIGR02442633 TIGR02442, Cob-chelat-sub, cobaltochelatase subuni 0.0
COG1239423 COG1239, ChlI, Mg-chelatase subunit ChlI [Coenzyme 1e-112
PRK13406584 PRK13406, bchD, magnesium chelatase subunit D; Pro 6e-85
CHL00081350 CHL00081, chlI, Mg-protoporyphyrin IX chelatase 4e-70
TIGR02030337 TIGR02030, BchI-ChlI, magnesium chelatase ATPase s 7e-69
PRK13407334 PRK13407, bchI, magnesium chelatase subunit I; Pro 5e-62
COG1240261 COG1240, ChlD, Mg-chelatase subunit ChlD [Coenzyme 4e-48
cd01451178 cd01451, vWA_Magnesium_chelatase, Magnesium chelat 3e-40
COG0714329 COG0714, COG0714, MoxR-like ATPases [General funct 2e-15
smart00327175 smart00327, VWA, von Willebrand factor (vWF) type 2e-12
pfam13519172 pfam13519, VWA_2, von Willebrand factor type A dom 4e-08
cd00198161 cd00198, vWFA, Von Willebrand factor type A (vWA) 6e-08
pfam01078207 pfam01078, Mg_chelatase, Magnesium chelatase, subu 8e-08
cd01465170 cd01465, vWA_subgroup, VWA subgroup: Von Willebran 2e-07
cd01461171 cd01461, vWA_interalpha_trypsin_inhibitor, vWA_int 3e-07
COG0606490 COG0606, COG0606, Predicted ATPase with chaperone 1e-06
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 2e-06
COG1067647 COG1067, LonB, Predicted ATP-dependent protease [P 1e-05
TIGR00368499 TIGR00368, TIGR00368, Mg chelatase-related protein 2e-04
TIGR03788 596 TIGR03788, marine_srt_targ, marine proteobacterial 2e-04
cd01466155 cd01466, vWA_C3HC4_type, VWA C3HC4-type: Von Wille 8e-04
COG1221403 COG1221, PspF, Transcriptional regulators containi 8e-04
PRK09862506 PRK09862, PRK09862, putative ATP-dependent proteas 0.001
TIGR03436 296 TIGR03436, acidobact_VWFA, VWFA-related Acidobacte 0.002
TIGR02903615 TIGR02903, spore_lon_C, ATP-dependent protease, Lo 0.002
pfam07728135 pfam07728, AAA_5, AAA domain (dynein-related subfa 0.003
PRK13765637 PRK13765, PRK13765, ATP-dependent protease Lon; Pr 0.004
>gnl|CDD|233692 TIGR02031, BchD-ChlD, magnesium chelatase ATPase subunit D Back     alignment and domain information 
 Score =  637 bits (1644), Expect = 0.0
 Identities = 257/547 (46%), Positives = 326/547 (59%), Gaps = 60/547 (10%)

Query: 101 DAIKTALLLGAIDREIGGIAISGRRGTAKTVMARGLHAILPPIEVVVGSIANADPTCPDE 160
           +  K AL L A+D  +GG+AI  R GT KT +AR L  ILPPI                 
Sbjct: 1   ERAKLALTLLAVDPSLGGVAIRARAGTGKTALARALAEILPPIM---------------- 44

Query: 161 WEDGLDEKAEYDTAGNLKTQIARSPFVQIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLL 220
                                   PFV++PLGVTEDRLIG +DVEES+  G  V QPGLL
Sbjct: 45  ------------------------PFVELPLGVTEDRLIGGIDVEESLAGGQRVTQPGLL 80

Query: 221 AEAHRGVLYIDEINLLDEGISNLLLNVLTEGVNIVEREGISFKHPCKPLLIATYNPEEGV 280
            EA RGVLY+D  NLLD+G+SN LL  L EGV IVEREGIS  HP K  LIATY+P EG 
Sbjct: 81  DEAPRGVLYVDMANLLDDGLSNRLLQALDEGVVIVEREGISVVHPAKFALIATYDPAEGG 140

Query: 281 --VREHLLDRIAINLSADLPMTFEDRVAAVGIATQFQERSNEVFKMVEEETDLAKTQIIL 338
             + +HLLDR+A+++S +   + + RV  V                + +E +L + QI  
Sbjct: 141 GGLPDHLLDRLALHVSLEDVASQDLRVEIVRRER------CNEVFRMNDELELLRGQIEA 194

Query: 339 AREYLKDVAIGREQLKYLVMEALRGGCQGHRAELYAARVAKCLAALEGREKVNVDDLKKA 398
           ARE L  V I  EQ+K LV+ A   G  GHRA+L+A R AK  AAL GR +V  +DLK A
Sbjct: 195 ARELLPQVTISAEQVKELVLTAASLGISGHRADLFAVRAAKAHAALHGRTEVTEEDLKLA 254

Query: 399 VELVILPRSIINETPPEQQNQQPPPPPPPQNQDSGEEEQNEEEDQEDENDEENEQQQEQL 458
           VELV+LPR+     P  Q    PPPPPP   +   EEE +E     D+ D ++ ++ +Q+
Sbjct: 255 VELVLLPRATRLPEPEPQP--PPPPPPPEPPE--PEEEPDEP----DQTDPDDGEETDQI 306

Query: 459 PEEFIFDAEGGLVDEKLLFFAQQAQRRRGKAGRAKNVIFSEDRGRYIKPMLPK-GPIKRL 517
           PEE +FDA    + + +L   Q  QRRRG   RA     S  RGR ++  L K G   R+
Sbjct: 307 PEELMFDAVEADLPDNILATLQTVQRRRG---RAGGEQKSNHRGRPLRSRLGKPGSGARV 363

Query: 518 AVDATLRAAAPYQKLRRERDTQKTRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALN 577
            + ATLRAAAP+Q+LRRE +   TR + VE +D+R KR  RK+G L+IFVVDASGS A+ 
Sbjct: 364 DLVATLRAAAPWQRLRREENPAGTRGLIVEASDIRIKRYRRKSGRLLIFVVDASGSAAVA 423

Query: 578 RMQNAKGAALKLLAESYTCRDQVSIIPFRGDSAEVLLPPSRSIAMARKRLERLPCGGGSP 637
           RM  AKGA   LL E+Y  RDQVS+I FRG +AEVLLPPSRS+  A++RL+ LP GGG+P
Sbjct: 424 RMSEAKGAVELLLGEAYVHRDQVSLIAFRGTAAEVLLPPSRSVEQAKRRLDVLPGGGGTP 483

Query: 638 LAHGLSM 644
           LA GL+ 
Sbjct: 484 LAAGLAA 490

This model represents one of two ATPase subunits of the trimeric magnesium chelatase responsible for insertion of magnesium ion into protoporphyrin IX. This is an essential step in the biosynthesis of both chlorophyll and bacteriochlorophyll. This subunit is found in green plants, photosynthetic algae, cyanobacteria and other photosynthetic bacteria. Unlike subunit I (TIGR02030), this subunit is not found in archaea [Biosynthesis of cofactors, prosthetic groups, and carriers, Chlorophyll and bacteriochlorphyll]. Length = 589
>gnl|CDD|233870 TIGR02442, Cob-chelat-sub, cobaltochelatase subunit Back     alignment and domain information
>gnl|CDD|224160 COG1239, ChlI, Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|237378 PRK13406, bchD, magnesium chelatase subunit D; Provisional Back     alignment and domain information
>gnl|CDD|177020 CHL00081, chlI, Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>gnl|CDD|131085 TIGR02030, BchI-ChlI, magnesium chelatase ATPase subunit I Back     alignment and domain information
>gnl|CDD|184036 PRK13407, bchI, magnesium chelatase subunit I; Provisional Back     alignment and domain information
>gnl|CDD|224161 COG1240, ChlD, Mg-chelatase subunit ChlD [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|238728 cd01451, vWA_Magnesium_chelatase, Magnesium chelatase: Mg-chelatase catalyses the insertion of Mg into protoporphyrin IX (Proto) Back     alignment and domain information
>gnl|CDD|223786 COG0714, COG0714, MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|214621 smart00327, VWA, von Willebrand factor (vWF) type A domain Back     alignment and domain information
>gnl|CDD|222192 pfam13519, VWA_2, von Willebrand factor type A domain Back     alignment and domain information
>gnl|CDD|238119 cd00198, vWFA, Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>gnl|CDD|144608 pfam01078, Mg_chelatase, Magnesium chelatase, subunit ChlI Back     alignment and domain information
>gnl|CDD|238742 cd01465, vWA_subgroup, VWA subgroup: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>gnl|CDD|238738 cd01461, vWA_interalpha_trypsin_inhibitor, vWA_interalpha trypsin inhibitor (ITI): ITI is a glycoprotein composed of three polypeptides- two heavy chains and one light chain (bikunin) Back     alignment and domain information
>gnl|CDD|223679 COG0606, COG0606, Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|223994 COG1067, LonB, Predicted ATP-dependent protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|129465 TIGR00368, TIGR00368, Mg chelatase-related protein Back     alignment and domain information
>gnl|CDD|234353 TIGR03788, marine_srt_targ, marine proteobacterial sortase target protein Back     alignment and domain information
>gnl|CDD|238743 cd01466, vWA_C3HC4_type, VWA C3HC4-type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>gnl|CDD|224142 COG1221, PspF, Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|182120 PRK09862, PRK09862, putative ATP-dependent protease; Provisional Back     alignment and domain information
>gnl|CDD|234208 TIGR03436, acidobact_VWFA, VWFA-related Acidobacterial domain Back     alignment and domain information
>gnl|CDD|234053 TIGR02903, spore_lon_C, ATP-dependent protease, Lon family Back     alignment and domain information
>gnl|CDD|219538 pfam07728, AAA_5, AAA domain (dynein-related subfamily) Back     alignment and domain information
>gnl|CDD|237495 PRK13765, PRK13765, ATP-dependent protease Lon; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 692
TIGR02442633 Cob-chelat-sub cobaltochelatase subunit. A number 100.0
PRK13406584 bchD magnesium chelatase subunit D; Provisional 100.0
TIGR02031589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 100.0
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis 100.0
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 100.0
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 100.0
PRK13407334 bchI magnesium chelatase subunit I; Provisional 100.0
COG1240261 ChlD Mg-chelatase subunit ChlD [Coenzyme metabolis 100.0
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 99.97
COG3829560 RocR Transcriptional regulator containing PAS, AAA 99.97
PRK09862506 putative ATP-dependent protease; Provisional 99.97
COG3604550 FhlA Transcriptional regulator containing GAF, AAA 99.96
COG0606490 Predicted ATPase with chaperone activity [Posttran 99.96
TIGR00368499 Mg chelatase-related protein. The N-terminal end m 99.96
COG2204464 AtoC Response regulator containing CheY-like recei 99.96
smart00350509 MCM minichromosome maintenance proteins. 99.96
PRK13531498 regulatory ATPase RavA; Provisional 99.95
TIGR02974329 phageshock_pspF psp operon transcriptional activat 99.92
PRK15424538 propionate catabolism operon regulatory protein Pr 99.91
TIGR02329526 propionate_PrpR propionate catabolism operon regul 99.91
COG0714329 MoxR-like ATPases [General function prediction onl 99.9
PRK11608326 pspF phage shock protein operon transcriptional ac 99.9
COG1221403 PspF Transcriptional regulators containing an AAA- 99.9
TIGR01817534 nifA Nif-specific regulatory protein. This model r 99.9
PTZ00111915 DNA replication licensing factor MCM4; Provisional 99.9
TIGR02902531 spore_lonB ATP-dependent protease LonB. Members of 99.9
PRK05022509 anaerobic nitric oxide reductase transcription reg 99.89
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 99.88
COG3283511 TyrR Transcriptional regulator of aromatic amino a 99.88
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 99.88
PF00493331 MCM: MCM2/3/5 family This family extends the MCM d 99.88
TIGR02915445 PEP_resp_reg putative PEP-CTERM system response re 99.85
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 99.85
PRK10923469 glnG nitrogen regulation protein NR(I); Provisiona 99.85
PRK15429686 formate hydrogenlyase transcriptional activator Fh 99.85
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 99.85
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.84
COG1241682 MCM2 Predicted ATPase involved in replication cont 99.84
KOG0480764 consensus DNA replication licensing factor, MCM6 c 99.83
PRK11361457 acetoacetate metabolism regulatory protein AtoC; P 99.83
COG3284606 AcoR Transcriptional activator of acetoin/glycerol 99.82
TIGR00764608 lon_rel lon-related putative ATP-dependent proteas 99.82
PRK15115444 response regulator GlrR; Provisional 99.81
TIGR01818463 ntrC nitrogen regulation protein NR(I). This model 99.8
COG2255332 RuvB Holliday junction resolvasome, helicase subun 99.79
KOG0478804 consensus DNA replication licensing factor, MCM4 c 99.79
KOG0734752 consensus AAA+-type ATPase containing the peptidas 99.79
KOG0482721 consensus DNA replication licensing factor, MCM7 c 99.79
PRK10365441 transcriptional regulatory protein ZraR; Provision 99.79
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 99.78
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 99.77
PRK13765637 ATP-dependent protease Lon; Provisional 99.77
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 99.77
COG2256436 MGS1 ATPase related to the helicase subunit of the 99.76
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 99.74
PF07726131 AAA_3: ATPase family associated with various cellu 99.73
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.73
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 99.7
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.7
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 99.7
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 99.7
KOG0479818 consensus DNA replication licensing factor, MCM3 c 99.68
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 99.68
KOG0477854 consensus DNA replication licensing factor, MCM2 c 99.67
cd01451178 vWA_Magnesium_chelatase Magnesium chelatase: Mg-ch 99.67
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 99.66
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 99.66
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 99.65
PRK03992389 proteasome-activating nucleotidase; Provisional 99.65
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 99.65
KOG2028554 consensus ATPase related to the helicase subunit o 99.65
KOG0731774 consensus AAA+-type ATPase containing the peptidas 99.64
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 99.64
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 99.63
PHA02244383 ATPase-like protein 99.62
PRK13342413 recombination factor protein RarA; Reviewed 99.62
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 99.62
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 99.62
CHL00195489 ycf46 Ycf46; Provisional 99.61
KOG0481729 consensus DNA replication licensing factor, MCM5 c 99.61
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 99.61
CHL00181287 cbbX CbbX; Provisional 99.61
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 99.61
CHL00176638 ftsH cell division protein; Validated 99.6
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 99.6
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 99.6
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 99.59
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 99.59
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 99.59
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 99.58
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 99.58
PRK13341 725 recombination factor protein RarA/unknown domain f 99.58
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 99.57
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 99.56
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 99.56
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 99.56
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 99.56
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 99.55
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 99.54
COG0465596 HflB ATP-dependent Zn proteases [Posttranslational 99.54
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 99.54
COG4650531 RtcR Sigma54-dependent transcription regulator con 99.54
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 99.54
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.53
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 99.53
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 99.53
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 99.52
PLN03025319 replication factor C subunit; Provisional 99.52
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.5
PRK14959624 DNA polymerase III subunits gamma and tau; Provisi 99.49
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 99.49
PRK08903227 DnaA regulatory inactivator Hda; Validated 99.49
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 99.48
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 99.48
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.48
COG2812515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 99.48
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 99.48
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 99.48
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 99.47
cd01466155 vWA_C3HC4_type VWA C3HC4-type: Von Willebrand fact 99.47
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 99.46
PRK12402337 replication factor C small subunit 2; Reviewed 99.46
PRK10865857 protein disaggregation chaperone; Provisional 99.45
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 99.45
KOG0736953 consensus Peroxisome assembly factor 2 containing 99.45
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 99.45
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.45
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 99.44
KOG1942456 consensus DNA helicase, TBP-interacting protein [R 99.44
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 99.44
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 99.44
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.44
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.44
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 99.43
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 99.43
cd01463190 vWA_VGCC_like VWA Voltage gated Calcium channel li 99.43
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 99.42
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 99.42
PTZ001121164 origin recognition complex 1 protein; Provisional 99.42
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 99.42
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 99.41
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 99.41
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 99.41
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 99.4
TIGR00763775 lon ATP-dependent protease La. This protein is ind 99.39
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 99.39
cd01454174 vWA_norD_type norD type: Denitrifying bacteria con 99.39
PRK10733644 hflB ATP-dependent metalloprotease; Reviewed 99.38
TIGR02928365 orc1/cdc6 family replication initiation protein. M 99.38
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 99.38
CHL00206 2281 ycf2 Ycf2; Provisional 99.38
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 99.37
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 99.37
PHA02544316 44 clamp loader, small subunit; Provisional 99.36
cd01472164 vWA_collagen von Willebrand factor (vWF) type A do 99.36
cd01456206 vWA_ywmD_type VWA ywmD type:Von Willebrand factor 99.36
cd01462152 VWA_YIEM_type VWA YIEM type: Von Willebrand factor 99.35
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 99.35
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 99.34
cd01470198 vWA_complement_factors Complement factors B and C2 99.34
PRK00440319 rfc replication factor C small subunit; Reviewed 99.34
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 99.34
cd01465170 vWA_subgroup VWA subgroup: Von Willebrand factor t 99.34
cd01464176 vWA_subfamily VWA subfamily: Von Willebrand factor 99.34
PRK08084235 DNA replication initiation factor; Provisional 99.34
PRK13685 326 hypothetical protein; Provisional 99.33
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 99.33
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 99.33
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 99.33
PRK14971614 DNA polymerase III subunits gamma and tau; Provisi 99.33
COG4245207 TerY Uncharacterized protein encoded in toxicity p 99.33
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 99.32
PRK08727233 hypothetical protein; Validated 99.32
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 99.31
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 99.31
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.31
cd01480186 vWA_collagen_alpha_1-VI-type VWA_collagen alpha(VI 99.31
PRK00411394 cdc6 cell division control protein 6; Reviewed 99.3
PRK06893229 DNA replication initiation factor; Validated 99.29
PRK04195482 replication factor C large subunit; Provisional 99.28
CHL00095821 clpC Clp protease ATP binding subunit 99.28
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 99.27
PRK11331459 5-methylcytosine-specific restriction enzyme subun 99.26
PRK06620214 hypothetical protein; Validated 99.26
PRK14948620 DNA polymerase III subunits gamma and tau; Provisi 99.26
cd01453183 vWA_transcription_factor_IIH_type Transcription fa 99.26
cd01482164 vWA_collagen_alphaI-XII-like Collagen: The extrace 99.26
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 99.25
KOG2680454 consensus DNA helicase TIP49, TBP-interacting prot 99.24
cd01474185 vWA_ATR ATR (Anthrax Toxin Receptor): Anthrax toxi 99.24
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 99.24
cd01461171 vWA_interalpha_trypsin_inhibitor vWA_interalpha tr 99.24
CHL00095821 clpC Clp protease ATP binding subunit 99.24
KOG2004906 consensus Mitochondrial ATP-dependent protease PIM 99.23
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.22
KOG0745564 consensus Putative ATP-dependent Clp-type protease 99.22
cd01467180 vWA_BatA_type VWA BatA type: Von Willebrand factor 99.22
PRK10865 857 protein disaggregation chaperone; Provisional 99.2
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 99.2
cd01471186 vWA_micronemal_protein Micronemal proteins: The To 99.2
KOG0740428 consensus AAA+-type ATPase [Posttranslational modi 99.18
TIGR03436 296 acidobact_VWFA VWFA-related Acidobacterial domain. 99.17
TIGR00868 863 hCaCC calcium-activated chloride channel protein 1 99.17
PF00004132 AAA: ATPase family associated with various cellula 99.17
PRK00149450 dnaA chromosomal replication initiation protein; R 99.15
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 99.15
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 99.15
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 99.15
cd01476163 VWA_integrin_invertebrates VWA_integrin (invertebr 99.15
PRK09087226 hypothetical protein; Validated 99.14
TIGR00362405 DnaA chromosomal replication initiator protein Dna 99.13
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 99.13
PRK07940394 DNA polymerase III subunit delta'; Validated 99.12
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 99.12
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 99.11
PF13519172 VWA_2: von Willebrand factor type A domain; PDB: 3 99.1
cd01452187 VWA_26S_proteasome_subunit 26S proteasome plays a 99.1
PRK12422445 chromosomal replication initiation protein; Provis 99.09
cd01450161 vWFA_subfamily_ECM Von Willebrand factor type A (v 99.08
PF13768155 VWA_3: von Willebrand factor type A domain 99.07
TIGR03788 596 marine_srt_targ marine proteobacterial sortase tar 99.06
PRK14086617 dnaA chromosomal replication initiation protein; P 99.05
smart00327177 VWA von Willebrand factor (vWF) type A domain. VWA 99.03
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 99.03
cd01477193 vWA_F09G8-8_type VWA F09G8.8 type: Von Willebrand 99.03
COG1067647 LonB Predicted ATP-dependent protease [Posttransla 99.02
PRK14087450 dnaA chromosomal replication initiation protein; P 99.02
PRK09112351 DNA polymerase III subunit delta'; Validated 99.01
PRK14088440 dnaA chromosomal replication initiation protein; P 99.0
PRK05642234 DNA replication initiation factor; Validated 99.0
cd01469177 vWA_integrins_alpha_subunit Integrins are a class 98.99
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 98.98
PF00092178 VWA: von Willebrand factor type A domain; InterPro 98.96
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 98.96
cd00198161 vWFA Von Willebrand factor type A (vWA) domain was 98.93
COG4867652 Uncharacterized protein with a von Willebrand fact 98.93
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 98.92
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 98.91
PRK07471365 DNA polymerase III subunit delta'; Validated 98.9
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 98.88
PTZ00441 576 sporozoite surface protein 2 (SSP2); Provisional 98.88
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 98.88
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 98.88
PRK10997487 yieM hypothetical protein; Provisional 98.87
cd01457199 vWA_ORF176_type VWA ORF176 type: Von Willebrand fa 98.85
cd01473192 vWA_CTRP CTRP for CS protein-TRAP-related protein: 98.84
PF05762222 VWA_CoxE: VWA domain containing CoxE-like protein; 98.81
COG2425437 Uncharacterized protein containing a von Willebran 98.8
TIGR00602637 rad24 checkpoint protein rad24. This family is bas 98.79
PRK15455644 PrkA family serine protein kinase; Provisional 98.78
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 98.77
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 98.76
PF08298358 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi 98.76
COG0593408 DnaA ATPase involved in DNA replication initiation 98.73
PRK08058329 DNA polymerase III subunit delta'; Validated 98.7
cd01460266 vWA_midasin VWA_Midasin: Midasin is a member of th 98.68
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 98.65
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 98.65
PRK07399314 DNA polymerase III subunit delta'; Validated 98.63
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 98.6
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 98.58
PRK05564313 DNA polymerase III subunit delta'; Validated 98.56
cd01481165 vWA_collagen_alpha3-VI-like VWA_collagen alpha 3(V 98.53
cd01458218 vWA_ku Ku70/Ku80 N-terminal domain. The Ku78 heter 98.53
PRK04132846 replication factor C small subunit; Provisional 98.52
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 98.52
KOG0990360 consensus Replication factor C, subunit RFC5 [Repl 98.51
TIGR02688449 conserved hypothetical protein TIGR02688. Members 98.5
smart00382148 AAA ATPases associated with a variety of cellular 98.5
COG1721416 Uncharacterized conserved protein (some members co 98.49
COG0470325 HolB ATPase involved in DNA replication [DNA repli 98.47
KOG1051898 consensus Chaperone HSP104 and related ATP-depende 98.45
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 98.44
PRK05707328 DNA polymerase III subunit delta'; Validated 98.41
PRK06964342 DNA polymerase III subunit delta'; Validated 98.37
PRK06871325 DNA polymerase III subunit delta'; Validated 98.33
cd01455191 vWA_F11C1-5a_type Von Willebrand factor type A (vW 98.31
PRK08769319 DNA polymerase III subunit delta'; Validated 98.27
PF12774231 AAA_6: Hydrolytic ATP binding site of dynein motor 98.26
TIGR02877371 spore_yhbH sporulation protein YhbH. This protein 98.23
KOG1969877 consensus DNA replication checkpoint protein CHL12 98.22
KOG2035351 consensus Replication factor C, subunit RFC3 [Cell 98.2
PRK08699325 DNA polymerase III subunit delta'; Validated 98.19
PRK12377248 putative replication protein; Provisional 98.18
KOG1808 1856 consensus AAA ATPase containing von Willebrand fac 98.16
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 98.16
PRK06090319 DNA polymerase III subunit delta'; Validated 98.14
PRK07993334 DNA polymerase III subunit delta'; Validated 98.1
PRK08116268 hypothetical protein; Validated 98.08
PRK06526254 transposase; Provisional 98.02
KOG0736953 consensus Peroxisome assembly factor 2 containing 97.95
PF09967126 DUF2201: VWA-like domain (DUF2201); InterPro: IPR0 97.94
PRK05325401 hypothetical protein; Provisional 97.92
PF13337457 Lon_2: Putative ATP-dependent Lon protease 97.89
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 97.87
KOG2227529 consensus Pre-initiation complex, subunit CDC6, AA 97.81
PRK08181269 transposase; Validated 97.8
TIGR02653675 Lon_rel_chp conserved hypothetical protein. This m 97.78
PF13654509 AAA_32: AAA domain; PDB: 3K1J_B. 97.77
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 97.77
PF04285421 DUF444: Protein of unknown function (DUF444); Inte 97.75
PF10138200 vWA-TerF-like: vWA found in TerF C terminus ; Inte 97.74
KOG1514767 consensus Origin recognition complex, subunit 1, a 97.66
PRK07952244 DNA replication protein DnaC; Validated 97.64
PF0188286 DUF58: Protein of unknown function DUF58; InterPro 97.62
COG3552395 CoxE Protein containing von Willebrand factor type 97.59
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 97.58
PRK09183259 transposase/IS protein; Provisional 97.56
PRK10536262 hypothetical protein; Provisional 97.52
PF13173128 AAA_14: AAA domain 97.52
COG1484254 DnaC DNA replication protein [DNA replication, rec 97.47
PF1333596 Mg_chelatase_2: Magnesium chelatase, subunit ChlI 97.46
PF11775219 CobT_C: Cobalamin biosynthesis protein CobT VWA do 97.45
PRK07276290 DNA polymerase III subunit delta'; Validated 97.45
PRK06921266 hypothetical protein; Provisional 97.42
PRK06835329 DNA replication protein DnaC; Validated 97.39
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.38
KOG2353 1104 consensus L-type voltage-dependent Ca2+ channel, a 97.35
PF06707205 DUF1194: Protein of unknown function (DUF1194); In 97.32
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 97.3
PHA01747425 putative ATP-dependent protease 97.29
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 97.28
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 97.19
PRK05917290 DNA polymerase III subunit delta'; Validated 97.13
COG2766649 PrkA Putative Ser protein kinase [Signal transduct 97.11
TIGR01651600 CobT cobaltochelatase, CobT subunit. This model de 97.1
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 97.05
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 97.04
COG4548637 NorD Nitric oxide reductase activation protein [In 97.02
PF04056193 Ssl1: Ssl1-like; InterPro: IPR007198 Ssl1-like pro 97.0
COG1618179 Predicted nucleotide kinase [Nucleotide transport 96.97
PRK08939306 primosomal protein DnaI; Reviewed 96.96
PF03215519 Rad17: Rad17 cell cycle checkpoint protein 96.93
PRK05818261 DNA polymerase III subunit delta'; Validated 96.84
PF05729166 NACHT: NACHT domain 96.78
COG2718423 Uncharacterized conserved protein [Function unknow 96.76
PRK13695174 putative NTPase; Provisional 96.72
PF05272198 VirE: Virulence-associated protein E; InterPro: IP 96.71
KOG3347176 consensus Predicted nucleotide kinase/nuclear prot 96.62
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 96.57
KOG2807 378 consensus RNA polymerase II transcription initiati 96.53
TIGR01613304 primase_Cterm phage/plasmid primase, P4 family, C- 96.49
PF03731224 Ku_N: Ku70/Ku80 N-terminal alpha/beta domain; Inte 96.46
KOG3768 888 consensus DEAD box RNA helicase [General function 96.45
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 96.41
PRK04296190 thymidine kinase; Provisional 96.39
PRK10875615 recD exonuclease V subunit alpha; Provisional 96.35
KOG2170344 consensus ATPase of the AAA+ superfamily [General 96.34
PF11443534 DUF2828: Domain of unknown function (DUF2828); Int 96.34
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 96.28
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 96.26
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 96.19
PHA02624647 large T antigen; Provisional 96.17
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 96.15
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 96.15
COG4930683 Predicted ATP-dependent Lon-type protease [Posttra 96.09
COG2304 399 Uncharacterized protein containing a von Willebran 96.06
PHA02774613 E1; Provisional 96.03
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 96.03
COG4088261 Predicted nucleotide kinase [Nucleotide transport 95.95
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 95.95
PRK14700300 recombination factor protein RarA; Provisional 95.82
PRK07132299 DNA polymerase III subunit delta'; Validated 95.72
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 95.71
PRK08118167 topology modulation protein; Reviewed 95.7
COG1936180 Predicted nucleotide kinase (related to CMP and AM 95.64
KOG2228408 consensus Origin recognition complex, subunit 4 [R 95.62
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 95.6
COG4178604 ABC-type uncharacterized transport system, permeas 95.6
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 95.54
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 95.52
KOG2884 259 consensus 26S proteasome regulatory complex, subun 95.51
KOG1051 898 consensus Chaperone HSP104 and related ATP-depende 95.41
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 95.3
PF1324576 AAA_19: Part of AAA domain 95.24
PRK03839180 putative kinase; Provisional 95.16
PHA00729226 NTP-binding motif containing protein 95.15
PRK00131175 aroK shikimate kinase; Reviewed 95.11
PRK13889988 conjugal transfer relaxase TraA; Provisional 95.04
PRK07261171 topology modulation protein; Provisional 95.01
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 95.0
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 94.97
PRK13947171 shikimate kinase; Provisional 94.92
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 94.89
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 94.87
PRK08233182 hypothetical protein; Provisional 94.87
PF13148378 DUF3987: Protein of unknown function (DUF3987) 94.85
PRK13826 1102 Dtr system oriT relaxase; Provisional 94.84
PTZ00301210 uridine kinase; Provisional 94.83
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 94.82
cd01479244 Sec24-like Sec24-like: Protein and membrane traffi 94.81
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 94.74
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 94.73
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 94.71
PRK06217183 hypothetical protein; Validated 94.71
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 94.69
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 94.69
PRK06762166 hypothetical protein; Provisional 94.69
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 94.68
PRK00625173 shikimate kinase; Provisional 94.67
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 94.62
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 94.61
PRK14532188 adenylate kinase; Provisional 94.57
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 94.56
PRK04132 846 replication factor C small subunit; Provisional 94.51
PRK13764602 ATPase; Provisional 94.5
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 94.49
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 94.47
PRK13949169 shikimate kinase; Provisional 94.47
COG1485367 Predicted ATPase [General function prediction only 94.43
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 94.43
PF06048286 DUF927: Domain of unknown function (DUF927); Inter 94.38
smart00187 423 INB Integrin beta subunits (N-terminal portion of 94.31
KOG1970634 consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 94.28
COG3864396 Uncharacterized protein conserved in bacteria [Fun 94.27
COG1373398 Predicted ATPase (AAA+ superfamily) [General funct 94.26
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 94.26
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 94.26
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 94.26
PRK14530215 adenylate kinase; Provisional 94.23
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 94.2
TIGR00578 584 ku70 ATP-dependent DNA helicase ii, 70 kDa subunit 94.19
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 94.11
cd01468239 trunk_domain trunk domain. COPII-coated vesicles c 94.1
PLN02318656 phosphoribulokinase/uridine kinase 94.08
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 94.02
PRK14531183 adenylate kinase; Provisional 93.95
COG5148 243 RPN10 26S proteasome regulatory complex, subunit R 93.92
TIGR02538564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 93.85
COG1855604 ATPase (PilT family) [General function prediction 93.84
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 93.82
cd01478 267 Sec23-like Sec23-like: Protein and membrane traffi 93.78
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 93.67
PRK02496184 adk adenylate kinase; Provisional 93.66
PTZ00202550 tuzin; Provisional 93.66
PRK04040188 adenylate kinase; Provisional 93.62
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 93.61
TIGR01618220 phage_P_loop phage nucleotide-binding protein. Thi 93.59
PRK06547172 hypothetical protein; Provisional 93.58
PRK05057172 aroK shikimate kinase I; Reviewed 93.57
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 93.52
PRK13851344 type IV secretion system protein VirB11; Provision 93.51
COG0703172 AroK Shikimate kinase [Amino acid transport and me 93.48
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 93.48
PRK05480209 uridine/cytidine kinase; Provisional 93.48
PRK05541176 adenylylsulfate kinase; Provisional 93.43
PRK13948182 shikimate kinase; Provisional 93.43
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 93.42
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 93.42
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 93.4
TIGR02533486 type_II_gspE general secretory pathway protein E. 93.38
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 93.37
PF04811243 Sec23_trunk: Sec23/Sec24 trunk domain; InterPro: I 93.34
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 93.34
PRK00771437 signal recognition particle protein Srp54; Provisi 93.3
TIGR00235207 udk uridine kinase. Model contains a number of lon 93.27
COG5245 3164 DYN1 Dynein, heavy chain [Cytoskeleton] 93.27
PF13654509 AAA_32: AAA domain; PDB: 3K1J_B. 93.26
PRK10436462 hypothetical protein; Provisional 93.23
PRK14527191 adenylate kinase; Provisional 93.2
PHA02530300 pseT polynucleotide kinase; Provisional 93.19
PRK00279215 adk adenylate kinase; Reviewed 93.18
PRK00300205 gmk guanylate kinase; Provisional 93.17
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 93.16
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 93.16
PF11265226 Med25_VWA: Mediator complex subunit 25 von Willebr 93.09
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 93.09
PLN02200234 adenylate kinase family protein 93.05
PF1355562 AAA_29: P-loop containing region of AAA domain 93.02
PRK06696223 uridine kinase; Validated 92.93
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 92.91
PRK03731171 aroL shikimate kinase II; Reviewed 92.91
PRK14528186 adenylate kinase; Provisional 92.88
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 92.88
PTZ00088229 adenylate kinase 1; Provisional 92.83
PRK00889175 adenylylsulfate kinase; Provisional 92.81
PRK13833323 conjugal transfer protein TrbB; Provisional 92.8
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 92.69
PF01057271 Parvo_NS1: Parvovirus non-structural protein NS1; 92.66
PF12780268 AAA_8: P-loop containing dynein motor region D4; I 92.6
PRK09825176 idnK D-gluconate kinase; Provisional 92.53
PLN02165334 adenylate isopentenyltransferase 92.52
PRK13946184 shikimate kinase; Provisional 92.5
PRK04182180 cytidylate kinase; Provisional 92.48
cd01918149 HprK_C HprK/P, the bifunctional histidine-containi 92.47
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 92.46
PRK14712 1623 conjugal transfer nickase/helicase TraI; Provision 92.38
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 92.37
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 92.35
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 92.32
COG4547620 CobT Cobalamin biosynthesis protein CobT (nicotina 92.27
cd01124187 KaiC KaiC is a circadian clock protein primarily f 92.25
PRK14526211 adenylate kinase; Provisional 92.13
PLN03210 1153 Resistant to P. syringae 6; Provisional 92.11
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 92.07
PF02367123 UPF0079: Uncharacterised P-loop hydrolase UPF0079; 91.99
PRK13975196 thymidylate kinase; Provisional 91.98
COG4619223 ABC-type uncharacterized transport system, ATPase 91.96
PRK12339197 2-phosphoglycerate kinase; Provisional 91.87
PRK13894319 conjugal transfer ATPase TrbB; Provisional 91.81
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information 
Probab=100.00  E-value=8.9e-84  Score=744.40  Aligned_cols=564  Identities=42%  Similarity=0.669  Sum_probs=465.2

Q ss_pred             CCCCceechHHHHHHHHHhhhcCCCccEEEECCCCCHHHHHHHHHHhhCCCceeeccccccCCCCCCCcccccccccccc
Q 005520           92 FPLAAVVGQDAIKTALLLGAIDREIGGIAISGRRGTAKTVMARGLHAILPPIEVVVGSIANADPTCPDEWEDGLDEKAEY  171 (692)
Q Consensus        92 ~~f~~IvGq~~~k~aL~l~~v~p~~~~VLL~G~pGTGKTtlAraLa~~l~~~~~i~~~~~nc~p~~~~~~~~~~~~~i~~  171 (692)
                      |||++|+||+.++++|++++++|..+||||+|++|||||++||+|+.++|++.++.+|.|||+|+.+..||..|......
T Consensus         1 ~pf~~ivGq~~~~~al~~~av~~~~g~vli~G~~GtgKs~lar~l~~~lp~~~~~~~~~~~c~p~~~~~~~~~~~~~~~~   80 (633)
T TIGR02442         1 FPFTAIVGQEDLKLALLLNAVDPRIGGVLIRGEKGTAKSTAARGLAALLPPIDVVAGCPFSCDPDDPEEWCEECRRKYRP   80 (633)
T ss_pred             CCcchhcChHHHHHHHHHHhhCCCCCeEEEEcCCCCcHHHHHHHHHHhCCCceeccCCcCCCCCCCccccChhhhhcccc
Confidence            79999999999999999999999999999999999999999999999999999999999999999999999999873221


Q ss_pred             cccccccccccCCCeEEcCCCCcccceeeecchhhhcccCCcccccCccccccCceEEecccccCCHHHHHHHHHHHHcC
Q 005520          172 DTAGNLKTQIARSPFVQIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLAEAHRGVLYIDEINLLDEGISNLLLNVLTEG  251 (692)
Q Consensus       172 ~~~~~~~~~~~~~pfv~l~~~~~e~~L~G~~d~~~~~~~g~~~~~~Gll~~A~~giL~IDEI~~L~~~~~~~Ll~~l~~g  251 (692)
                             ......||+.+|++.++++|+|++|+++++..|...+++|+|.+|++||||||||++|++.+|+.|+.+|++|
T Consensus        81 -------~~~~~~pfv~~p~~~t~~~l~G~~d~~~~l~~g~~~~~~G~L~~A~~GiL~lDEi~~l~~~~q~~Ll~~le~g  153 (633)
T TIGR02442        81 -------SEQRPVPFVNLPLGATEDRVVGSLDIERALREGEKAFQPGLLAEAHRGILYIDEVNLLDDHLVDVLLDAAAMG  153 (633)
T ss_pred             -------cccCCCCeeeCCCCCcHHHcCCcccHHHHhhcCCeeecCcceeecCCCeEEeChhhhCCHHHHHHHHHHHhcC
Confidence                   1123689999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ceeeeeCCeeeeecCccEEEEeecCCCCCchHHHHHhhcccccCCCCCCHHHHHHHHHHHHHHhhhhhHHhhhhhhhhHH
Q 005520          252 VNIVEREGISFKHPCKPLLIATYNPEEGVVREHLLDRIAINLSADLPMTFEDRVAAVGIATQFQERSNEVFKMVEEETDL  331 (692)
Q Consensus       252 ~~~v~r~G~~~~~p~~~~lIattNp~eg~l~~~LldRf~~~v~v~~p~~~~~r~eI~~~~~~f~~~~~~~~~~~~~~~~~  331 (692)
                      .+.|+|+|.+..+|++|+||+|+||+++.|+++|+|||+++|.+..+.+.+++.+++.....|..++..|...|......
T Consensus       154 ~~~v~r~g~~~~~~~~~~lIat~np~eg~l~~~L~dR~~l~i~v~~~~~~~~~~~il~~~~~~~~~~~~~~~~~~~~~~~  233 (633)
T TIGR02442       154 VNRVEREGLSVSHPARFVLIGTMNPEEGDLRPQLLDRFGLCVDVAAPRDPEERVEIIRRRLAFDADPEAFAARWAAEQEE  233 (633)
T ss_pred             CEEEEECCceeeecCCeEEEEecCCCCCCCCHHHHhhcceEEEccCCCchHHHHHHHHHHHhhccCcHHHHHHhhhhHHH
Confidence            99999999999999999999999999999999999999999999987778889999988888877887787788777778


Q ss_pred             HHHHHHHHHHhhccCCCCHHHHHHHHHHHHhcCCCChhHHHHHHHHHHHHHHHcCCCCccHHHHHHHHHHHcCCCccCCC
Q 005520          332 AKTQIILAREYLKDVAIGREQLKYLVMEALRGGCQGHRAELYAARVAKCLAALEGREKVNVDDLKKAVELVILPRSIINE  411 (692)
Q Consensus       332 l~~~i~~ar~~l~~v~is~~~l~~L~~~~~~~~v~s~R~~i~llr~A~a~Aal~gr~~Vt~eDv~~A~~lvl~hR~~~~~  411 (692)
                      +...|..++.+++.|.++++++++|++++..+|+.|+|+.+.++++|+++|+|+|+++|+.+||.+|+.+||.||++..+
T Consensus       234 l~~~i~~ar~~~~~V~is~~~~~~l~~~~~~~~i~s~Ra~i~~~r~Ara~AaL~gr~~V~~~Dv~~A~~lvL~hR~~~~p  313 (633)
T TIGR02442       234 LRNRIARARSLLPSVRISDSLIRFISELCIEFGVDGHRADIVMARAARALAALDGRRRVTAEDVREAAELVLPHRRRRKP  313 (633)
T ss_pred             HHHHHHHHHHhCCCCCCCHHHHHHHHHHHHHhCCCCccHHHHHHHHHHHHHHHcCCCcCCHHHHHHHHHHHhhhhccCCC
Confidence            88999999999999999999999999999999999999999999999999999999999999999999999999998654


Q ss_pred             CCCC---CCCC---C-CCCCCCCCCCCCCCcccCccccccC-CCCcchhhccc--CCC---cccccccCCCCcchhhhHH
Q 005520          412 TPPE---QQNQ---Q-PPPPPPPQNQDSGEEEQNEEEDQED-ENDEENEQQQE--QLP---EEFIFDAEGGLVDEKLLFF  478 (692)
Q Consensus       412 ~~~~---~~~~---~-~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~--~~~---~~~~~~~~~~~~~~~~~~~  478 (692)
                      .+.+   ++++   + ++++++++.++++++++.++.++++ ++.++++++++  ..+   .+.+++++. .+.++++.+
T Consensus       314 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~  392 (633)
T TIGR02442       314 FEQPQGKDEKDLEEKPEEPGPDPEKPDEGEDDAEQSGPRGHPTPGNDDEKEPDPQEEADGQGSSTDPAGD-IFRIRVLAP  392 (633)
T ss_pred             cccCCCCCccccccccCCCCCCCCCCCccccccccccccccccccccccccccccCCCCCCcccccCccc-ccCcchhcc
Confidence            2211   1100   0 1111111000101000000000000 00000000111  001   123466555 455566665


Q ss_pred             HHHHhhhcCCCCCcccccccCCCCccccccCCCCCCcccchHHhHHhhCchhhhhhhcccccCcceeeeccchhhhhhhc
Q 005520          479 AQQAQRRRGKAGRAKNVIFSEDRGRYIKPMLPKGPIKRLAVDATLRAAAPYQKLRRERDTQKTRKVFVEKTDMRAKRMAR  558 (692)
Q Consensus       479 ~~~~~~~~~~~g~~~~~~~~~~~Gr~~~~~~~~~~~~~i~~~~Tlr~aap~q~~r~~~~~~~~~~~~~~~~dl~~~~~~~  558 (692)
                      ....  .++++||++ ...+..||||+++..++++.++|||++|||+|+|||+.|      .+ .+.|.++||+++++++
T Consensus       393 ~~~~--~~~~~g~~~-~~~~~~rGr~~~~~~~~~~~~~i~~~aTlr~aa~~q~~r------~~-~~~i~~~dl~~~~~~~  462 (633)
T TIGR02442       393 PQAR--ARGASGRRS-RTRSDSRGRYVRARRNRGPPDDLAVDATLRAAAPHQRAR------PG-AVAVEPEDLREKIRAG  462 (633)
T ss_pred             cccc--ccCCCCCCc-ccccCCCCeeeeccCCCCCCCccCHHHHHHHhccccccc------CC-cceechhhhhHHHhcC
Confidence            4321  223466554 333458999999998876667899999999999999876      12 6899999999999999


Q ss_pred             cCCceEEEEEeCCCCCCc-hHHHHHHHHHHHHHHHhcCCCCeEEEEEeeCCCcEEEcCCCccHHHHHHHhhcCCCCCCCc
Q 005520          559 KAGALVIFVVDASGSMAL-NRMQNAKGAALKLLAESYTCRDQVSIIPFRGDSAEVLLPPSRSIAMARKRLERLPCGGGSP  637 (692)
Q Consensus       559 ~~~~~v~~vvD~SgSM~~-~r~~~ak~a~~~ll~~a~~~rd~v~li~F~~~~a~~~lp~t~~~~~~~~~L~~l~~gG~Tp  637 (692)
                      +.+..|+||||+||||.+ +||..+|+++..|+.++|..+|+|+||+|+|+.+++++|+|++...+...|..+++||+||
T Consensus       463 r~~~~vv~vvD~SgSM~~~~rl~~ak~a~~~ll~~a~~~~D~v~lI~F~g~~a~~~~p~t~~~~~~~~~L~~l~~gG~Tp  542 (633)
T TIGR02442       463 RAGNLVIFVVDASGSMAARGRMAAAKGAVLSLLRDAYQKRDKVALITFRGEEAEVLLPPTSSVELAARRLEELPTGGRTP  542 (633)
T ss_pred             CCCceEEEEEECCccCCCccHHHHHHHHHHHHHHHhhcCCCEEEEEEECCCCceEEcCCCCCHHHHHHHHHhCCCCCCCC
Confidence            999999999999999987 6999999999999999999999999999988789999999999999999999999999999


Q ss_pred             hHHHHHHHHHHhcccCCC-CCCceEEEEccCCCCccccCCCCCC
Q 005520          638 LAHGLSMVCRSVKPHHCG-ILTKKFLRCWWLLLSETIDERLNVA  680 (692)
Q Consensus       638 L~~gl~~a~~~l~~~~~~-~~~~~~vvl~~~~~~~lTDG~~n~~  680 (692)
                      |++||..|++++.....+ ...+++|||       ||||+.|++
T Consensus       543 l~~aL~~A~~~l~~~~~~~~~~~~~vvl-------iTDG~~n~~  579 (633)
T TIGR02442       543 LAAGLLKAAEVLSNELLRDDDGRPLLVV-------ITDGRANVA  579 (633)
T ss_pred             HHHHHHHHHHHHHHhhccCCCCceEEEE-------ECCCCCCCC
Confidence            999999999998843211 124568888       999999997

A number of genomes (actinobacteria, cyanobacteria, betaproteobacteria and pseudomonads) which apparently biosynthesize B12, encode a cobN gene but are demonstrably lacking cobS and cobT. These genomes do, however contain a homolog (modelled here) of the magnesium chelatase subunits BchI/BchD family. Aside from the cyanobacteria (which have a separate magnesium chelatase trimer), these species do not make chlorins, so do not have any use for a magnesium chelatase. Furthermore, in nearly all cases the members of this family are proximal to either CobN itself or other genes involved in cobalt transport or B12 biosynthesis.
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>COG1240 ChlD Mg-chelatase subunit ChlD [Coenzyme metabolism] Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>PTZ00111 DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0480 consensus DNA replication licensing factor, MCM6 component [Replication, recombination and repair] Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0478 consensus DNA replication licensing factor, MCM4 component [Replication, recombination and repair] Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0482 consensus DNA replication licensing factor, MCM7 component [Replication, recombination and repair] Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>KOG0479 consensus DNA replication licensing factor, MCM3 component [Replication, recombination and repair] Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>KOG0477 consensus DNA replication licensing factor, MCM2 component [Replication, recombination and repair] Back     alignment and domain information
>cd01451 vWA_Magnesium_chelatase Magnesium chelatase: Mg-chelatase catalyses the insertion of Mg into protoporphyrin IX (Proto) Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>KOG0481 consensus DNA replication licensing factor, MCM5 component [Replication, recombination and repair] Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG4650 RtcR Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd01466 vWA_C3HC4_type VWA C3HC4-type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01463 vWA_VGCC_like VWA Voltage gated Calcium channel like: Voltage-gated calcium channels are a complex of five proteins: alpha 1, beta 1, gamma, alpha 2 and delta Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd01454 vWA_norD_type norD type: Denitrifying bacteria contain both membrane bound and periplasmic nitrate reductases Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>cd01472 vWA_collagen von Willebrand factor (vWF) type A domain; equivalent to the I-domain of integrins Back     alignment and domain information
>cd01456 vWA_ywmD_type VWA ywmD type:Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01462 VWA_YIEM_type VWA YIEM type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd01470 vWA_complement_factors Complement factors B and C2 are two critical proteases for complement activation Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd01465 vWA_subgroup VWA subgroup: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01464 vWA_subfamily VWA subfamily: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK13685 hypothetical protein; Provisional Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG4245 TerY Uncharacterized protein encoded in toxicity protection region of plasmid R478, contains von Willebrand factor (vWF) domain [General function prediction only] Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>cd01480 vWA_collagen_alpha_1-VI-type VWA_collagen alpha(VI) type: The extracellular matrix represents a complex alloy of variable members of diverse protein families defining structural integrity and various physiological functions Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd01453 vWA_transcription_factor_IIH_type Transcription factors IIH type: TFIIH is a multiprotein complex that is one of the five general transcription factors that binds RNA polymerase II holoenzyme Back     alignment and domain information
>cd01482 vWA_collagen_alphaI-XII-like Collagen: The extracellular matrix represents a complex alloy of variable members of diverse protein families defining structural integrity and various physiological functions Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>cd01474 vWA_ATR ATR (Anthrax Toxin Receptor): Anthrax toxin is a key virulence factor for Bacillus anthracis, the causative agent of anthrax Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd01461 vWA_interalpha_trypsin_inhibitor vWA_interalpha trypsin inhibitor (ITI): ITI is a glycoprotein composed of three polypeptides- two heavy chains and one light chain (bikunin) Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01467 vWA_BatA_type VWA BatA type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01471 vWA_micronemal_protein Micronemal proteins: The Toxoplasma lytic cycle begins when the parasite actively invades a target cell Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03436 acidobact_VWFA VWFA-related Acidobacterial domain Back     alignment and domain information
>TIGR00868 hCaCC calcium-activated chloride channel protein 1 Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>cd01476 VWA_integrin_invertebrates VWA_integrin (invertebrates): Integrins are a family of cell surface receptors that have diverse functions in cell-cell and cell-extracellular matrix interactions Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13519 VWA_2: von Willebrand factor type A domain; PDB: 3IBS_B 3RAG_B 2X5N_A Back     alignment and domain information
>cd01452 VWA_26S_proteasome_subunit 26S proteasome plays a major role in eukaryotic protein breakdown, especially for ubiquitin-tagged proteins Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>cd01450 vWFA_subfamily_ECM Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>PF13768 VWA_3: von Willebrand factor type A domain Back     alignment and domain information
>TIGR03788 marine_srt_targ marine proteobacterial sortase target protein Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>smart00327 VWA von Willebrand factor (vWF) type A domain Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>cd01477 vWA_F09G8-8_type VWA F09G8 Back     alignment and domain information
>COG1067 LonB Predicted ATP-dependent protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>cd01469 vWA_integrins_alpha_subunit Integrins are a class of adhesion receptors that link the extracellular matrix to the cytoskeleton and cooperate with growth factor receptors to promote celll survival, cell cycle progression and cell migration Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00092 VWA: von Willebrand factor type A domain; InterPro: IPR002035 The von Willebrand factor is a large multimeric glycoprotein found in blood plasma Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>cd00198 vWFA Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>COG4867 Uncharacterized protein with a von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00441 sporozoite surface protein 2 (SSP2); Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK10997 yieM hypothetical protein; Provisional Back     alignment and domain information
>cd01457 vWA_ORF176_type VWA ORF176 type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>cd01473 vWA_CTRP CTRP for CS protein-TRAP-related protein: Adhesion of Plasmodium to host cells is an important phenomenon in parasite invasion and in malaria associated pathology Back     alignment and domain information
>PF05762 VWA_CoxE: VWA domain containing CoxE-like protein; InterPro: IPR008912 This group of proteins contains a VWA type domain and the function of this family is unknown Back     alignment and domain information
>COG2425 Uncharacterized protein containing a von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd01460 vWA_midasin VWA_Midasin: Midasin is a member of the AAA ATPase family Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd01481 vWA_collagen_alpha3-VI-like VWA_collagen alpha 3(VI) like: The extracellular matrix represents a complex alloy of variable members of diverse protein families defining structural integrity and various physiological functions Back     alignment and domain information
>cd01458 vWA_ku Ku70/Ku80 N-terminal domain Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair] Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>COG1721 Uncharacterized conserved protein (some members contain a von Willebrand factor type A (vWA) domain) [General function prediction only] Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd01455 vWA_F11C1-5a_type Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF) Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>TIGR02877 spore_yhbH sporulation protein YhbH Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>KOG1808 consensus AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09967 DUF2201: VWA-like domain (DUF2201); InterPro: IPR018698 This family of various hypothetical bacterial proteins has no known function Back     alignment and domain information
>PRK05325 hypothetical protein; Provisional Back     alignment and domain information
>PF13337 Lon_2: Putative ATP-dependent Lon protease Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>TIGR02653 Lon_rel_chp conserved hypothetical protein Back     alignment and domain information
>PF13654 AAA_32: AAA domain; PDB: 3K1J_B Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04285 DUF444: Protein of unknown function (DUF444); InterPro: IPR006698 This entry is represented by Thermus phage phiYS40, Orf56 Back     alignment and domain information
>PF10138 vWA-TerF-like: vWA found in TerF C terminus ; InterPro: IPR019303 This entry represents the N-terminal domain of a family of proteins that confer resistance to the metalloid element tellurium and its salts Back     alignment and domain information
>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF01882 DUF58: Protein of unknown function DUF58; InterPro: IPR002881 This domain is found in a family of prokaryotic proteins that have no known function Back     alignment and domain information
>COG3552 CoxE Protein containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13335 Mg_chelatase_2: Magnesium chelatase, subunit ChlI Back     alignment and domain information
>PF11775 CobT_C: Cobalamin biosynthesis protein CobT VWA domain Back     alignment and domain information
>PRK07276 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>KOG2353 consensus L-type voltage-dependent Ca2+ channel, alpha2/delta subunit [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF06707 DUF1194: Protein of unknown function (DUF1194); InterPro: IPR010607 This family consists of several hypothetical Rhizobiales specific proteins of around 270 residues in length Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PHA01747 putative ATP-dependent protease Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG2766 PrkA Putative Ser protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01651 CobT cobaltochelatase, CobT subunit Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>COG4548 NorD Nitric oxide reductase activation protein [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF04056 Ssl1: Ssl1-like; InterPro: IPR007198 Ssl1-like proteins are 40 kDa subunits of the transcription factor II H complex Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PRK05818 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>COG2718 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PF05272 VirE: Virulence-associated protein E; InterPro: IPR007936 This family contains several bacterial virulence-associated protein E like proteins Back     alignment and domain information
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>KOG2807 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>TIGR01613 primase_Cterm phage/plasmid primase, P4 family, C-terminal domain Back     alignment and domain information
>PF03731 Ku_N: Ku70/Ku80 N-terminal alpha/beta domain; InterPro: IPR005161 The Ku heterodimer (composed of Ku70 P12956 from SWISSPROT and Ku80 P13010 from SWISSPROT) contributes to genomic integrity through its ability to bind DNA double-strand breaks and facilitate repair by the non-homologous end-joining pathway Back     alignment and domain information
>KOG3768 consensus DEAD box RNA helicase [General function prediction only] Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>KOG2170 consensus ATPase of the AAA+ superfamily [General function prediction only] Back     alignment and domain information
>PF11443 DUF2828: Domain of unknown function (DUF2828); InterPro: IPR024553 This uncharacterised domain is found in eukaryotic, bacterial and viral proteins Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>COG4930 Predicted ATP-dependent Lon-type protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2304 Uncharacterized protein containing a von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PHA02774 E1; Provisional Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK14700 recombination factor protein RarA; Provisional Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG2884 consensus 26S proteasome regulatory complex, subunit RPN10/PSMD4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PF13148 DUF3987: Protein of unknown function (DUF3987) Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>cd01479 Sec24-like Sec24-like: Protein and membrane traffic in eukaryotes is mediated by at least in part by the budding and fusion of intracellular transport vesicles that selectively carry cargo proteins and lipids from donor to acceptor organelles Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>COG1485 Predicted ATPase [General function prediction only] Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>PF06048 DUF927: Domain of unknown function (DUF927); InterPro: IPR009270 This entry is represented by Bacteriophage PT1028, Orf1 Back     alignment and domain information
>smart00187 INB Integrin beta subunits (N-terminal portion of extracellular region) Back     alignment and domain information
>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>COG3864 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>TIGR00578 ku70 ATP-dependent DNA helicase ii, 70 kDa subunit (ku70) Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>cd01468 trunk_domain trunk domain Back     alignment and domain information
>PLN02318 phosphoribulokinase/uridine kinase Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>COG5148 RPN10 26S proteasome regulatory complex, subunit RPN10/PSMD4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>COG1855 ATPase (PilT family) [General function prediction only] Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>cd01478 Sec23-like Sec23-like: Protein and membrane traffic in eukaryotes is mediated by at least in part by the budding and fusion of intracellular transport vesicles that selectively carry cargo proteins and lipids from donor to acceptor organelles Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>PF04811 Sec23_trunk: Sec23/Sec24 trunk domain; InterPro: IPR006896 COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex [] Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>COG5245 DYN1 Dynein, heavy chain [Cytoskeleton] Back     alignment and domain information
>PF13654 AAA_32: AAA domain; PDB: 3K1J_B Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>PF11265 Med25_VWA: Mediator complex subunit 25 von Willebrand factor type A; InterPro: IPR021419 The overall function of the full-length Med25 is efficiently to coordinate the transcriptional activation of RAR/RXR (retinoic acid receptor/retinoic X receptor) in higher eukaryotic cells Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>PF01057 Parvo_NS1: Parvovirus non-structural protein NS1; InterPro: IPR001257 Parvoviruses are some of the smallest viruses containing linear, non-segmented single-stranded DNA genomes, with an average genome size of 5000 nucleotides Back     alignment and domain information
>PF12780 AAA_8: P-loop containing dynein motor region D4; InterPro: IPR024317 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>COG4547 CobT Cobalamin biosynthesis protein CobT (nicotinate-mononucleotide:5, 6-dimethylbenzimidazole phosphoribosyltransferase) [Coenzyme metabolism] Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query692
1g8p_A350 Crystal Structure Of Bchi Subunit Of Magnesium Chel 2e-51
2x31_A189 Modelling Of The Complex Between Subunits Bchi And 6e-12
>pdb|1G8P|A Chain A, Crystal Structure Of Bchi Subunit Of Magnesium Chelatase Length = 350 Back     alignment and structure 
Iteration: 1

 Score =  200 bits (508), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 122/317 (38%), Positives = 173/317 (54%), Gaps = 13/317 (4%)
Query: 89  RQFFPLAAVVGQDAIKTALLLGAIDREIGGIAISGRRGTAKTVMARGLHAILPPIEVVVG 148
           R  FP +A+VGQ+ +K ALLL A+D  IGG+ + G RGT K+   R L A+LP IE V G
Sbjct: 18  RPVFPFSAIVGQEDMKLALLLTAVDPGIGGVLVFGDRGTGKSTAVRALAALLPEIEAVEG 77
Query: 149 SIANADPTCPDEWEDGLDEKAEYDTAGNLKTQIAR--SPFVQIPLGVTEDRLIGSVDVEE 206
                   CP       + +   D A  L T + R  +P V +PLGV+EDR++G++D+E 
Sbjct: 78  --------CP---VSSPNVEMIPDWATVLSTNVIRKPTPVVDLPLGVSEDRVVGALDIER 126
Query: 207 SVKTGTTVFQPGLLAEAHRGVLYIDEINLLDEGISNLLLNVLTEGVNIVEREGISFKHPC 266
           ++  G   F+PGLLA A+RG LYIDE NLL++ I +LLL+V   G N+VER+G+S +HP 
Sbjct: 127 AISKGEKAFEPGLLARANRGYLYIDECNLLEDHIVDLLLDVAQSGENVVERDGLSIRHPA 186
Query: 267 KPLLIATYNPEEGVVREHLLDRIAINLSADLPMTFEDRVAAVGIATQFQERSNEVFKMVE 326
           + +L+ + NPEEG +R  LLDR  +++    P   E RV  +     +        +   
Sbjct: 187 RFVLVGSGNPEEGDLRPQLLDRFGLSVEVLSPRDVETRVEVIRRRDTYDADPKAFLEEWR 246
Query: 327 EETDLAKTQIILAREYLKDVAIGREQLKYLVMEALRGGCQGHRAELYAARVAKCLAALEG 386
            +    + QI+ ARE L  V      L       +  G  G R EL   R A+ LAALEG
Sbjct: 247 PKDMDIRNQILEARERLPKVEAPNTALYDCAALCIALGSDGLRGELTLLRSARALAALEG 306
Query: 387 REKVNVDDLKKAVELVI 403
              V  D LK+   + +
Sbjct: 307 ATAVGRDHLKRVATMAL 323
>pdb|2X31|A Chain A, Modelling Of The Complex Between Subunits Bchi And Bchd Of Magnesium Chelatase Based On Single-Particle Cryo-Em Reconstruction At 7.5 Ang Length = 189 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query692
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 1e-110
2x31_A189 Magnesium-chelatase 60 kDa subunit; ligase, bacter 7e-30
3rag_A242 Uncharacterized protein; structural genomics, PSI- 2e-19
3nbx_X500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 4e-12
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 2e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
3k1j_A604 LON protease, ATP-dependent protease LON; ATP-bind 2e-09
4fx5_A 464 VON willebrand factor type A; structural genomics, 1e-08
2x5n_A192 SPRPN10, 26S proteasome regulatory subunit RPN10; 3e-07
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 4e-04
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Length = 350 Back     alignment and structure
 Score =  335 bits (861), Expect = e-110
 Identities = 116/334 (34%), Positives = 168/334 (50%), Gaps = 9/334 (2%)

Query: 73  ANGAVAAASEDQDSYGRQFFPLAAVVGQDAIKTALLLGAIDREIGGIAISGRRGTAKTVM 132
                        +  R  FP +A+VGQ+ +K ALLL A+D  IGG+ + G RGT K+  
Sbjct: 2   TTAVARLQPSASGAKTRPVFPFSAIVGQEDMKLALLLTAVDPGIGGVLVFGDRGTGKSTA 61

Query: 133 ARGLHAILPPIEVVVGSIANADPTCPDEWEDGLDEKAEYDTAGNLKTQIARSPFVQIPLG 192
            R L A+LP IE V G   ++           +                  +P V +PLG
Sbjct: 62  VRALAALLPEIEAVEGCPVSSPNVEMIPDWATVLST---------NVIRKPTPVVDLPLG 112

Query: 193 VTEDRLIGSVDVEESVKTGTTVFQPGLLAEAHRGVLYIDEINLLDEGISNLLLNVLTEGV 252
           V+EDR++G++D+E ++  G   F+PGLLA A+RG LYIDE NLL++ I +LLL+V   G 
Sbjct: 113 VSEDRVVGALDIERAISKGEKAFEPGLLARANRGYLYIDECNLLEDHIVDLLLDVAQSGE 172

Query: 253 NIVEREGISFKHPCKPLLIATYNPEEGVVREHLLDRIAINLSADLPMTFEDRVAAVGIAT 312
           N+VER+G+S +HP + +L+ + NPEEG +R  LLDR  +++    P   E RV  +    
Sbjct: 173 NVVERDGLSIRHPARFVLVGSGNPEEGDLRPQLLDRFGLSVEVLSPRDVETRVEVIRRRD 232

Query: 313 QFQERSNEVFKMVEEETDLAKTQIILAREYLKDVAIGREQLKYLVMEALRGGCQGHRAEL 372
            +        +    +    + QI+ ARE L  V      L       +  G  G R EL
Sbjct: 233 TYDADPKAFLEEWRPKDMDIRNQILEARERLPKVEAPNTALYDCAALCIALGSDGLRGEL 292

Query: 373 YAARVAKCLAALEGREKVNVDDLKKAVELVILPR 406
              R A+ LAALEG   V  D LK+   + +  R
Sbjct: 293 TLLRSARALAALEGATAVGRDHLKRVATMALSHR 326
>2x31_A Magnesium-chelatase 60 kDa subunit; ligase, bacteriochlorophyll biosynthesis, photosynthesis; 7.50A {Rhodobacter capsulatus} Length = 189 Back     alignment and structure
>3rag_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tructural genomics; 1.80A {Alicyclobacillus acidocaldarius subsp} Length = 242 Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Length = 500 Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Length = 368 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Length = 604 Back     alignment and structure
>4fx5_A VON willebrand factor type A; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, blood clotting; HET: MSE; 1.73A {Catenulispora acidiphila} Length = 464 Back     alignment and structure
>2x5n_A SPRPN10, 26S proteasome regulatory subunit RPN10; nuclear protein, nucleus, ubiquitin; 1.30A {Schizosaccharomyces pombe} Length = 192 Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Length = 456 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 692
d1g8pa_333 c.37.1.20 (A:) ATPase subunit of magnesium chelata 4e-59
d1ny5a2247 c.37.1.20 (A:138-384) Transcriptional activator si 1e-08
d1q0pa_209 c.62.1.1 (A:) Complement factor B domain {Human (H 5e-06
d1shux_181 c.62.1.1 (X:) Capillary morphogenesis protein 2 do 6e-06
d1mf7a_194 c.62.1.1 (A:) Integrin alpha M (CR3, CD11b/CD18, M 3e-04
d1yvra2174 c.62.1.5 (A:364-537) 60-kda SS-A/Ro ribonucleoprot 6e-04
d1jeya2220 c.62.1.3 (A:34-253) Ku70 subunit N-terminal domain 6e-04
d1n3ya_189 c.62.1.1 (A:) Integrin alpha-x beta2 {Human (Homo 7e-04
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Length = 333 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: ATPase subunit of magnesium chelatase, BchI
species: Rhodobacter capsulatus [TaxId: 1061]

 Score =  200 bits (509), Expect = 4e-59
 Identities = 117/318 (36%), Positives = 170/318 (53%), Gaps = 9/318 (2%)

Query: 89  RQFFPLAAVVGQDAIKTALLLGAIDREIGGIAISGRRGTAKTVMARGLHAILPPIEVVVG 148
           R  FP +A+VGQ+ +K ALLL A+D  IGG+ + G RGT K+   R L A+LP IE V G
Sbjct: 1   RPVFPFSAIVGQEDMKLALLLTAVDPGIGGVLVFGDRGTGKSTAVRALAALLPEIEAVEG 60

Query: 149 SIANADPTCPDEWEDGLDEKAEYDTAGNLKTQIARSPFVQIPLGVTEDRLIGSVDVEESV 208
              ++                ++ T  +       +P V +PLGV+EDR++G++D+E ++
Sbjct: 61  CPVSSPNVEMI---------PDWATVLSTNVIRKPTPVVDLPLGVSEDRVVGALDIERAI 111

Query: 209 KTGTTVFQPGLLAEAHRGVLYIDEINLLDEGISNLLLNVLTEGVNIVEREGISFKHPCKP 268
             G   F+PGLLA A+RG LYIDE NLL++ I +LLL+V   G N+VER+G+S +HP + 
Sbjct: 112 SKGEKAFEPGLLARANRGYLYIDECNLLEDHIVDLLLDVAQSGENVVERDGLSIRHPARF 171

Query: 269 LLIATYNPEEGVVREHLLDRIAINLSADLPMTFEDRVAAVGIATQFQERSNEVFKMVEEE 328
           +L+ + NPEEG +R  LLDR  +++    P   E RV  +     +        +    +
Sbjct: 172 VLVGSGNPEEGDLRPQLLDRFGLSVEVLSPRDVETRVEVIRRRDTYDADPKAFLEEWRPK 231

Query: 329 TDLAKTQIILAREYLKDVAIGREQLKYLVMEALRGGCQGHRAELYAARVAKCLAALEGRE 388
               + QI+ ARE L  V      L       +  G  G R EL   R A+ LAALEG  
Sbjct: 232 DMDIRNQILEARERLPKVEAPNTALYDCAALCIALGSDGLRGELTLLRSARALAALEGAT 291

Query: 389 KVNVDDLKKAVELVILPR 406
            V  D LK+   + +  R
Sbjct: 292 AVGRDHLKRVATMALSHR 309
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 247 Back     information, alignment and structure
>d1q0pa_ c.62.1.1 (A:) Complement factor B domain {Human (Homo sapiens) [TaxId: 9606]} Length = 209 Back     information, alignment and structure
>d1shux_ c.62.1.1 (X:) Capillary morphogenesis protein 2 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 181 Back     information, alignment and structure
>d1mf7a_ c.62.1.1 (A:) Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 194 Back     information, alignment and structure
>d1yvra2 c.62.1.5 (A:364-537) 60-kda SS-A/Ro ribonucleoprotein, RoRNP {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 174 Back     information, alignment and structure
>d1jeya2 c.62.1.3 (A:34-253) Ku70 subunit N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 220 Back     information, alignment and structure
>d1n3ya_ c.62.1.1 (A:) Integrin alpha-x beta2 {Human (Homo sapiens) [TaxId: 9606]} Length = 189 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query692
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 100.0
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 99.92
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 99.87
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 99.85
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 99.85
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 99.83
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.8
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 99.79
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.76
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 99.74
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 99.74
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.73
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 99.73
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 99.72
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 99.71
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 99.67
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 99.67
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.67
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.65
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 99.59
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 99.56
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 99.55
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.52
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.5
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 99.49
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 99.47
d1q0pa_209 Complement factor B domain {Human (Homo sapiens) [ 99.38
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 99.33
d1shux_181 Capillary morphogenesis protein 2 domain {Human (H 99.27
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 99.27
d1atza_184 von Willebrand factor A3 domain, vWA3 {Human (Homo 99.21
d1jeya2220 Ku70 subunit N-terminal domain {Human (Homo sapien 99.19
d1yvra2174 60-kda SS-A/Ro ribonucleoprotein, RoRNP {African c 99.17
d1mjna_179 Integrin CD11a/CD18 (Leukocyte function associated 99.16
d1jeyb2236 Ku80 subunit N-terminal domain {Human (Homo sapien 99.15
d1mf7a_194 Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha sub 99.12
d1n3ya_189 Integrin alpha-x beta2 {Human (Homo sapiens) [TaxI 99.11
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 99.07
d1v7pc_193 Integrin alpha2-beta1 {Human (Homo sapiens) [TaxId 99.06
d1ijba_202 von Willebrand factor A1 domain, vWA1 {Human (Homo 99.01
d1pt6a_192 Integrin alpha1-beta1 {Human (Homo sapiens) [TaxId 98.9
d1svma_362 Papillomavirus large T antigen helicase domain {Si 98.7
d1tyeb2248 Integrin beta A domain {Human (Homo sapiens) [TaxI 98.44
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 98.38
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 98.12
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 97.83
d1tuea_205 Replication protein E1 helicase domain {Human papi 97.48
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 97.08
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.98
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.98
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.91
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 96.86
d1pd0a3252 Sec24 {Baker's yeast (Saccharomyces cerevisiae) [T 96.75
d2qtva3271 Sec23 {Baker's yeast (Saccharomyces cerevisiae) [T 96.74
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 96.72
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 96.65
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.62
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 96.58
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 96.52
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.52
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 96.5
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 96.4
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 96.37
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.27
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 96.25
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 96.24
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 96.23
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 96.21
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 95.97
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.91
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 95.91
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 95.84
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 95.8
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 95.77
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 95.75
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 95.65
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 95.62
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 95.6
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.58
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 95.53
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 95.53
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 95.45
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 95.41
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 95.39
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 95.35
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 95.24
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 95.19
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 95.14
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 95.11
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 95.06
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 94.76
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 94.64
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 94.61
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 94.52
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 94.37
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 94.36
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 93.9
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 93.28
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 93.24
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 92.88
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 92.7
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 92.66
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 92.46
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 92.3
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 92.27
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 92.22
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 92.17
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 92.09
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 92.05
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 92.01
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 91.96
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 91.93
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 91.85
d1g2912240 Maltose transport protein MalK, N-terminal domain 91.71
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 91.66
d1okkd2207 GTPase domain of the signal recognition particle r 91.62
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 91.6
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 91.55
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 91.54
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 91.47
d2awna2232 Maltose transport protein MalK, N-terminal domain 91.45
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 91.42
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 91.28
d1ls1a2207 GTPase domain of the signal sequence recognition p 91.14
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 91.12
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 91.08
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 91.04
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 90.97
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 90.96
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 90.92
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 90.81
d1j8yf2211 GTPase domain of the signal sequence recognition p 90.66
d1vmaa2213 GTPase domain of the signal recognition particle r 90.5
d2qy9a2211 GTPase domain of the signal recognition particle r 90.36
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 90.2
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 90.11
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 89.62
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 89.5
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 89.49
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 89.44
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 89.42
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 89.05
d2hyda1255 Putative multidrug export ATP-binding/permease pro 88.87
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 88.85
d2fh5b1207 Signal recognition particle receptor beta-subunit 88.81
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 88.74
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 88.64
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 88.61
g1qhh.1623 DEXX box DNA helicase {Bacillus stearothermophilus 88.6
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 88.53
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 88.5
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 88.44
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 88.42
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 88.4
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 88.38
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 88.38
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 88.21
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 88.11
d1nrjb_209 Signal recognition particle receptor beta-subunit 88.02
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 87.73
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 87.65
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 87.62
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 87.62
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 87.48
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 87.39
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 87.2
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 87.18
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 87.15
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 87.09
d1xpua3289 Transcription termination factor Rho, ATPase domai 87.08
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 86.97
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 86.86
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 86.69
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 86.67
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 86.63
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 86.57
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 86.51
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 86.31
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 86.26
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 86.18
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 86.15
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 86.05
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 86.04
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 85.94
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 85.93
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 85.92
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 85.86
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 85.79
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 85.74
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 85.56
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 85.46
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 85.41
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 85.19
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 85.19
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 85.12
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 84.87
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 84.85
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 84.81
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 84.8
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 84.62
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 84.38
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 84.29
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 84.15
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 84.14
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 84.12
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 84.09
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 83.95
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 83.85
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 83.83
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 83.81
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 83.8
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 83.78
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 83.73
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 83.64
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 83.57
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 82.89
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 82.89
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 82.86
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 82.72
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 82.61
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 82.56
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 82.55
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 82.21
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 82.08
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 81.57
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 81.08
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 80.99
d1w36b1485 Exodeoxyribonuclease V beta chain (RecB), N-termin 80.82
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 80.79
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 80.51
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 80.21
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: ATPase subunit of magnesium chelatase, BchI
species: Rhodobacter capsulatus [TaxId: 1061]

Probab=100.00  E-value=0  Score=377.13  Aligned_cols=312  Identities=37%  Similarity=0.577  Sum_probs=284.3

Q ss_pred             CCCCCCCEECHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             88899842032999999998500578961899889997799999999954799611226545689999975333432210
Q 005520           90 QFFPLAAVVGQDAIKTALLLGAIDREIGGIAISGRRGTAKTVMARGLHAILPPIEVVVGSIANADPTCPDEWEDGLDEKA  169 (692)
Q Consensus        90 ~~~~f~~IvGq~~~k~aL~~aav~p~~~gVLL~GppGTGKT~lArala~~l~~~~~i~~~~~~~~~~~~~~~~~~~~~~~  169 (692)
                      ..|+|++|+||+.+|++|+++++.++.+||||.|+||||||++||+++.+||++..++.|.++|.+...   +..+....
T Consensus         2 ~~~~f~~I~Gq~~~kral~laa~~~~~h~vLl~G~pG~GKT~lar~~~~iLp~~~~~~~~~~~~~~~~~---~~~~~~~~   78 (333)
T d1g8pa_           2 PVFPFSAIVGQEDMKLALLLTAVDPGIGGVLVFGDRGTGKSTAVRALAALLPEIEAVEGCPVSSPNVEM---IPDWATVL   78 (333)
T ss_dssp             CCCCGGGSCSCHHHHHHHHHHHHCGGGCCEEEECCGGGCTTHHHHHHHHHSCCEEEETTCTTCCSSGGG---SCTTCCCS
T ss_pred             CCCCHHHCCCCHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHCCCCHHHCCCCCCCCCCCC---CCCHHHCC
T ss_conf             989851406949999999999764699708998899852999999998737982154057534675344---62022012


Q ss_pred             CCCCCCCCCCCCCCCCEEECCCCCCCCCEEEECCHHHHCCCCCCCCCCCCCCCCCCCEEEECCCCCCCHHHHHHHHHHHH
Q ss_conf             01235664334469986876999743441420100100015974233573000257659955543489779999999998
Q 005520          170 EYDTAGNLKTQIARSPFVQIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLAEAHRGVLYIDEINLLDEGISNLLLNVLT  249 (692)
Q Consensus       170 ~~~~~~~~~~~~~~~p~v~l~~~~te~~l~G~id~~~~~~~g~~~~~pGll~~A~~giL~IDEi~~l~~~~~~~Ll~~le  249 (692)
                            .........+++..+.+.+.+.++|++|+++.+.+|...+++|.+..||+||+|+||+|++++.+++.|+++|+
T Consensus        79 ------~~~~~~~~~~~~~~~~~~~~~~l~G~~d~~~~~~~g~~~~~~G~l~~A~~gvl~iDEi~~~~~~~~~aLl~~me  152 (333)
T d1g8pa_          79 ------STNVIRKPTPVVDLPLGVSEDRVVGALDIERAISKGEKAFEPGLLARANRGYLYIDECNLLEDHIVDLLLDVAQ  152 (333)
T ss_dssp             ------CCCEEEECCCEEEECTTCCHHHHHCEECHHHHHHHCGGGEECCHHHHHTTEEEEETTGGGSCHHHHHHHHHHHH
T ss_pred             ------CCCCCCCCCCEEECCCCCCCCCCCCCCHHHHCCCCCCCEEECCCCCCCCCCEEECCCHHHHHHHHHHHHHHHHC
T ss_conf             ------45752123752423677885435574102110236860220253113556376315377777999998744530


Q ss_pred             CCCEEEEECCEEEEECCCCEEEEEECCCCCCCHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             18201221790556338638998436998885188997540003689999987799999999998654567865556665
Q 005520          250 EGVNIVEREGISFKHPCKPLLIATYNPEEGVVREHLLDRIAINLSADLPMTFEDRVAAVGIATQFQERSNEVFKMVEEET  329 (692)
Q Consensus       250 ~g~~~i~r~G~s~~~p~~f~lIat~Np~eg~l~~aLldRf~~~v~v~~p~~~~~r~ei~~~~~~~~~~~~~~~~~~~~~~  329 (692)
                      ++.++|.|.|.++.+|++|++|+|+||+++.++++++|||++++.+..+.+...+.++..........+..+...+....
T Consensus       153 ~~~v~i~r~g~~~~~p~~f~liaa~Np~~~~l~~~llDRf~~~i~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  232 (333)
T d1g8pa_         153 SGENVVERDGLSIRHPARFVLVGSGNPEEGDLRPQLLDRFGLSVEVLSPRDVETRVEVIRRRDTYDADPKAFLEEWRPKD  232 (333)
T ss_dssp             HSEEEECCTTCCEEEECCEEEEEEECSCSCCCCHHHHTTCSEEEECCCCCSHHHHHHHHHHHHHHHHCHHHHHHHHHHHH
T ss_pred             CCEEEECCCCCEECCCCCEEEEEECCCCCCCCCCCHHHHHCCEEECCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHH
T ss_conf             77687513584304888879998457631236631032413344326864035788877765410227577888889999


Q ss_pred             HHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCCCC
Q ss_conf             79999999999740347789999999999999429987257999999999999976999754999999999872997457
Q 005520          330 DLAKTQIILAREYLKDVAIGREQLKYLVMEALRGGCQGHRAELYAARVAKCLAALEGREKVNVDDLKKAVELVILPRSII  409 (692)
Q Consensus       330 ~~l~~~i~~ar~~l~~V~is~~~l~~L~~~~~~~~i~s~R~~i~llr~Ara~Aal~gr~~Vt~eDv~~A~~lvl~hR~~~  409 (692)
                      ..+..++..+..++..+.++++...++.......+..|+|+.+.++|+|+++|+|+|+++|+.+||.+|+.++|.||++.
T Consensus       233 ~~~~~~~~~~~~~l~~v~~~~~~~~~~~~~~~~~~~~S~R~~~~llrvArtiA~L~gr~~V~~~di~~a~~lvL~hR~~~  312 (333)
T d1g8pa_         233 MDIRNQILEARERLPKVEAPNTALYDCAALCIALGSDGLRGELTLLRSARALAALEGATAVGRDHLKRVATMALSHRLRR  312 (333)
T ss_dssp             HHHHHHHHHHHHHGGGCBCCHHHHHHHHHHHHHSSSCSHHHHHHHHHHHHHHHHHTTCSBCCHHHHHHHHHHHHGGGCC-
T ss_pred             HHHHHHHHHHHHCCCCEECCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHCCC
T ss_conf             99998888875211312058999999999999708988379999999999999976989989999999999987765548


Q ss_pred             C
Q ss_conf             9
Q 005520          410 N  410 (692)
Q Consensus       410 ~  410 (692)
                      .
T Consensus       313 ~  313 (333)
T d1g8pa_         313 D  313 (333)
T ss_dssp             -
T ss_pred             C
T ss_conf             8
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1q0pa_ c.62.1.1 (A:) Complement factor B domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1shux_ c.62.1.1 (X:) Capillary morphogenesis protein 2 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1atza_ c.62.1.1 (A:) von Willebrand factor A3 domain, vWA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jeya2 c.62.1.3 (A:34-253) Ku70 subunit N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yvra2 c.62.1.5 (A:364-537) 60-kda SS-A/Ro ribonucleoprotein, RoRNP {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1mjna_ c.62.1.1 (A:) Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jeyb2 c.62.1.4 (B:6-241) Ku80 subunit N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mf7a_ c.62.1.1 (A:) Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n3ya_ c.62.1.1 (A:) Integrin alpha-x beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1v7pc_ c.62.1.1 (C:) Integrin alpha2-beta1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijba_ c.62.1.1 (A:) von Willebrand factor A1 domain, vWA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pt6a_ c.62.1.1 (A:) Integrin alpha1-beta1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1tyeb2 c.62.1.1 (B:107-354) Integrin beta A domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pd0a3 c.62.1.2 (A:301-552) Sec24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qtva3 c.62.1.2 (A:120-390) Sec23 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure