Citrus Sinensis ID: 005529

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690--
MDCCGFILECPKAALISGCDPNSTYDHCKCFEENAKSNLGPIVEKFVCLSLEEDDSVTFCVRDKEISFVRNKIASLSSPFKAMLYGGFVESKRKTIDFSHDGVSVEGLRAVEVYTRTSRVDLFCPGIVLELLSFANRFCCEEMKSACDAHLASLVGDIEDALILIDYGLEERATLLVASCLQVLLRELPSSLYNPKVMKIFCSSEATERLANVGHASFLLYYFLSQVAMEKDRVSNTTVMLLERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAGHIYSLAGLARAKYKVGQQYSAYKLINSIISEHKPTGWMYQERSLYNLGREKIVDLNYASELDPTLSFPYKYRAVAKMEEGQIRAAISEIDRIIVFKLSVDCLELRAWLFIAADDYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKSFLRFRQSLLLLRLNCQKAAMRCLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKSISIERTFEAFFLKAYILADTNLDPESSTYVIQLLEEALRCPSDGLRKGQALNNLGSIYVECGKLDQAENCYINALDIKHTRAHQGLARVYYLKNELKAAYDEMTKLLEKAQYSASAFEKRSEYSDREMAKNDLNMATQLDPLRTYPYRYRAAERS
cccccccccccccHHcccccccccccccccccccccccccHHHHHHHHccccccccEEEEEccEEEEHHHHHHHcccHHHHHHHcccccccccccEEEccccccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccccccccccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHcccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHcccHHccccHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccHHHHHHHHcHHHHccccHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHHHHHccccccccccHHccccc
ccccccEEEccHHHccccccccccccccccccccccccccccccccccccccccccEEEEEcccEEEEEHEHHHHccHHHHHHHccccHHcccccEEcccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccccHHHHHHHHHcccEEEEcHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHccccccccccHEEEHHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHcccccccEEcccccHHHHHHHHHHHHHHccHcHHHHHHHHHccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHccHEEEEcEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccccccHHHcccccEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccHHHHHHHHHHHHcccccccccccEHHcccc
mdccgfilecpkaalisgcdpnstydhckcfeenaksnlgpiVEKFVCLsleeddsvtfcvrdkEISFVRNKiaslsspfkamlyggfveskrktidfshdgvsveGLRAVEVYTrtsrvdlfcPGIVLELLSFANRFCCEEMKSACDAHLASLVGDIEDALILIDYGLEERATLLVASCLQVLLRelpsslynpkvMKIFCSSEATERLANVGHASFLLYYFLSQVAMEKDRVSNTTVMLLERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAGHIYSLAGLARAKYKVGQQYSAYKLINSIIsehkptgwmyqerslynlgrekivdlnyaseldptlsfpyKYRAVAKMEEGQIRAAISEIDRIIVFKLSVDCLELRAWLFIAADDYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHHvrswspadcwiklydrwssvddigSLAVINQMlindpgksFLRFRQSLLLLRLNCQKAAMRCLRLArnhssseherlVYEGWILYDTGHREEALSRAEKSISIERTFEAFFLKAYILadtnldpesSTYVIQLLEEALrcpsdglrkgqaLNNLGSIYVEcgkldqaencyinaldikhtrAHQGLARVYYLKNELKAAYDEMTKLLEKAQYSASAFEKRSEYSDREMAKNDlnmatqldplrtypyryraaers
MDCCGFILECPKAALISGCDPNSTYDHCKCFEenaksnlgpIVEKFVCLSLEEDDSVTFCvrdkeisfvrnkiaslsspfkAMLYGGFVESKRKTidfshdgvsvegLRAVEVYTRTSRVDLFCPGIVLELLSFANRFCCEEMKSACDAHLASLVGDIEDALILIDYGLEERATLLVASCLQVLLRelpsslynpKVMKIFCSSEATERLANVGHASFLLYYFLSQVAMEKDRVSNTTVMLLERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAGHIYSLAGLARAKYKVGQQYSAYKLINSIISEHKPTGWMYQERSLYNLGREKIVDLNyaseldptlsFPYKYRAVAKMEEGQIRAAISEIDRIIVFKLSVDCLELRAWLFIAADDYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKSFLRFRQSLLLLRLNCQKAAMRCLRLarnhssseherlVYEGWILYDTGHREEALSRAEKSISIERTFEAFFLKAYILADTNLDPESSTYVIQLLEEALRCPSDGLRKGQALNNLGSIYVECGKLDQAENCYINALDIKHTRAHQGLARVYYLKNELKAAYDEMTKLLEKAQYSASAFEKRSEYSDREMAKndlnmatqldplrtypyryraaers
MDCCGFILECPKAALISGCDPNSTYDHCKCFEENAKSNLGPIVEKFVCLSLEEDDSVTFCVRDKEISFVRNKIASLSSPFKAMLYGGFVESKRKTIDFSHDGVSVEGLRAVEVYTRTSRVDLFCPGIVLELLSFANRFCCEEMKSACDAHLASLVGDIEDALILIDYGLEERATLLVASCLQVLLRELPSSLYNPKVMKIFCSSEATERLANVGHASFLLYYFLSQVAMEKDRVSNTTVMLLERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAGHIYSLAGLARAKYKVGQQYSAYKLINSIISEHKPTGWMYQERSLYNLGREKIVDLNYASELDPTLSFPYKYRAVAKMEEGQIRAAISEIDRIIVFKLSVDCLELRAWLFIAADDYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKsflrfrqsllllrlNCQKAAMRCLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKSISIERTFEAFFLKAYILADTNLDPESSTYVIQLLEEALRCPSDGLRKGQALNNLGSIYVECGKLDQAENCYINALDIKHTRAHQGLARVYYLKNELKAAYDEMTKLLEKAQYSASAFEKRSEYSDREMAKNDLNMATQLDPLRTYPYRYRAAERS
**CCGFILECPKAALISGCDPNSTYDHCKCFEENAKSNLGPIVEKFVCLSLEEDDSVTFCVRDKEISFVRNKIASLSSPFKAMLYGGFVESKRKTIDFSHDGVSVEGLRAVEVYTRTSRVDLFCPGIVLELLSFANRFCCEEMKSACDAHLASLVGDIEDALILIDYGLEERATLLVASCLQVLLRELPSSLYNPKVMKIFCSSEATERLANVGHASFLLYYFLSQVAMEKDRVSNTTVMLLERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAGHIYSLAGLARAKYKVGQQYSAYKLINSIISEHKPTGWMYQERSLYNLGREKIVDLNYASELDPTLSFPYKYRAVAKMEEGQIRAAISEIDRIIVFKLSVDCLELRAWLFIAADDYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKSFLRFRQSLLLLRLNCQKAAMRCLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKSISIERTFEAFFLKAYILADTNLDPESSTYVIQLLEEALRCPSDGLRKGQALNNLGSIYVECGKLDQAENCYINALDIKHTRAHQGLARVYYLKNELKAAYDEMTKLLE***********************************************
**CCGFILECPKAALISGCDPNSTY***********************LSLEEDDSVTFCVRDKEISFVRNKIASLSSPFKAMLYGGFVESKRKTIDFSHDGVSVEGLRAVEVYTRTSRVDLFCPGIVLELLSFANRFCCEEMKSACDAHLASLVGDIEDALILIDYGLEERATLLVASCLQVLLRELPSSLYNPKVMKIFCSSEATERLANVGHASFLLYYFLSQVAM*****SNTTVMLLERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAGHIYSLAGLARAKYKVGQQYSAYKLINSIISEHKPTGWMYQERSLYNLGREKIVDLNYASELDPTLSFPYKYRAVAKMEEGQIRAAISEIDRIIVFKLSVDCLELRAWLFIAADDYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKSFLRFRQSLLLLRLNCQKAAMRCLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKSISIERTFEAFFLKAYILADTNLDPESSTYVIQLLEEALRCPSDGLRKGQALNNLGSIYVECGKLDQAENCYINALDIKHTRAHQGLARVYYLKNELKAAYDEMTKLLEKAQYSASAFEKRSEYSDREMAKNDLNMATQLDPLRTYPYRYRAA***
MDCCGFILECPKAALISGCDPNSTYDHCKCFEENAKSNLGPIVEKFVCLSLEEDDSVTFCVRDKEISFVRNKIASLSSPFKAMLYGGFVESKRKTIDFSHDGVSVEGLRAVEVYTRTSRVDLFCPGIVLELLSFANRFCCEEMKSACDAHLASLVGDIEDALILIDYGLEERATLLVASCLQVLLRELPSSLYNPKVMKIFCSSEATERLANVGHASFLLYYFLSQVAMEKDRVSNTTVMLLERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAGHIYSLAGLARAKYKVGQQYSAYKLINSIISEHKPTGWMYQERSLYNLGREKIVDLNYASELDPTLSFPYKYRAVAKMEEGQIRAAISEIDRIIVFKLSVDCLELRAWLFIAADDYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKSFLRFRQSLLLLRLNCQKAAMRCLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKSISIERTFEAFFLKAYILADTNLDPESSTYVIQLLEEALRCPSDGLRKGQALNNLGSIYVECGKLDQAENCYINALDIKHTRAHQGLARVYYLKNELKAAYDEMTKLLEKAQY*************REMAKNDLNMATQLDPLRTYPYRYRAAERS
*DCCGFILECPKAALISGCDPNSTYDHCKCFE*********************DDSVTFCVRDKEISFVRNKIASLSSPFKAMLYGGFVESKRKTIDFSHDGVSVEGLRAVEVYTRTSRVDLFCPGIVLELLSFANRFCCEEMKSACDAHLASLVGDIEDALILIDYGLEERATLLVASCLQVLLRELPSSLYNPKVMKIFCSSEATERLANVGHASFLLYYFLSQVAMEKDRVSNTTVMLLERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAGHIYSLAGLARAKYKVGQQYSAYKLINSIISEHKPTGWMYQERSLYNLGREKIVDLNYASELDPTLSFPYKYRAVAKMEEGQIRAAISEIDRIIVFKLSVDCLELRAWLFIAADDYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKSFLRFRQSLLLLRLNCQKAAMRCLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKSISIERTFEAFFLKAYILADTNLDPESSTYVIQLLEEALRCPSDGLRKGQALNNLGSIYVECGKLDQAENCYINALDIKHTRAHQGLARVYYLKNELKAAYDEMTKLLEKAQYSASAFEKRSEYSDREMAKNDLNMATQLDPLRTYPYRYRA****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDCCGFILECPKAALISGCDPNSTYDHCKCFEENAKSNLGPIVEKFVCLSLEEDDSVTFCVRDKEISFVRNKIASLSSPFKAMLYGGFVESKRKTIDFSHDGVSVEGLRAVEVYTRTSRVDLFCPGIVLELLSFANRFCCEEMKSACDAHLASLVGDIEDALILIDYGLEERATLLVASCLQVLLRELPSSLYNPKVMKIFCSSEATERLANVGHASFLLYYFLSQVAMEKDRVSNTTVMLLERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAGHIYSLAGLARAKYKVGQQYSAYKLINSIISEHKPTGWMYQERSLYNLGREKIVDLNYASELDPTLSFPYKYRAVAKMEEGQIRAAISEIDRIIVFKLSVDCLELRAWLFIAADDYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKSFLRFRQSLLLLRLNCQKAAMRCLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKSISIERTFEAFFLKAYILADTNLDPESSTYVIQLLEEALRCPSDGLRKGQALNNLGSIYVECGKLDQAENCYINALDIKHTRAHQGLARVYYLxxxxxxxxxxxxxxxxxxxxxASAFEKRSEYSDREMAKNDLNMATQLDPLRTYPYRYRAAERS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query692 2.2.26 [Sep-21-2011]
O65020951 Ethylene-overproduction p yes no 0.991 0.721 0.686 0.0
Q9LV01925 ETO1-like protein 2 OS=Ar no no 0.995 0.744 0.594 0.0
Q9ZQX6888 ETO1-like protein 1 OS=Ar no no 0.916 0.713 0.544 0.0
>sp|O65020|ETO1_ARATH Ethylene-overproduction protein 1 OS=Arabidopsis thaliana GN=ETO1 PE=1 SV=2 Back     alignment and function desciption
 Score =  992 bits (2565), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/689 (68%), Positives = 573/689 (83%), Gaps = 3/689 (0%)

Query: 1   MDCCGFILECPKAALISGCDPNSTYDHCKCFEENAKSNLGPIVEKFVCLSLEEDDSVTFC 60
           MDCCG  LECPKA L+SG DP S YD C C   +  S    + E     S E D  ++FC
Sbjct: 191 MDCCGRNLECPKATLVSGYDPESVYDPCVC---SGASRSEMMNEDECSTSQEVDYDMSFC 247

Query: 61  VRDKEISFVRNKIASLSSPFKAMLYGGFVESKRKTIDFSHDGVSVEGLRAVEVYTRTSRV 120
           + D+E+  VR KIASLS PFKAMLYGGF E KR TI+F+ +G+SVEG+RA E+++RT+R+
Sbjct: 248 IGDEEVRCVRYKIASLSRPFKAMLYGGFREMKRATINFTQNGISVEGMRAAEIFSRTNRL 307

Query: 121 DLFCPGIVLELLSFANRFCCEEMKSACDAHLASLVGDIEDALILIDYGLEERATLLVASC 180
           D F P +VLELL  ANRFCC+E+KSACD+HLA LV  +++A++LI+YGLEE A LLVA+C
Sbjct: 308 DNFPPNVVLELLKLANRFCCDELKSACDSHLAHLVNSLDEAMLLIEYGLEEAAYLLVAAC 367

Query: 181 LQVLLRELPSSLYNPKVMKIFCSSEATERLANVGHASFLLYYFLSQVAMEKDRVSNTTVM 240
           LQV LRELPSS++NP V+KIFCS+E  ERLA++GHASF LY+FLSQ+AME D  SNTTVM
Sbjct: 368 LQVFLRELPSSMHNPNVIKIFCSAEGRERLASLGHASFTLYFFLSQIAMEDDMKSNTTVM 427

Query: 241 LLERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAGHIYSLAGLARAKYK 300
           LLERL EC+ + W++ LA HQLG VM ER+EYKDA  +F AA +AGH+YSL G+AR K+K
Sbjct: 428 LLERLVECAVDSWEKQLAYHQLGVVMLERKEYKDAQRWFNAAVEAGHLYSLVGVARTKFK 487

Query: 301 VGQQYSAYKLINSIISEHKPTGWMYQERSLYNLGREKIVDLNYASELDPTLSFPYKYRAV 360
              +YSAYK+INS+IS+HK TGWM+QERSLY  G+EK++DL+ A+E DPTL+FPYK+RAV
Sbjct: 488 RDHRYSAYKIINSLISDHKATGWMHQERSLYCSGKEKLLDLDTATEFDPTLTFPYKFRAV 547

Query: 361 AKMEEGQIRAAISEIDRIIVFKLSVDCLELRAWLFIAADDYESALRDTLALLALESNYMM 420
           A +EE Q  AAI+E+++I+ FK S DCLE+RAW+ I  +DYE AL+D  ALL LE N+MM
Sbjct: 548 ALVEENQFGAAIAELNKILGFKASPDCLEMRAWISIGMEDYEGALKDIRALLTLEPNFMM 607

Query: 421 FHGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKSFLR 480
           F+ ++ GDH+V+LL    + WS ADCW++LYDRWSSVDDIGSLAV++ ML NDPGKS LR
Sbjct: 608 FNWKIHGDHMVELLRPLAQQWSQADCWMQLYDRWSSVDDIGSLAVVHHMLANDPGKSLLR 667

Query: 481 FRQSLLLLRLNCQKAAMRCLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKSISI 540
           FRQSLLLLRLNCQKAAMR LRLARNHS SEHERLVYEGWILYDTGHREEAL++AE+SISI
Sbjct: 668 FRQSLLLLRLNCQKAAMRSLRLARNHSKSEHERLVYEGWILYDTGHREEALAKAEESISI 727

Query: 541 ERTFEAFFLKAYILADTNLDPESSTYVIQLLEEALRCPSDGLRKGQALNNLGSIYVECGK 600
           +R+FEAFFLKAY LAD+ LDP+SS YVIQLL+EAL+CPSDGLRKGQALNNLGS+YV+C K
Sbjct: 728 QRSFEAFFLKAYALADSTLDPDSSNYVIQLLQEALKCPSDGLRKGQALNNLGSVYVDCEK 787

Query: 601 LDQAENCYINALDIKHTRAHQGLARVYYLKNELKAAYDEMTKLLEKAQYSASAFEKRSEY 660
           LD A +CY NAL IKHTRAHQGLARVY+LKN+ KAAYDEMTKL+EKAQ +ASA+EKRSEY
Sbjct: 788 LDLAADCYTNALTIKHTRAHQGLARVYHLKNQRKAAYDEMTKLIEKAQNNASAYEKRSEY 847

Query: 661 SDREMAKNDLNMATQLDPLRTYPYRYRAA 689
            DREMA++DL +ATQLDPLRTYPYRYRAA
Sbjct: 848 CDREMAQSDLCLATQLDPLRTYPYRYRAA 876
Essential regulator of the ethylene pathway, which acts by regulating the stability of 1-aminocyclopropane-1-carboxylate synthase (ACS) enzymes. May act as a substrate-specific adapter that connects ACS enzymes, such as ACS5, to ubiquitin ligase complexes, leading to proteasomal degradation of ACS enzymes.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9LV01|ETOL2_ARATH ETO1-like protein 2 OS=Arabidopsis thaliana GN=EOL2 PE=1 SV=2 Back     alignment and function description
>sp|Q9ZQX6|ETOL1_ARATH ETO1-like protein 1 OS=Arabidopsis thaliana GN=EOL1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query692
224105907 896 predicted protein [Populus trichocarpa] 0.971 0.75 0.760 0.0
225434510 927 PREDICTED: ethylene-overproduction prote 0.995 0.743 0.743 0.0
255560353 911 Ethylene-overproduction protein, putativ 0.995 0.756 0.729 0.0
356566016 902 PREDICTED: ethylene-overproduction prote 0.988 0.758 0.699 0.0
356553104 955 PREDICTED: ethylene-overproduction prote 0.994 0.720 0.689 0.0
356541801 895 PREDICTED: ethylene-overproduction prote 0.991 0.766 0.696 0.0
297819878 947 ethylene-overproduction protein 1 [Arabi 0.989 0.723 0.682 0.0
225439486 951 PREDICTED: ethylene-overproduction prote 0.995 0.724 0.7 0.0
240255605 959 tetratricopeptide repeat (TPR)-containin 0.991 0.715 0.686 0.0
50400253 951 RecName: Full=Ethylene-overproduction pr 0.991 0.721 0.686 0.0
>gi|224105907|ref|XP_002313975.1| predicted protein [Populus trichocarpa] gi|222850383|gb|EEE87930.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 1089 bits (2817), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/688 (76%), Positives = 597/688 (86%), Gaps = 16/688 (2%)

Query: 2   DCCGFILECPKAALISGCDPNSTYDHCKCFEENAKSNLGPIVEKFVCLSLEEDDSVTFCV 61
           DC G+ILECP AAL+SGCDPNS YDHC+C ++N                LE D  V+FC+
Sbjct: 149 DCSGYILECPMAALVSGCDPNSIYDHCQCGQDN----------------LEADSDVSFCI 192

Query: 62  RDKEISFVRNKIASLSSPFKAMLYGGFVESKRKTIDFSHDGVSVEGLRAVEVYTRTSRVD 121
            D+ +  VR KIASLSSPFKAMLYG FVES+R  IDFS  G+SV+G+RAV+VY+RT RVD
Sbjct: 193 GDELVHCVRFKIASLSSPFKAMLYGSFVESRRDKIDFSKIGISVKGMRAVQVYSRTGRVD 252

Query: 122 LFCPGIVLELLSFANRFCCEEMKSACDAHLASLVGDIEDALILIDYGLEERATLLVASCL 181
           LFCP IVLELLSFANRFCCEE+K ACDAHLASLV   EDALILID+GLEERA LLVASCL
Sbjct: 253 LFCPEIVLELLSFANRFCCEELKCACDAHLASLVCGTEDALILIDHGLEERANLLVASCL 312

Query: 182 QVLLRELPSSLYNPKVMKIFCSSEATERLANVGHASFLLYYFLSQVAMEKDRVSNTTVML 241
           QV LRELP+SLYN KVM +FC+SEA ERLA +GHASFLLYYFLSQVAME++  SN  VML
Sbjct: 313 QVFLRELPNSLYNHKVMSVFCNSEARERLAMLGHASFLLYYFLSQVAMEENVASNAAVML 372

Query: 242 LERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAGHIYSLAGLARAKYKV 301
           LE L E +TE+WQ+ LALHQLGCVM ER+EYK A +YFEAA +AGH+YSLAG+AR KYK 
Sbjct: 373 LEGLEEFATEKWQKALALHQLGCVMLERKEYKGAQFYFEAAVEAGHVYSLAGVARTKYKQ 432

Query: 302 GQQYSAYKLINSIISEHKPTGWMYQERSLYNLGREKIVDLNYASELDPTLSFPYKYRAVA 361
           GQQYSA++L+NS+I +HKP GWMYQERSLY +G+EKI+D+N A+ELDPTLSFPYK+RAV 
Sbjct: 433 GQQYSAFRLMNSLIFKHKPVGWMYQERSLYGVGQEKIMDMNTATELDPTLSFPYKFRAVM 492

Query: 362 KMEEGQIRAAISEIDRIIVFKLSVDCLELRAWLFIAADDYESALRDTLALLALESNYMMF 421
           K+EE QIRAAI+EID+II FKLS DCLELRAW FIA +D+ESALRD  ALL LE  YMMF
Sbjct: 493 KVEEKQIRAAITEIDKIIGFKLSPDCLELRAWFFIALEDFESALRDIRALLTLEPKYMMF 552

Query: 422 HGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKSFLRF 481
           HGRVSGDHLV+LL+H +R W+ ADCW++LY+RWSSVDDIGSLAV++QML NDP KS L F
Sbjct: 553 HGRVSGDHLVELLSHRIRLWNLADCWMQLYERWSSVDDIGSLAVLHQMLSNDPAKSLLWF 612

Query: 482 RQSLLLLRLNCQKAAMRCLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKSISIE 541
           RQSLLLLRLNCQKAAMRCLRLARNH+SS HERL+YEGW+L+D+GHREEALSRAEKSISI+
Sbjct: 613 RQSLLLLRLNCQKAAMRCLRLARNHTSSVHERLIYEGWLLFDSGHREEALSRAEKSISIQ 672

Query: 542 RTFEAFFLKAYILADTNLDPESSTYVIQLLEEALRCPSDGLRKGQALNNLGSIYVECGKL 601
           R+FEAFFL AY LADTNLDPESS+ VIQLLEEALRCPSDGLRKGQALNNLGSIYV+CGKL
Sbjct: 673 RSFEAFFLMAYTLADTNLDPESSSTVIQLLEEALRCPSDGLRKGQALNNLGSIYVDCGKL 732

Query: 602 DQAENCYINALDIKHTRAHQGLARVYYLKNELKAAYDEMTKLLEKAQYSASAFEKRSEYS 661
           DQA +CY+NAL+IKHTRAHQGLARVY+LKN+ KAA+DEMTKL+EKA  SASA+EKRSEY 
Sbjct: 733 DQAADCYMNALNIKHTRAHQGLARVYHLKNQRKAAFDEMTKLIEKAHSSASAYEKRSEYC 792

Query: 662 DREMAKNDLNMATQLDPLRTYPYRYRAA 689
           DRE AK+DLNMATQLDPLRTYPYRYRAA
Sbjct: 793 DREKAKDDLNMATQLDPLRTYPYRYRAA 820

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225434510|ref|XP_002278414.1| PREDICTED: ethylene-overproduction protein 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255560353|ref|XP_002521192.1| Ethylene-overproduction protein, putative [Ricinus communis] gi|223539606|gb|EEF41192.1| Ethylene-overproduction protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356566016|ref|XP_003551231.1| PREDICTED: ethylene-overproduction protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|356553104|ref|XP_003544898.1| PREDICTED: ethylene-overproduction protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|356541801|ref|XP_003539361.1| PREDICTED: ethylene-overproduction protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|297819878|ref|XP_002877822.1| ethylene-overproduction protein 1 [Arabidopsis lyrata subsp. lyrata] gi|297323660|gb|EFH54081.1| ethylene-overproduction protein 1 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|225439486|ref|XP_002269998.1| PREDICTED: ethylene-overproduction protein 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|240255605|ref|NP_001030839.5| tetratricopeptide repeat (TPR)-containing protein [Arabidopsis thaliana] gi|332645320|gb|AEE78841.1| tetratricopeptide repeat (TPR)-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|50400253|sp|O65020.2|ETO1_ARATH RecName: Full=Ethylene-overproduction protein 1; AltName: Full=Protein ETHYLENE OVERPRODUCER 1; Short=Protein ETO1 gi|46810683|gb|AAT01656.1| ethylene overproducer 1 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query692
TAIR|locus:2074343959 ETO1 "ETHYLENE OVERPRODUCER 1" 0.991 0.715 0.667 3.3e-253
TAIR|locus:2132402888 EOL1 "ETO1-like 1" [Arabidopsi 0.916 0.713 0.525 5.3e-175
TAIR|locus:2074343 ETO1 "ETHYLENE OVERPRODUCER 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2438 (863.3 bits), Expect = 3.3e-253, P = 3.3e-253
 Identities = 460/689 (66%), Positives = 560/689 (81%)

Query:     1 MDCCGFILECPKAALISGCDPNSTYDHCKCFEENAKSNLGPIVEKFVCLSLEEDDSVTFC 60
             MDCCG  LECPKA L+SG DP S YD C C   +  S    + E     S E D  ++FC
Sbjct:   199 MDCCGRNLECPKATLVSGYDPESVYDPCVC---SGASRSEMMNEDECSTSQEVDYDMSFC 255

Query:    61 VRDKEISFVRNKIASLSSPFKAMLYGGFVESKRKTIDFSHDGVSVEGLRAVEVYTRTSRV 120
             + D+E+  VR KIASLS PFKAMLYGGF E KR TI+F+ +G+SVEG+RA E+++RT+R+
Sbjct:   256 IGDEEVRCVRYKIASLSRPFKAMLYGGFREMKRATINFTQNGISVEGMRAAEIFSRTNRL 315

Query:   121 DLFCPGIVLELLSFANRFCCEEMKSACDAHLASLVGDIEDALILIDYGLEERATLLVASC 180
             D F P +VLELL  ANRFCC+E+KSACD+HLA LV  +++A++LI+YGLEE A LLVA+C
Sbjct:   316 DNFPPNVVLELLKLANRFCCDELKSACDSHLAHLVNSLDEAMLLIEYGLEEAAYLLVAAC 375

Query:   181 LQVLLRELPSSLYNPKVMKIFCSSEATERLANVGHASFLLYYFLSQVAMEKDRVSNTTVM 240
             LQV LRELPSS++NP V+KIFCS+E  ERLA++GHASF LY+FLSQ+AME D  SNTTVM
Sbjct:   376 LQVFLRELPSSMHNPNVIKIFCSAEGRERLASLGHASFTLYFFLSQIAMEDDMKSNTTVM 435

Query:   241 LLERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAGHIYSLAGLARAKYK 300
             LLERL EC+ + W++ LA HQLG VM ER+EYKDA  +F AA +AGH+YSL G+AR K+K
Sbjct:   436 LLERLVECAVDSWEKQLAYHQLGVVMLERKEYKDAQRWFNAAVEAGHLYSLVGVARTKFK 495

Query:   301 VGQQYSAYKLINSIISEHKPTGWMYQERSLYNLGREKIVDLNYASELDPTLSFPYKYRAV 360
                +YSAYK+INS+IS+HK TGWM+QERSLY  G+EK++DL+ A+E DPTL+FPYK+RAV
Sbjct:   496 RDHRYSAYKIINSLISDHKATGWMHQERSLYCSGKEKLLDLDTATEFDPTLTFPYKFRAV 555

Query:   361 AKMEEGQIRAAISEIDRIIVFKLSVDCLELRAWLFIAADDYESALRDTLALLALESNYMM 420
             A +EE Q  AAI+E+++I+ FK S DCLE+RAW+ I  +DYE AL+D  ALL LE N+MM
Sbjct:   556 ALVEENQFGAAIAELNKILGFKASPDCLEMRAWISIGMEDYEGALKDIRALLTLEPNFMM 615

Query:   421 FHGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKXXXX 480
             F+ ++ GDH+V+LL    + WS ADCW++LYDRWSSVDDIGSLAV++ ML NDPGK    
Sbjct:   616 FNWKIHGDHMVELLRPLAQQWSQADCWMQLYDRWSSVDDIGSLAVVHHMLANDPGKSLLR 675

Query:   481 XXXXXXXXXXNCQKAAMRCLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKSISI 540
                       NCQKAAMR LRLARNHS SEHERLVYEGWILYDTGHREEAL++AE+SISI
Sbjct:   676 FRQSLLLLRLNCQKAAMRSLRLARNHSKSEHERLVYEGWILYDTGHREEALAKAEESISI 735

Query:   541 ERTFEAFFLKAYILADTNLDPESSTYVIQLLEEALRCPSDGLRKGQALNNLGSIYVECGK 600
             +R+FEAFFLKAY LAD+ LDP+SS YVIQLL+EAL+CPSDGLRKGQALNNLGS+YV+C K
Sbjct:   736 QRSFEAFFLKAYALADSTLDPDSSNYVIQLLQEALKCPSDGLRKGQALNNLGSVYVDCEK 795

Query:   601 LDQAENCYINALDIKHTRAHQGLARVYYLKNELKAAYDEMTKLLEKAQYSASAFEKRSEY 660
             LD A +CY NAL IKHTRAHQGLARVY+LKN+ KAAYDEMTKL+EKAQ +ASA+EKRSEY
Sbjct:   796 LDLAADCYTNALTIKHTRAHQGLARVYHLKNQRKAAYDEMTKLIEKAQNNASAYEKRSEY 855

Query:   661 SDREMAKNDLNMATQLDPLRTYPYRYRAA 689
              DREMA++DL +ATQLDPLRTYPYRYRAA
Sbjct:   856 CDREMAQSDLCLATQLDPLRTYPYRYRAA 884
GO:0005634 "nucleus" evidence=ISM
GO:0009693 "ethylene biosynthetic process" evidence=IMP
GO:0010182 "sugar mediated signaling pathway" evidence=RCA;TAS
GO:0005515 "protein binding" evidence=IPI
GO:0010364 "regulation of ethylene biosynthetic process" evidence=IDA
GO:0030674 "protein binding, bridging" evidence=IPI
GO:0043161 "proteasomal ubiquitin-dependent protein catabolic process" evidence=IPI
GO:0017145 "stem cell division" evidence=IMP
GO:2000069 "regulation of post-embryonic root development" evidence=IMP
GO:0006487 "protein N-linked glycosylation" evidence=RCA
GO:0009755 "hormone-mediated signaling pathway" evidence=RCA
GO:0048825 "cotyledon development" evidence=RCA
GO:0016036 "cellular response to phosphate starvation" evidence=IMP
TAIR|locus:2132402 EOL1 "ETO1-like 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O65020ETO1_ARATHNo assigned EC number0.68650.99130.7213yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query692
smart0022597 smart00225, BTB, Broad-Complex, Tramtrack and Bric 2e-08
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 6e-05
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 9e-05
pfam1341469 pfam13414, TPR_11, TPR repeat 3e-04
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 0.001
>gnl|CDD|197585 smart00225, BTB, Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information 
 Score = 51.9 bits (125), Expect = 2e-08
 Identities = 30/98 (30%), Positives = 43/98 (43%), Gaps = 3/98 (3%)

Query: 57  VTFCVRDKEISFVRNKIASLSSPFKAMLYGGFVESKRKTIDFSHDGVSVEGLRAVEVYTR 116
           VT  V  K+    +  +A+ S  FKA+    F ES +  I    D VS E  RA+  +  
Sbjct: 2   VTLVVGGKKFHAHKAVLAAHSPYFKALFSSDFKESDKSEIYL--DDVSPEDFRALLNFLY 59

Query: 117 TSRVDLFCPGIVLELLSFANRFCCEEMKSACDAHLASL 154
           T ++DL     V ELL  A+      +   C+  L  L
Sbjct: 60  TGKLDL-PEENVEELLELADYLQIPGLVELCEEFLLKL 96

Domain in Broad-Complex, Tramtrack and Bric a brac. Also known as POZ (poxvirus and zinc finger) domain. Known to be a protein-protein interaction motif found at the N-termini of several C2H2-type transcription factors as well as Shaw-type potassium channels. Known structure reveals a tightly intertwined dimer formed via interactions between N-terminal strand and helix structures. However in a subset of BTB/POZ domains, these two secondary structures appear to be missing. Be aware SMART predicts BTB/POZ domains without the beta1- and alpha1-secondary structures. Length = 97
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 692
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 100.0
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.97
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.96
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.96
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.96
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.96
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.96
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.96
KOG0547606 consensus Translocase of outer mitochondrial membr 99.96
KOG4350620 consensus Uncharacterized conserved protein, conta 99.95
PHA02790480 Kelch-like protein; Provisional 99.95
PHA02713557 hypothetical protein; Provisional 99.95
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.95
PHA03098534 kelch-like protein; Provisional 99.94
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 99.94
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.94
KOG0547606 consensus Translocase of outer mitochondrial membr 99.91
PRK14574 822 hmsH outer membrane protein; Provisional 99.91
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.9
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.9
PRK11788389 tetratricopeptide repeat protein; Provisional 99.9
KOG1126638 consensus DNA-binding cell division cycle control 99.9
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.9
PRK11788389 tetratricopeptide repeat protein; Provisional 99.89
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.86
PRK14574 822 hmsH outer membrane protein; Provisional 99.86
KOG1126638 consensus DNA-binding cell division cycle control 99.85
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.84
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.84
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.84
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 99.82
KOG2076 895 consensus RNA polymerase III transcription factor 99.82
KOG4591280 consensus Uncharacterized conserved protein, conta 99.81
KOG2003 840 consensus TPR repeat-containing protein [General f 99.81
KOG2075521 consensus Topoisomerase TOP1-interacting protein B 99.81
PRK11189296 lipoprotein NlpI; Provisional 99.8
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.79
KOG2003 840 consensus TPR repeat-containing protein [General f 99.78
PRK12370553 invasion protein regulator; Provisional 99.78
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.77
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.77
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.77
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.76
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.76
PRK11189296 lipoprotein NlpI; Provisional 99.76
PRK12370553 invasion protein regulator; Provisional 99.76
KOG2076 895 consensus RNA polymerase III transcription factor 99.75
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.74
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.74
PF00651111 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB ( 99.74
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.74
KOG1125579 consensus TPR repeat-containing protein [General f 99.74
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.73
PLN03218 1060 maturation of RBCL 1; Provisional 99.73
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.73
KOG1129478 consensus TPR repeat-containing protein [General f 99.73
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.72
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.72
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.72
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.72
PLN03077 857 Protein ECB2; Provisional 99.72
KOG1129478 consensus TPR repeat-containing protein [General f 99.71
KOG1125579 consensus TPR repeat-containing protein [General f 99.7
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.7
KOG07831267 consensus Uncharacterized conserved protein, conta 99.7
PLN03077 857 Protein ECB2; Provisional 99.69
PLN03218 1060 maturation of RBCL 1; Provisional 99.68
KOG4682488 consensus Uncharacterized conserved protein, conta 99.68
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.67
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 99.67
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.67
PLN02789320 farnesyltranstransferase 99.67
smart0022590 BTB Broad-Complex, Tramtrack and Bric a brac. Doma 99.67
PLN02789320 farnesyltranstransferase 99.67
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.65
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.63
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.61
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.6
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.6
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.56
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.55
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.54
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.51
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.5
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.48
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 99.47
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.46
PRK15359144 type III secretion system chaperone protein SscB; 99.46
PRK15359144 type III secretion system chaperone protein SscB; 99.44
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.44
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.44
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.43
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.42
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.41
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 99.37
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.37
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.36
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.35
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.34
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.34
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.33
PRK10370198 formate-dependent nitrite reductase complex subuni 99.32
PRK10370198 formate-dependent nitrite reductase complex subuni 99.31
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.31
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.29
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 99.29
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.27
PRK04841 903 transcriptional regulator MalT; Provisional 99.24
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.24
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.23
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.22
PRK04841903 transcriptional regulator MalT; Provisional 99.21
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.2
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.18
KOG1128777 consensus Uncharacterized conserved protein, conta 99.16
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.15
KOG0553304 consensus TPR repeat-containing protein [General f 99.14
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.13
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.12
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.1
KOG0511516 consensus Ankyrin repeat protein [General function 99.08
KOG0553304 consensus TPR repeat-containing protein [General f 99.07
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.05
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.04
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.04
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.02
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.01
KOG1128 777 consensus Uncharacterized conserved protein, conta 99.0
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.99
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.97
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.95
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.93
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.92
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.91
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.88
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.88
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.87
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.86
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.82
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.8
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.8
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.8
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.79
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.78
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.78
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.78
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.76
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.76
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.75
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.74
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.74
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.73
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.71
KOG4340 459 consensus Uncharacterized conserved protein [Funct 98.7
KOG4648 536 consensus Uncharacterized conserved protein, conta 98.7
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.69
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.69
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.67
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.66
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.63
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.63
PRK11906458 transcriptional regulator; Provisional 98.62
PRK10803263 tol-pal system protein YbgF; Provisional 98.61
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.6
PF12688120 TPR_5: Tetratrico peptide repeat 98.6
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.58
KOG07831267 consensus Uncharacterized conserved protein, conta 98.56
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.55
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.53
KOG1941 518 consensus Acetylcholine receptor-associated protei 98.53
PRK11906458 transcriptional regulator; Provisional 98.52
PRK15331165 chaperone protein SicA; Provisional 98.5
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.5
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.49
KOG4648 536 consensus Uncharacterized conserved protein, conta 98.49
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.48
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.47
COG4700251 Uncharacterized protein conserved in bacteria cont 98.47
PF12688120 TPR_5: Tetratrico peptide repeat 98.45
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.43
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.42
KOG1941 518 consensus Acetylcholine receptor-associated protei 98.41
PRK10803263 tol-pal system protein YbgF; Provisional 98.41
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.39
COG4700251 Uncharacterized protein conserved in bacteria cont 98.38
PRK15331165 chaperone protein SicA; Provisional 98.38
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.31
PF1337173 TPR_9: Tetratricopeptide repeat 98.3
KOG4234271 consensus TPR repeat-containing protein [General f 98.29
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.28
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.27
KOG2716230 consensus Polymerase delta-interacting protein PDI 98.24
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.23
PF1337173 TPR_9: Tetratricopeptide repeat 98.22
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.2
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 98.2
KOG2838401 consensus Uncharacterized conserved protein, conta 98.18
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.17
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.17
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.17
KOG4555175 consensus TPR repeat-containing protein [Function 98.15
KOG4234271 consensus TPR repeat-containing protein [General f 98.15
COG3898531 Uncharacterized membrane-bound protein [Function u 98.14
PF13512142 TPR_18: Tetratricopeptide repeat 98.12
PF13512142 TPR_18: Tetratricopeptide repeat 98.1
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.07
COG3898 531 Uncharacterized membrane-bound protein [Function u 98.04
KOG4555175 consensus TPR repeat-containing protein [Function 98.03
KOG2300629 consensus Uncharacterized conserved protein [Funct 98.02
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.01
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.0
PF0221494 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassi 97.96
KOG1987297 consensus Speckle-type POZ protein SPOP and relate 97.96
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 97.95
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 97.95
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.91
PF1342844 TPR_14: Tetratricopeptide repeat 97.88
KOG2300 629 consensus Uncharacterized conserved protein [Funct 97.83
KOG2838401 consensus Uncharacterized conserved protein, conta 97.8
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.8
KOG2471 696 consensus TPR repeat-containing protein [General f 97.77
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.73
PF06552186 TOM20_plant: Plant specific mitochondrial import r 97.71
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.7
KOG3473112 consensus RNA polymerase II transcription elongati 97.68
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.64
PF1343134 TPR_17: Tetratricopeptide repeat 97.64
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.64
PF06552186 TOM20_plant: Plant specific mitochondrial import r 97.62
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 97.62
KOG1550552 consensus Extracellular protein SEL-1 and related 97.6
KOG3616 1636 consensus Selective LIM binding factor [Transcript 97.59
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.58
KOG1585308 consensus Protein required for fusion of vesicles 97.57
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.55
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.54
PF1342844 TPR_14: Tetratricopeptide repeat 97.53
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.52
PF07707103 BACK: BTB And C-terminal Kelch; InterPro: IPR01170 97.52
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.52
KOG2610491 consensus Uncharacterized conserved protein [Funct 97.5
KOG1585308 consensus Protein required for fusion of vesicles 97.5
KOG1586288 consensus Protein required for fusion of vesicles 97.5
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.47
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.44
KOG1586288 consensus Protein required for fusion of vesicles 97.4
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.39
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.37
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.36
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 97.36
PF1343134 TPR_17: Tetratricopeptide repeat 97.33
KOG2610 491 consensus Uncharacterized conserved protein [Funct 97.26
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 97.21
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.16
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.15
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.05
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.04
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.03
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 96.96
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 96.96
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 96.96
KOG0530318 consensus Protein farnesyltransferase, alpha subun 96.94
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 96.93
KOG1550 552 consensus Extracellular protein SEL-1 and related 96.93
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 96.93
PF11822317 DUF3342: Domain of unknown function (DUF3342); Int 96.89
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 96.89
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 96.87
smart00875101 BACK BTB And C-terminal Kelch. The BACK domain is 96.84
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 96.83
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.77
KOG2714465 consensus SETA binding protein SB1 and related pro 96.73
KOG2471 696 consensus TPR repeat-containing protein [General f 96.73
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 96.66
smart00512104 Skp1 Found in Skp1 protein family. Family of Skp1 96.59
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 96.55
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 96.5
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 96.46
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 96.44
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.43
COG4649221 Uncharacterized protein conserved in bacteria [Fun 96.42
KOG1665302 consensus AFH1-interacting protein FIP2, contains 96.41
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 96.4
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 96.35
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 96.31
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.3
KOG0530318 consensus Protein farnesyltransferase, alpha subun 96.19
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.15
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.13
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 96.1
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 96.07
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 96.07
PF0393162 Skp1_POZ: Skp1 family, tetramerisation domain; Int 96.07
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 96.03
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 95.99
KOG1724162 consensus SCF ubiquitin ligase, Skp1 component [Po 95.95
KOG4507 886 consensus Uncharacterized conserved protein, conta 95.89
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 95.89
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 95.87
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 95.77
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 95.77
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 95.68
KOG1464 440 consensus COP9 signalosome, subunit CSN2 [Posttran 95.59
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 95.54
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 95.51
PF09986214 DUF2225: Uncharacterized protein conserved in bact 95.42
COG5159421 RPN6 26S proteasome regulatory complex component [ 95.41
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 95.24
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 95.17
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 95.1
KOG1463411 consensus 26S proteasome regulatory complex, subun 95.05
KOG1778319 consensus CREB binding protein/P300 and related TA 95.01
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 94.96
COG4649221 Uncharacterized protein conserved in bacteria [Fun 94.9
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 94.88
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 94.8
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 94.73
KOG0511516 consensus Ankyrin repeat protein [General function 94.48
PF09986214 DUF2225: Uncharacterized protein conserved in bact 94.3
KOG3783546 consensus Uncharacterized conserved protein [Funct 94.29
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 94.06
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 93.98
COG4976287 Predicted methyltransferase (contains TPR repeat) 93.88
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 93.8
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 93.76
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 93.75
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 93.65
KOG4507 886 consensus Uncharacterized conserved protein, conta 93.64
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 93.57
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 93.48
COG4976 287 Predicted methyltransferase (contains TPR repeat) 93.41
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 93.4
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 93.3
KOG4014248 consensus Uncharacterized conserved protein (conta 93.23
KOG1463411 consensus 26S proteasome regulatory complex, subun 93.14
KOG3364149 consensus Membrane protein involved in organellar 92.95
PRK10941269 hypothetical protein; Provisional 92.8
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 92.67
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 92.66
PRK10941269 hypothetical protein; Provisional 92.45
KOG2041 1189 consensus WD40 repeat protein [General function pr 92.39
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 92.38
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 92.23
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 92.18
KOG3807 556 consensus Predicted membrane protein ST7 (tumor su 92.12
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 92.02
PF1286294 Apc5: Anaphase-promoting complex subunit 5 91.79
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 91.77
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 91.16
COG5159421 RPN6 26S proteasome regulatory complex component [ 91.12
KOG2715210 consensus Uncharacterized conserved protein, conta 91.03
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 90.86
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 90.82
COG5201158 SKP1 SCF ubiquitin ligase, SKP1 component [Posttra 90.7
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 90.67
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 90.3
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 90.24
KOG3364149 consensus Membrane protein involved in organellar 90.23
KOG2396 568 consensus HAT (Half-A-TPR) repeat-containing prote 90.04
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 89.35
KOG3840438 consensus Uncharaterized conserved protein, contai 89.12
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 89.11
KOG2581 493 consensus 26S proteasome regulatory complex, subun 88.88
PF15015 569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 88.66
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 88.61
PF0146678 Skp1: Skp1 family, dimerisation domain; InterPro: 87.97
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 87.92
KOG1310 758 consensus WD40 repeat protein [General function pr 87.88
PF1286294 Apc5: Anaphase-promoting complex subunit 5 87.87
KOG2396 568 consensus HAT (Half-A-TPR) repeat-containing prote 87.8
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 87.54
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 87.35
KOG3807556 consensus Predicted membrane protein ST7 (tumor su 87.06
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 86.52
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 86.2
KOG2422 665 consensus Uncharacterized conserved protein [Funct 86.0
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 85.51
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 84.58
KOG0529 421 consensus Protein geranylgeranyltransferase type I 84.47
COG5191 435 Uncharacterized conserved protein, contains HAT (H 84.15
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 83.33
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 83.0
KOG2422665 consensus Uncharacterized conserved protein [Funct 82.77
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 82.23
KOG4814 872 consensus Uncharacterized conserved protein [Funct 82.1
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 81.92
COG3629280 DnrI DNA-binding transcriptional activator of the 80.93
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=2.4e-40  Score=338.28  Aligned_cols=389  Identities=18%  Similarity=0.137  Sum_probs=350.6

Q ss_pred             hhhHHHHHHHHhhhhhhhhHHHHHHHhhhhhHhhcccHHHHHHHHHHHHhcC--cchhhhhHHHHHHHhCCchHHHHHHH
Q 005529          235 SNTTVMLLERLGECSTERWQRMLALHQLGCVMFEREEYKDACYYFEAAADAG--HIYSLAGLARAKYKVGQQYSAYKLIN  312 (692)
Q Consensus       235 ~~~a~~~l~~~~~~~~~~~~~~~a~~~lg~~~~~~g~~~~A~~~~~~al~~~--~~~a~~~la~~~~~~g~~~~A~~~~~  312 (692)
                      .+.....-..+++..|.   -++++.++|+++..+|++++|+..|+.+++.+  .++++.++|.++..+|+...|.+.+.
T Consensus        98 ~d~s~a~~~~a~r~~~q---~ae~ysn~aN~~kerg~~~~al~~y~~aiel~p~fida~inla~al~~~~~~~~a~~~~~  174 (966)
T KOG4626|consen   98 LDKSSAGSLLAIRKNPQ---GAEAYSNLANILKERGQLQDALALYRAAIELKPKFIDAYINLAAALVTQGDLELAVQCFF  174 (966)
T ss_pred             hhhhhhhhhhhhhccch---HHHHHHHHHHHHHHhchHHHHHHHHHHHHhcCchhhHHHhhHHHHHHhcCCCcccHHHHH
Confidence            55555555555655554   35789999999999999999999999999875  57899999999999999999999999


Q ss_pred             HHHhccCCcchhhhhhhh----ccccchHHhhHHHHHhcCCCCchhhhHHHHHHHhhCCHHHHHHHHHHHHcccCC-hhH
Q 005529          313 SIISEHKPTGWMYQERSL----YNLGREKIVDLNYASELDPTLSFPYKYRAVAKMEEGQIRAAISEIDRIIVFKLS-VDC  387 (692)
Q Consensus       313 ~~~~~~~~~~~~~~~~~~----~~~~~~a~~~~~~a~~~~p~~~~~~~~~a~~~~~~~~~~~A~~~~~~~l~~~p~-~~~  387 (692)
                      .++..+|++.-+....+.    .+...+|-..|.+|++.+|..+.+|..+|-++..+|+.-.|+..|+++++++|+ .++
T Consensus       175 ~alqlnP~l~ca~s~lgnLlka~Grl~ea~~cYlkAi~~qp~fAiawsnLg~~f~~~Gei~~aiq~y~eAvkldP~f~dA  254 (966)
T KOG4626|consen  175 EALQLNPDLYCARSDLGNLLKAEGRLEEAKACYLKAIETQPCFAIAWSNLGCVFNAQGEIWLAIQHYEEAVKLDPNFLDA  254 (966)
T ss_pred             HHHhcCcchhhhhcchhHHHHhhcccchhHHHHHHHHhhCCceeeeehhcchHHhhcchHHHHHHHHHHhhcCCCcchHH
Confidence            999999986544332222    234578999999999999999999999999999999999999999999999997 688


Q ss_pred             HHHHHHHHHHhccHHHHHHHHHHHHhcCCCcchhccccchhHHHHHHHHHhhhcCchhhHHHhhhccccccccchHHHHH
Q 005529          388 LELRAWLFIAADDYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSLAVIN  467 (692)
Q Consensus       388 l~~~a~~~~~~g~~~~A~~~~~~~l~~~p~~~~~~~~~~~~~~~~l~~~~~~~~~~a~~~~~l~~~~~~~~~~~al~~~~  467 (692)
                      +..+|.+|..++.+++|+..|.+++.+.|++...+++++.-+..           +             +.---++..+.
T Consensus       255 YiNLGnV~ke~~~~d~Avs~Y~rAl~lrpn~A~a~gNla~iYye-----------q-------------G~ldlAI~~Yk  310 (966)
T KOG4626|consen  255 YINLGNVYKEARIFDRAVSCYLRALNLRPNHAVAHGNLACIYYE-----------Q-------------GLLDLAIDTYK  310 (966)
T ss_pred             HhhHHHHHHHHhcchHHHHHHHHHHhcCCcchhhccceEEEEec-----------c-------------ccHHHHHHHHH
Confidence            88999999999999999999999999999999888887643211           0             00011466788


Q ss_pred             HHHhcCCCChHHHHHHHHHHHHhcCHHHHHHHHHHHHhcCCcchHHHHHHHHHHHHcCCHHHHHHHHHHHHhccCCh-HH
Q 005529          468 QMLINDPGKSFLRFRQSLLLLRLNCQKAAMRCLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKSISIERTF-EA  546 (692)
Q Consensus       468 ~~l~~~p~~~~~~~~~a~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~p~~-~a  546 (692)
                      ++++..|.-+.++..+|..+-..|+..+|..+|.+++.+.|+.+++.+++|.++..+|.+++|...|.+++..+|++ .+
T Consensus       311 ral~~~P~F~~Ay~NlanALkd~G~V~ea~~cYnkaL~l~p~hadam~NLgni~~E~~~~e~A~~ly~~al~v~p~~aaa  390 (966)
T KOG4626|consen  311 RALELQPNFPDAYNNLANALKDKGSVTEAVDCYNKALRLCPNHADAMNNLGNIYREQGKIEEATRLYLKALEVFPEFAAA  390 (966)
T ss_pred             HHHhcCCCchHHHhHHHHHHHhccchHHHHHHHHHHHHhCCccHHHHHHHHHHHHHhccchHHHHHHHHHHhhChhhhhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999 99


Q ss_pred             HHHHHHHHHHcCCCchhhHHHHHHHHHHhcCCCCCCChH--HHHHHHHHHHHHcCCHHHHHHHHHHHHhcc--cHHHHHH
Q 005529          547 FFLKAYILADTNLDPESSTYVIQLLEEALRCPSDGLRKG--QALNNLGSIYVECGKLDQAENCYINALDIK--HTRAHQG  622 (692)
Q Consensus       547 ~~~lg~~~~~~~~~~~A~~~~~~~~~~al~~~~~~~~~~--~~~~~lg~~~~~~g~~~~A~~~~~~al~~~--~~~~~~~  622 (692)
                      +.++|.+|.++|++++|+..    |++++     .+.|.  +++.++|.+|..+|+.+.|+++|.+|+.++  .+.+|.|
T Consensus       391 ~nNLa~i~kqqgnl~~Ai~~----Ykeal-----rI~P~fAda~~NmGnt~ke~g~v~~A~q~y~rAI~~nPt~AeAhsN  461 (966)
T KOG4626|consen  391 HNNLASIYKQQGNLDDAIMC----YKEAL-----RIKPTFADALSNMGNTYKEMGDVSAAIQCYTRAIQINPTFAEAHSN  461 (966)
T ss_pred             hhhHHHHHHhcccHHHHHHH----HHHHH-----hcCchHHHHHHhcchHHHHhhhHHHHHHHHHHHHhcCcHHHHHHhh
Confidence            99999999999999999999    99999     99999  999999999999999999999999999999  8999999


Q ss_pred             HHHHHHHcCCHHHHHHHHHHHHHHcCCCHHHHHHHhh
Q 005529          623 LARVYYLKNELKAAYDEMTKLLEKAQYSASAFEKRSE  659 (692)
Q Consensus       623 lg~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~lg~  659 (692)
                      ||.+|...|+..+|+..|+++++++||.++++.++..
T Consensus       462 Lasi~kDsGni~~AI~sY~~aLklkPDfpdA~cNllh  498 (966)
T KOG4626|consen  462 LASIYKDSGNIPEAIQSYRTALKLKPDFPDAYCNLLH  498 (966)
T ss_pred             HHHHhhccCCcHHHHHHHHHHHccCCCCchhhhHHHH
Confidence            9999999999999999999999999999999999887

>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4350 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG4591 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2075 consensus Topoisomerase TOP1-interacting protein BTBD1 [Function unknown] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PF00651 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB (for BR-C, ttk and bab) [] or POZ (for Pox virus and Zinc finger) [] domain is present near the N terminus of a fraction of zinc finger (IPR007087 from INTERPRO) proteins and in proteins that contain the IPR006652 from INTERPRO motif such as Kelch and a family of pox virus proteins Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG4682 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>smart00225 BTB Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG2716 consensus Polymerase delta-interacting protein PDIP1 and related proteins, contain BTB/POZ domain [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2838 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF02214 BTB_2: BTB/POZ domain; InterPro: IPR003131 Potassium channels are the most diverse group of the ion channel family [, ] Back     alignment and domain information
>KOG1987 consensus Speckle-type POZ protein SPOP and related proteins with TRAF, MATH and BTB/POZ domains [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2838 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3473 consensus RNA polymerase II transcription elongation factor Elongin/SIII, subunit elongin C [Transcription] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF07707 BACK: BTB And C-terminal Kelch; InterPro: IPR011705 This domain is found associated with (IPR000210 from INTERPRO) and (IPR006652 from INTERPRO) Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PF11822 DUF3342: Domain of unknown function (DUF3342); InterPro: IPR021777 This family of proteins are functionally uncharacterised Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>smart00875 BACK BTB And C-terminal Kelch Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG2714 consensus SETA binding protein SB1 and related proteins, contain BTB/POZ domain [General function prediction only] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>smart00512 Skp1 Found in Skp1 protein family Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1665 consensus AFH1-interacting protein FIP2, contains BTB/POZ domain and pentapeptide repeats [General function prediction only] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF03931 Skp1_POZ: Skp1 family, tetramerisation domain; InterPro: IPR016073 SKP1 (together with SKP2) was identified as an essential component of the cyclin A-CDK2 S phase kinase complex [] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>KOG1724 consensus SCF ubiquitin ligase, Skp1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1778 consensus CREB binding protein/P300 and related TAZ Zn-finger proteins [Transcription] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG4014 consensus Uncharacterized conserved protein (contains TPR repeat) [Function unknown] Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2715 consensus Uncharacterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>COG5201 SKP1 SCF ubiquitin ligase, SKP1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG3840 consensus Uncharaterized conserved protein, contains BTB/POZ domain [General function prediction only] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF01466 Skp1: Skp1 family, dimerisation domain; InterPro: IPR016072 SKP1 (together with SKP2) was identified as an essential component of the cyclin A-CDK2 S phase kinase complex [] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query692
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-16
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 5e-09
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-04
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-14
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-07
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 3e-12
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 1e-04
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 7e-12
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-10
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 5e-06
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 9e-06
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 5e-04
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 8e-12
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 9e-08
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-06
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 9e-04
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 2e-11
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 3e-08
2ho1_A 252 Type 4 fimbrial biogenesis protein PILF; type IV p 1e-05
2gw1_A514 Mitochondrial precursor proteins import receptor; 4e-11
2gw1_A 514 Mitochondrial precursor proteins import receptor; 6e-10
2gw1_A514 Mitochondrial precursor proteins import receptor; 4e-09
2gw1_A 514 Mitochondrial precursor proteins import receptor; 2e-04
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-10
3u4t_A272 TPR repeat-containing protein; structural genomics 4e-10
3u4t_A 272 TPR repeat-containing protein; structural genomics 8e-05
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 4e-10
4eqf_A365 PEX5-related protein; accessory protein, tetratric 2e-05
4eqf_A365 PEX5-related protein; accessory protein, tetratric 4e-05
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 7e-10
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 5e-09
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-08
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-07
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-04
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 3e-09
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 2e-06
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-09
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-06
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 7e-06
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 7e-06
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-04
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 7e-04
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 7e-09
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 6e-08
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 9e-05
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 1e-08
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 5e-05
2vq2_A 225 PILW, putative fimbrial biogenesis and twitching m 2e-04
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 5e-04
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 2e-08
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 2e-06
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 3e-04
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 3e-08
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 3e-06
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 6e-04
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 3e-08
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 4e-08
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 5e-08
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 4e-08
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-07
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 1e-05
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 7e-08
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 7e-05
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 1e-04
4eoz_A145 Speckle-type POZ protein; E3 ubiquitin ligase, nuc 7e-08
3hqi_A312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 9e-08
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 1e-07
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 5e-06
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 4e-05
2pl2_A 217 Hypothetical conserved protein TTC0263; TPR, prote 6e-05
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 7e-05
4g1t_A472 Interferon-induced protein with tetratricopeptide 1e-07
4g1t_A472 Interferon-induced protein with tetratricopeptide 3e-06
4g1t_A 472 Interferon-induced protein with tetratricopeptide 9e-06
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 2e-07
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 5e-04
2if5_A120 Zinc finger and BTB domain-containing protein 7A; 2e-07
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 2e-07
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 2e-07
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-07
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 1e-06
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-05
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 2e-07
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 9e-06
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 2e-04
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 4e-07
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 4e-06
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 4e-07
3k9i_A117 BH0479 protein; putative protein binding protein, 4e-07
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 6e-07
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 1e-06
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 1e-04
3uq3_A 258 Heat shock protein STI1; HSP90, peptide binding, c 7e-07
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 9e-06
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 2e-04
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 7e-07
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 2e-06
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 1e-05
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 8e-07
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 4e-05
3q15_A378 PSP28, response regulator aspartate phosphatase H; 1e-06
3q15_A378 PSP28, response regulator aspartate phosphatase H; 3e-06
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 3e-06
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 3e-05
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 5e-05
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 4e-06
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 1e-04
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 1e-04
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 5e-06
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 5e-06
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 3e-05
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 6e-04
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 6e-06
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 9e-06
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 6e-05
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 8e-06
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 1e-05
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 3e-04
3ohu_A125 Transcription regulator protein BACH2; BTB/POZ dom 3e-05
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 6e-05
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 8e-05
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 1e-04
2z8h_A138 Transcription regulator protein BACH1; BTB, POZ, d 2e-04
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 2e-04
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 4e-04
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 2e-04
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 4e-04
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 9e-04
2vpk_A116 Myoneurin; transcription regulation, transcription 3e-04
2ppi_A144 Gigaxonin; BTB domain, protein degradation, struct 3e-04
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 4e-04
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 5e-04
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 7e-04
3i3n_A279 Kelch-like protein 11; structural genomics, BTB, K 7e-04
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
 Score = 81.7 bits (202), Expect = 2e-16
 Identities = 52/382 (13%), Positives = 117/382 (30%), Gaps = 31/382 (8%)

Query: 329 SLYNLGR--EKIVDLNYASELDPTLSFPYKYRAVAKMEEGQIRAAISEIDRIIVFK-LSV 385
            L   G+  + +   + A + DP     Y  RA   +  G+ +AA+ ++ ++I  K    
Sbjct: 35  KLLAAGQLADALSQFHAAVDGDPDNYIAYYRRATVFLAMGKSKAALPDLTKVIQLKMDFT 94

Query: 386 DCLELRAWLFIAADDYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHHVRSWSPAD 445
                R  L +     + A  D   +L    +        S       +         A 
Sbjct: 95  AARLQRGHLLLKQGKLDEAEDDFKKVLKSNPSENEEKEAQSQLIKSDEMQRLRSQ---AL 151

Query: 446 CWIKLYDRWSSVDDIGSLAVINQMLINDPGKSFLRFRQSLLLLRLNCQKAAMRCLRLARN 505
                   +++      +A ++++L      + LR  ++   ++    + A+  L+ A  
Sbjct: 152 NAFGS-GDYTAA-----IAFLDKILEVCVWDAELRELRAECFIKEGEPRKAISDLKAASK 205

Query: 506 HSSSEHERLVYEGWILYDTGHREEALSRAEKSISIERTF-EAFFLKAYILADTNLDPESS 564
             +   E       + Y  G  E +LS   + + +++     F     +     L   + 
Sbjct: 206 LKNDNTEAFYKISTLYYQLGDHELSLSEVRECLKLDQDHKRCFAHYKQVKKLNKLIESAE 265

Query: 565 TYV--------IQLLEEALRC-PSDGLRKGQALNNLGSIYVECGKLDQAENCYINALDIK 615
             +            E  ++  PS      ++   +   + +  K  +A       L ++
Sbjct: 266 ELIRDGRYTDATSKYESVMKTEPSIAEYTVRSKERICHCFSKDEKPVEAIRVCSEVLQME 325

Query: 616 --HTRAHQGLARVYYLKNELKAAYDEMTKLLEKAQYSASAFEKRS--EYSDREMAKNDLN 671
             +  A +  A  Y ++     A  +     E  +      E     +   ++  K D  
Sbjct: 326 PDNVNALKDRAEAYLIEEMYDEAIQDYETAQEHNENDQQIREGLEKAQRLLKQSQKRDYY 385

Query: 672 MATQLDPLRTYP-----YRYRA 688
               +            YR  A
Sbjct: 386 KILGVKRNAKKQEIIKAYRKLA 407
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Length = 145 Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Length = 312 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Length = 120 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Length = 172 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Length = 109 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Length = 127 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} PDB: 3ohv_A Length = 125 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Length = 138 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Length = 116 Back     alignment and structure
>2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Length = 144 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} Length = 279 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 692
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 9e-11
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-09
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 9e-05
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 1e-04
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 2e-04
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 0.001
d1zbpa1 264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 0.001
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 62.0 bits (149), Expect = 9e-11
 Identities = 46/387 (11%), Positives = 104/387 (26%), Gaps = 27/387 (6%)

Query: 322 GWMYQERSLYNLGR--EKIVDLNYASELDPTLSFPYKYRAVAKMEEGQIRAAISEIDRII 379
           G M      Y  G               +P  +      +    +  ++  +       I
Sbjct: 1   GPMELAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAI 60

Query: 380 -VFKLSVDCLELRAWLFIAADDYESALRDTLALLALESNYMMFHGRVSGDHLVKLLNHH- 437
               L  +       ++      + A+      L L+ +++  +  ++   +        
Sbjct: 61  KQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGA 120

Query: 438 ---------VRSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKSFLRFRQSLLLL 488
                                     +      + A   + +   P  +        +  
Sbjct: 121 VQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFN 180

Query: 489 RLNCQKAAMRCLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKSISIERTF-EAF 547
                  A+     A     +  +  +  G +L +    + A++   +++S+        
Sbjct: 181 AQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVH 240

Query: 548 FLKAYILADTNLDPESSTYVIQLLEEALRCPSDGLRKGQALNNLGSIYVECGKLDQAENC 607
              A +  +  L   +    I     A+           A  NL +   E G + +AE+C
Sbjct: 241 GNLACVYYEQGLIDLA----IDTYRRAIELQPH---FPDAYCNLANALKEKGSVAEAEDC 293

Query: 608 YINALDI--KHTRAHQGLARVYYLKNELKAAYDEMTKLLEKAQYSASAFEKR----SEYS 661
           Y  AL +   H  +   LA +   +  ++ A     K LE     A+A         +  
Sbjct: 294 YNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQG 353

Query: 662 DREMAKNDLNMATQLDPLRTYPYRYRA 688
             + A      A ++ P     Y    
Sbjct: 354 KLQEALMHYKEAIRISPTFADAYSNMG 380
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query692
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.96
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.96
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.94
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.93
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.92
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.9
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.88
d1r29a_122 B-cell lymphoma 6 (Bcl6) protein BTB domain {Human 99.88
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.88
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.87
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.86
d1buoa_121 Promyelocytic leukaemia zinc finger (PLZF) protein 99.86
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.78
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.76
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.7
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.68
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.65
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.63
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.62
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.59
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.58
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.56
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.5
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.49
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.49
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.49
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.45
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.43
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.43
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.4
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.39
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.38
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.32
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.32
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.28
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.26
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.25
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.25
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.24
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.2
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.19
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.17
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.14
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.11
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.04
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.99
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.96
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.94
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.82
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.73
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.72
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.64
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 98.2
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 98.07
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.95
d2c9wc196 Elongin C {Human (Homo sapiens) [TaxId: 9606]} 97.87
d1hv2a_99 Elongin C {Baker's yeast (Saccharomyces cerevisiae 97.75
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.72
d1nn7a_105 Potassium channel kv4.2 {Rat (Rattus norvegicus) [ 97.49
d3kvta_103 akv3.1 voltage-gated potassium channel {California 97.1
d1t1da_100 Shaker potassium channel {California sea hare (Apl 96.98
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 96.46
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 93.17
d1nexa272 Centromere DNA-binding protein complex Cbf3 subuni 91.25
d1fs1b261 Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sa 88.06
d1fs1b155 Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sa 86.52
d1nexa170 Centromere DNA-binding protein complex Cbf3 subuni 85.56
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=3.9e-39  Score=257.98  Aligned_cols=368  Identities=16%  Similarity=0.123  Sum_probs=287.5

Q ss_pred             HHHHHHHHHHCCCHHHHHHHHHHHHHCC--CCHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCCH
Q ss_conf             8741024752224899999999998427--62001457999987089458999999877405986223334321036302
Q 005529          259 LHQLGCVMFEREEYKDACYYFEAAADAG--HIYSLAGLARAKYKVGQQYSAYKLINSIISEHKPTGWMYQERSLYNLGRE  336 (692)
Q Consensus       259 ~~~lg~~~~~~~~~~~A~~~~~~al~~~--~~~a~~~la~~~~~~g~~~~A~~~~~~~i~~~~~~~~~~~~~~~~~~~~~  336 (692)
                      ++.+|..+++.|+|++|+..|+++++..  +..++..+|.++..+|++++|+..                          
T Consensus         2 ll~la~~~~~~G~~~~A~~~~~~~l~~~p~~~~~~~~la~~~~~~~~~~~A~~~--------------------------   55 (388)
T d1w3ba_           2 PMELAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHF--------------------------   55 (388)
T ss_dssp             CCTHHHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHH--------------------------
T ss_pred             HHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHHHHHH--------------------------
T ss_conf             699999999869999999999999986899899999999999986999999999--------------------------


Q ss_pred             HHHHHHHHHHCCCCCCHHHHHHHHHHHHHCCHHHHHHHHHHHHCCCCC-HHHHHHHHHHHHHHCCHHHHHHHHHHHHHCC
Q ss_conf             786287988529999614667999998609989999999988725679-6389999999997011999999999998607
Q 005529          337 KIVDLNYASELDPTLSFPYKYRAVAKMEEGQIRAAISEIDRIIVFKLS-VDCLELRAWLFIAADDYESALRDTLALLALE  415 (692)
Q Consensus       337 a~~~l~~a~~~~p~~~~~~~~~a~~~~~~~~~~~A~~~~~k~l~~~p~-~~~l~l~a~~~~~~g~~~~A~~~~~~al~~~  415 (692)
                          ++++++++|+...++..+|.++..+|++++|+..+.+++...|. .......+......+....+...........
T Consensus        56 ----~~~al~~~p~~~~a~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  131 (388)
T d1w3ba_          56 ----STLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYN  131 (388)
T ss_dssp             ----HHHHHHHCTTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHC
T ss_pred             ----HHHHHHHCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             ----9999985999899999999996420002222222221211222222222222222222222222222211122222


Q ss_pred             CCCCHHCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHCCCCCCCCCHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCHHH
Q ss_conf             88600201352227999878876301803369986300465462013999999976399993898999999998169999
Q 005529          416 SNYMMFHGRVSGDHLVKLLNHHVRSWSPADCWIKLYDRWSSVDDIGSLAVINQMLINDPGKSFLRFRQSLLLLRLNCQKA  495 (692)
Q Consensus       416 p~~~~~~~~~~~~~~~~l~~~~~~~~~~a~~~~~l~~~~~~~~~~~al~~~~~~l~~~p~~~~~~~~~a~~~~~~~~~~~  495 (692)
                      +.......        ...... .               .............+.+...|..+..+..+|..+...+++++
T Consensus       132 ~~~~~~~~--------~~~~~~-~---------------~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~  187 (388)
T d1w3ba_         132 PDLYCVRS--------DLGNLL-K---------------ALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWL  187 (388)
T ss_dssp             TTCTHHHH--------HHHHHH-H---------------TTSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHH
T ss_pred             CCCCCCCC--------CCCCCC-C---------------CCCHHHHHHHHHHHHHCCCCCHHHHHHHHCCCCCCCCCHHH
T ss_conf             22222222--------222222-1---------------10001356788887402586106899863630102471999


Q ss_pred             HHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCH-HHHHHHHHHHHHCCCCCHHHHHHHHHHHHH
Q ss_conf             9999999995099606999999999998699899999999998023781-799999999998699901268999999999
Q 005529          496 AMRCLRLARNHSSSEHERLVYEGWILYDTGHREEALSRAEKSISIERTF-EAFFLKAYILADTNLDPESSTYVIQLLEEA  574 (692)
Q Consensus       496 A~~~~~~al~~~p~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~p~~-~a~~~la~~~~~~~~~~~A~~~~~~~~~~a  574 (692)
                      |...++++++.+|++..++..+|.++...|++++|+..+++++...|.. ..+..+|.++...|++++|+..    |+++
T Consensus       188 A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~----~~~a  263 (388)
T d1w3ba_         188 AIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDT----YRRA  263 (388)
T ss_dssp             HHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHH----HHHH
T ss_pred             HHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHH----HHHH
T ss_conf             999999999849464999999715522005299999999985777554799999999999987899999999----9999


Q ss_pred             HCCCCCCCCHH--HHHHHHHHHHHHCCCHHHHHHHHHHHHHCC--CHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCC
Q ss_conf             63999999957--899999999998299999999999998243--47999999999998089999999999999982899
Q 005529          575 LRCPSDGLRKG--QALNNLGSIYVECGKLDQAENCYINALDIK--HTRAHQGLARVYYLKNELKAAYDEMTKLLEKAQYS  650 (692)
Q Consensus       575 l~~~~~~~~~~--~~~~~lg~~~~~~g~~~~A~~~~~~al~~~--~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~p~~  650 (692)
                      +     .++|+  .++.++|.++...|++++|++.+++++...  +...+..+|.++..+|++++|+..++++++.+|++
T Consensus       264 l-----~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~  338 (388)
T d1w3ba_         264 I-----ELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEF  338 (388)
T ss_dssp             H-----HTCSSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTSCTTC
T ss_pred             H-----HHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCC
T ss_conf             9-----84999899999999999974879999999986540487300101579999998789999999999999868898


Q ss_pred             HHHHHHHHH----CCCHHHHHHHHHHHHCCCCCCCCCCHHHHH
Q ss_conf             999999960----499799999999956219988873102210
Q 005529          651 ASAFEKRSE----YSDREMAKNDLNMATQLDPLRTYPYRYRAA  689 (692)
Q Consensus       651 ~~~~~~lg~----~g~~~~A~~~~~~al~~~P~~~~~~~~r~~  689 (692)
                      +.++..+|.    .|++++|+..|++|++++|+.+..|...|.
T Consensus       339 ~~~~~~la~~~~~~g~~~~A~~~~~~al~l~P~~~~a~~~lg~  381 (388)
T d1w3ba_         339 AAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGN  381 (388)
T ss_dssp             HHHHHHHHHHHHTTTCCHHHHHHHHHHHTTCTTCHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHH
T ss_conf             9999999999998599999999999999709998999999999
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c9wc1 d.42.1.1 (C:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv2a_ d.42.1.1 (A:) Elongin C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nn7a_ d.42.1.2 (A:) Potassium channel kv4.2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3kvta_ d.42.1.2 (A:) akv3.1 voltage-gated potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} Back     information, alignment and structure
>d1t1da_ d.42.1.2 (A:) Shaker potassium channel {California sea hare (Aplysia californica) [TaxId: 6500]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nexa2 d.42.1.1 (A:4-103) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fs1b2 d.42.1.1 (B:2-68) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fs1b1 a.157.1.1 (B:86-140) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexa1 a.157.1.1 (A:116-185) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure