Citrus Sinensis ID: 005572


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690
MKIFCRLPLLFSLSLVVLAQSTCNSKDQELVSKAFSSVSTFNISWLKPTNLNGSNPSTPIRELNLSSRNLSGIISWKFLRNMSELHSIDLSNNSLKGSVPGWFWSTQSLTQVNLSKNRFGGTIGFKPTSRNGPFPSVQVLNLSSNRFTNLVKLSQFSKLMVLDVSNNDLRILPSGFANLSKLRHLDISSCKISGNIKPVSFLHSLKYLDVSNNSMNGTFPSDFPPLSGVKFLNISLNKFTGFVGHDKYQKFGKSAFIQGGSFVFDTTKTPRPSNNHIMPHVDSSRTPPYKIVHKHNPAVQKHRSKAKALVIGLSCASAFVFVFGIAIIFCMCRRRKILARRNKWAISKPVNQQLPFKVEKSGPFSFETESGTSWMADIKEPTSAAVIMCSKPLVNYLTFKDLIAATSHFGKESLLAEGRCGPVYRAVLPGELHVAIKVLDNAKGIDHDDAVAMFDELSRLKHPNLLPLAGYCIAGKEKLVLLEFMANGDLHRWLHELPTGEPNVEDWSTDTWDHHPGAGSHISSPEKTNWVTRHRIAIGVARGLAYLHHVGSTHGHLVTSSILLAESLEPKIAGFGLRNIGVKNVGERSENETCGPESDVYCFGVILMELLTGKRGTDDCVKWVRKLVKEGAGGDALDFRLKLGSGDSVAEMVESLRVGYLCTADSPGKRPTMQQVLGLLKDIRPSADLS
ccEEEEcHHHHHHHHHHHHHHccccccccccHHHHcccccccccccccccccccccccccEEEEccccccEEEccHHHHcccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccccccEEEcccccccccccccccccccEEEccccccccccccccccccccEEEccccccccccccccccccccEEEccccccEEcccccccccccccEEccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccHHHHHHHHcccccccEEcccccccEEEEEEccccEEEEEEEcccccccHHHHHHHHHHHccccccccccccEEEEcccEEEEEEcccccccHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccEEcccccccEEccccccccccccccccccccccccccccccHHHHHHHHHccccccccHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHccccccccc
ccccccccHHHcccccEEEEEcccccccccccHHHcccccccEEEEccccccccccccccEEEEcccccccccccHHHHHccccccEEEcccccccccccHHHccccccEEEEcccccccccccHHHHHHcccccccEEEEcccccccccccccccccccEEEccccccccccHHHccccccEEEEEcccccccccccccccccccEEEcccccccccccHHHccccccEEEEcccccccccccHHHHHHcccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHcccccccccccccccccccccccccccccccccccccccEEEEccccccEccHHHHHHHHccccHccEEEcccccEEEEEEcccccEEEEEEEccccccccHHHHHHHHHHHHccccccHHHHEEEcccccEEEEEEccccccHHHHHHcccccccccccccccccHccccccccccccccccHHHHHHHHHHHHHHHHHHccccEEEcccccccEEcccccHHHHHHHHHHHHHcccccHHcEEEEEcccccEEHHHHHHHHHHccccccHHHHHHHHHHHHcccccHEccHHHccccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccccccc
mkifcrlpllFSLSLVVLAQStcnskdqeLVSKAFSSVstfniswlkptnlngsnpstpirelnLSSRNLSGIISWKFLRNMSElhsidlsnnslkgsvpgwfwstqsLTQVnlsknrfggtigfkptsrngpfpsvqvLNLSSNRFTNLVKLSQFSKLMVldvsnndlrilpsgfanlsklrhldissckisgnikpvsfLHSLKyldvsnnsmngtfpsdfpplsgvkfLNISLNKftgfvghdkyqkfgksafiqggsfvfdttktprpsnnhimphvdssrtppykivhkhnpavqKHRSKAKALVIGLSCASAFVFVFGIAIIFCMCRRRKILARRNKwaiskpvnqqlpfkveksgpfsfetesgtswmadikeptSAAVIMCSKPLVNYLTFKDLIAATSHfgkesllaegrcgpvyravlpGELHVAIKVldnakgidhddAVAMFDElsrlkhpnllplagyciagKEKLVLLEFMANGDLHRwlhelptgepnvedwstdtwdhhpgagshisspektnwvtRHRIAIGVARGLAYLHHVGSTHGHLVTSSILLaeslepkiagfglrnigvknvgersenetcgpesdvyCFGVILMELltgkrgtddCVKWVRKLVKegaggdaldfrlklgsgdsVAEMVESLRVGYLctadspgkrptMQQVLGLLkdirpsadls
MKIFCRLPLLFSLSLVVLAQSTCNSKDQELVSKAFSSVSTfniswlkptnlngsnpsTPIRELNLSSRNLSGIISWKFLRNMSELHSIDLSNNSLKGSVPGWFWSTQSLTQVNLSKNRFGGTIGFKPTSRNGPFPSVQVLNLSSNRFTNLVKLSQFSKLMVLDVSNNDLRILPSGFANLSKLRHLDISSCKISGNIKPVSFLHSLKYLDVSNNSMNGTFPSDFPPLSGVKFLNISLNKFTGFVGHDKYQKFGKSAFIQGGSFVFDTTKtprpsnnhimphvdssrtPPYKIVHKHNPAVQKHRSKAKALVIGLSCASAFVFVFGIAIIFCMCRRRKILARRnkwaiskpvnqqlpfkveksgpFSFETESGTSWMADIKEPTSAAVIMCSKPLVNYLTFKDLIAATSHFGKESLLAEGRCGPVYRAVLPGELHVAIKVLDNAKGIDHDDAVAMFDELSRLKHPNLLPLAGYCIAGKEKLVLLEFMANGDLHRWLHELPTGEPNVEDWSTDTWDHHPGagshisspektnWVTRHRIAIGVARGLAYLHHVGSTHGHLVTSSILLAESLEPKIAGFGLRNIGVKNVgersenetcgpesDVYCFGVILMELLtgkrgtddCVKWVRKLVkegaggdaldfrLKLGSGDSVAEMVESLRVGYLctadspgkrpTMQQVLgllkdirpsadls
MKIFCRlpllfslslvvlAQSTCNSKDQELVSKAFSSVSTFNISWLKPTNLNGSNPSTPIRELNLSSRNLSGIISWKFLRNMSELHSIDLSNNSLKGSVPGWFWSTQSLTQVNLSKNRFGGTIGFKPTSRNGPFPSVQVLNLSSNRFTNLVKLSQFSKLMVLDVSNNDLRILPSGFANLSKLRHLDISSCKISGNIKPVSFLHSLKYLDVSNNSMNGTFPSDFPPLSGVKFLNISLNKFTGFVGHDKYQKFGKSAFIQGGSFVFDTTKTPRPSNNHIMPHVDSSRTPPYKIVHKHNPAVQKHRSKAKALVIGLSCASafvfvfgiaiifCMCRRRKILARRNKWAISKPVNQQLPFKVEKSGPFSFETESGTSWMADIKEPTSAAVIMCSKPLVNYLTFKDLIAATSHFGKESLLAEGRCGPVYRAVLPGELHVAIKVLDNAKGIDHDDAVAMFDELSRLKHPNLLPLAGYCIAGKEKLVLLEFMANGDLHRWLHELPTGEPNVEDWSTDTWDHHPGAGSHISSPEKTNWVTRHRIAIGVARGLAYLHHVGSTHGHLVTSSILLAESLEPKIAGFGLRNIGVKNVGERSENETCGPESDVYCFGVILMELLTGKRGTDDCVKWVRKLVKEGAGGDALDFRLKLGSGDSVAEMVESLRVGYLCTADSPGKRPTMQQVLGLLKDIRPSADLS
**IFCRLPLLFSLSLVVLAQSTCNSKDQELVSKAFSSVSTFNISWLKPT******************RNLSGIISWKFLRNMSELHSIDLSNNSLKGSVPGWFWSTQSLTQVNLSKNRFGGTIGFKPTSRNGPFPSVQVLNLSSNRFTNLVKLSQFSKLMVLDVSNNDLRILPSGFANLSKLRHLDISSCKISGNIKPVSFLHSLKYLDVSNNSMNGTFPSDFPPLSGVKFLNISLNKFTGFVGHDKYQKFGKSAFIQGGSFVFDT***************************************AKALVIGLSCASAFVFVFGIAIIFCMCRRRKILARRNKWAISKPVNQQLPFKV*************TSWMADIKEPTSAAVIMCSKPLVNYLTFKDLIAATSHFGKESLLAEGRCGPVYRAVLPGELHVAIKVLDNAKGIDHDDAVAMFDELSRLKHPNLLPLAGYCIAGKEKLVLLEFMANGDLHRWLHELPTGEPNVEDWSTDTWD*************KTNWVTRHRIAIGVARGLAYLHHVGSTHGHLVTSSILLAESLEPKIAGFGLRNIGVKNVGE*****TCGPESDVYCFGVILMELLTGKRGTDDCVKWVRKLVKEGAGGDALDFRLKLGSGDSVAEMVESLRVGYLCTA**************************
MKIFCRLPLLFSLSLVVLAQSTCNSKDQELVSKAFSSVSTFNISWLKPTNLNGSNPSTPIRELNLSSRNLSGIISWKFLRNMSELHSIDLSNNSLKGSVPGWFWSTQSLTQVNLSKNRFGGTIGFKPTSRNGPFPSVQVLNLSSNRFTNLVKLSQFSKLMVLDVSNNDLRILPSGFANLSKLRHLDISSCKISGNIKPVSFLHSLKYLDVSNNSMNGTFPSDFPPLSGVKFLNISLNKFTGFVGHDKYQKFGKSAFIQGGSFVFDT*******************************************VIGLSCASAFVFVFGIAIIFCMCRRRK****************************************************CSKPLVNYLTFKDLIAATSHFGKESLLAEGRCGPVYRAVLPGELHVAIKVLDNA*****DDA*AMFDELSRLKHPNLLPLAGYCIAGKEKLVLLEFMANGDLHRWLHELPTGEPNVEDWSTDTWD***********PEKTNWVTRHRIAIGVARGLAYLHHVGSTHGHLVTSSILLAESLEPKIAGFGLRNIGVKNVGERSENETCGPESDVYCFGVILMELLTGKRGTDDCVKWVRKLVKEGAGGDALDFRLKLGSGDSVAEMVESLRVGYLCTADSPGKRPTMQQVLGLLK**RP*****
MKIFCRLPLLFSLSLVVLAQSTCNSKDQELVSKAFSSVSTFNISWLKPTNLNGSNPSTPIRELNLSSRNLSGIISWKFLRNMSELHSIDLSNNSLKGSVPGWFWSTQSLTQVNLSKNRFGGTIGFKPTSRNGPFPSVQVLNLSSNRFTNLVKLSQFSKLMVLDVSNNDLRILPSGFANLSKLRHLDISSCKISGNIKPVSFLHSLKYLDVSNNSMNGTFPSDFPPLSGVKFLNISLNKFTGFVGHDKYQKFGKSAFIQGGSFVFDTTKTPRPSNNHIMPHVDSSRTPPYKIVHKH***********KALVIGLSCASAFVFVFGIAIIFCMCRRRKILARRNKWAISKPVNQQLPFKVEKSGPFSFETESGTSWMADIKEPTSAAVIMCSKPLVNYLTFKDLIAATSHFGKESLLAEGRCGPVYRAVLPGELHVAIKVLDNAKGIDHDDAVAMFDELSRLKHPNLLPLAGYCIAGKEKLVLLEFMANGDLHRWLHELPTGEPNVEDWSTDTWDHHPGAGSHISSPEKTNWVTRHRIAIGVARGLAYLHHVGSTHGHLVTSSILLAESLEPKIAGFGLRNIGVKNV*********GPESDVYCFGVILMELLTGKRGTDDCVKWVRKLVKEGAGGDALDFRLKLGSGDSVAEMVESLRVGYLCTADSPGKRPTMQQVLGLLKDIRPSADLS
**IFCRLPLLFSLSLVVLAQSTCNSKDQELVSKAFSSVSTFNISWLKPTNLNGSNPSTPIRELNLSSRNLSGIISWKFLRNMSELHSIDLSNNSLKGSVPGWFWSTQSLTQVNLSKNRFGGTIGFKPTSRNGPFPSVQVLNLSSNRFTNLVKLSQFSKLMVLDVSNNDLRILPSGFANLSKLRHLDISSCKISGNIKPVSFLHSLKYLDVSNNSMNGTFPSDFPPLSGVKFLNISLNKFTGFVGHDKYQKFGKSAFIQGGSFVFDTTKTPRPSNNHIMPHVDSSRTPPYKIVHKHN*******SKAKALVIGLSCASAFVFVFGIAIIFCMCRRRKILA******************************************TSAAVIMCSKPLVNYLTFKDLIAATSHFGKESLLAEGRCGPVYRAVLPGELHVAIKVLDNAKGIDHDDAVAMFDELSRLKHPNLLPLAGYCIAGKEKLVLLEFMANGDLHRWLHELPTGEPNVEDWSTDTWDH**********PEKTNWVTRHRIAIGVARGLAYLHHVGSTHGHLVTSSILLAESLEPKIAGFGLRNIGVKNVGERSENETCGPESDVYCFGVILMELLTGKRGTDDCVKWVRKLVKEGAGGDALDFRLKLGSGDSVAEMVESLRVGYLCTADSPGKRPTMQQVLGLLKDIR******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKIFCRLPLLFSLSLVVLAQSTCNSKDQELVSKAFSSVSTFNISWLKPTNLNGSNPSTPIRELNLSSRNLSGIISWKFLRNMSELHSIDLSNNSLKGSVPGWFWSTQSLTQVNLSKNRFGGTIGFKPTSRNGPFPSVQVLNLSSNRFTNLVKLSQFSKLMVLDVSNNDLRILPSGFANLSKLRHLDISSCKISGNIKPVSFLHSLKYLDVSNNSMNGTFPSDFPPLSGVKFLNISLNKFTGFVGHDKYQKFGKSAFIQGGSFVFDTTKTPRPSNNHIMPHVDSSRTPPYKIVHKHNPAVQKHRSKAKALVIGLSCASAFVFVFGIAIIFCMCRRRKILARRNKWAISKPVNQQLPFKVEKSGPFSFETESGTSWMADIKEPTSAAVIMCSKPLVNYLTFKDLIAATSHFGKESLLAEGRCGPVYRAVLPGELHVAIKVLDNAKGIDHDDAVAMFDELSRLKHPNLLPLAGYCIAGKEKLVLLEFMANGDLHRWLHELPTGEPNVEDWSTDTWDHHPGAGSHISSPEKTNWVTRHRIAIGVARGLAYLHHVGSTHGHLVTSSILLAESLEPKIAGFGLRNIGVKNVGERSENETCGPESDVYCFGVILMELLTGKRGTDDCVKWVRKLVKEGAGGDALDFRLKLGSGDSVAEMVESLRVGYLCTADSPGKRPTMQQVLGLLKDIRPSADLS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query690 2.2.26 [Sep-21-2011]
C0LGK9853 Probable LRR receptor-lik no no 0.811 0.656 0.345 2e-84
Q9LVN2785 Probably inactive leucine no no 0.826 0.726 0.326 1e-69
Q9LYN81192 Leucine-rich repeat recep no no 0.786 0.455 0.317 4e-58
Q9ZWC81166 Serine/threonine-protein no no 0.827 0.489 0.273 8e-53
O224761196 Protein BRASSINOSTEROID I no no 0.871 0.502 0.274 3e-51
C0LGP9784 Probable leucine-rich rep no no 0.795 0.700 0.283 5e-51
Q8L8991207 Systemin receptor SR160 O N/A no 0.847 0.484 0.272 4e-50
Q8GUQ51207 Brassinosteroid LRR recep N/A no 0.847 0.484 0.272 1e-49
Q9ZVR71008 Phytosulfokine receptor 1 no no 0.773 0.529 0.269 9e-47
Q8LPB41021 Phytosulfokine receptor 1 N/A no 0.810 0.547 0.272 2e-46
>sp|C0LGK9|Y2242_ARATH Probable LRR receptor-like serine/threonine-protein kinase At2g24230 OS=Arabidopsis thaliana GN=At2g24230 PE=2 SV=1 Back     alignment and function desciption
 Score =  314 bits (804), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 231/668 (34%), Positives = 346/668 (51%), Gaps = 108/668 (16%)

Query: 81  NMSELHSIDLSNNSLKGSVPGWFWSTQSLTQVNLSKNRFGGTIGFKPTSRNGPFPSVQVL 140
           +M  +  +++S N   GSV G F   ++L   +LSKNRF G I  +  S    + S+  L
Sbjct: 233 DMKSISFLNISGNQFDGSVTGVF--KETLEVADLSKNRFQGHISSQVDSN---WFSLVYL 287

Query: 141 NLSSNRFTNLV-------------------------KLSQFSKLMVLDVSNNDLR-ILPS 174
           +LS N  + ++                         ++   S L  L++SN +L   +P 
Sbjct: 288 DLSENELSGVIKNLTLLKKLKHLNLAWNRFNRGMFPRIEMLSGLEYLNLSNTNLSGHIPR 347

Query: 175 GFANLSKLRHLDISSCKISGNIKPVSFLHSLKYLDVSNNSMNGTFP-SDFPPLSGVKFLN 233
             + LS L  LD+S   ++G+I P+  + +L  +DVS N++ G  P S    L  ++  N
Sbjct: 348 EISKLSDLSTLDVSGNHLAGHI-PILSIKNLVAIDVSRNNLTGEIPMSILEKLPWMERFN 406

Query: 234 ISLNKFTGFVGHDKYQKFGKSAFIQGGSFVFDTTKTPRPSNNHIMPHVDSSRTPPYKIVH 293
            S N  T   G     KF  SA     SF   T   P  +N                   
Sbjct: 407 FSFNNLTFCSG-----KF--SAETLNRSFFGSTNSCPIAAN------------------- 440

Query: 294 KHNPAV-QKHRSKAKALVIGLSCA-SAFVFVFGIAIIFCMCRRRKILARRNKWAISKPVN 351
              PA+ ++ RS    L + L+   S    + G  I      RRK  +   K        
Sbjct: 441 ---PALFKRKRSVTGGLKLALAVTLSTMCLLIGALIFVAFGCRRKTKSGEAK-------- 489

Query: 352 QQLPFKVEKS--GPFSFETESGTSWMADIKEPTSAAVIMCSKPLVNYLTFKDLIAATSHF 409
             L  K E+S  GPFSF+T+S T+W+AD+K+  +  V++  KPL+N +TF DL++ATS+F
Sbjct: 490 -DLSVKEEQSISGPFSFQTDS-TTWVADVKQANAVPVVIFEKPLLN-ITFSDLLSATSNF 546

Query: 410 GKESLLAEGRCGPVYRAVLPGELHVAIKVLDNAKGIDHDDAVAMFDELSRLKHPNLLPLA 469
            +++LLA+G+ GPVYR  LPG +HVA+KVL +   +   +A    + L R+KHPNL+PL 
Sbjct: 547 DRDTLLADGKFGPVYRGFLPGGIHVAVKVLVHGSTLSDQEAARELEFLGRIKHPNLVPLT 606

Query: 470 GYCIAGKEKLVLLEFMANGDLHRWLHELPTGEPNVEDWSTDTWDHHPGAGSHISSPEK-- 527
           GYCIAG +++ + E+M NG+L   LH+LP G    +DW+TDTW+     G+     E   
Sbjct: 607 GYCIAGDQRIAIYEYMENGNLQNLLHDLPFGVQTTDDWTTDTWEEETDNGTQNIGTEGPV 666

Query: 528 TNWVTRHRIAIGVARGLAYLHHVGS---THGHLVTSSILLAESLEPKIAGFGLRNIGVKN 584
             W  RH+IA+G AR LA+LHH  S    H  +  SS+ L ++ EP+++ FGL  +    
Sbjct: 667 ATWRFRHKIALGTARALAFLHHGCSPPIIHRDVKASSVYLDQNWEPRLSDFGLAKVFGNG 726

Query: 585 VGE---------------RSENETCGPESDVYCFGVILMELLTGKRGTDD---------C 620
           + +               + E+E   P+SDVYCFGV+L EL+TGK+  +D          
Sbjct: 727 LDDEIIHGSPGYLPPEFLQPEHELPTPKSDVYCFGVVLFELMTGKKPIEDDYLDEKDTNL 786

Query: 621 VKWVRKLVKEGAGGDALDFRLKLGSGDSVAEMVESLRVGYLCTADSPGKRPTMQQVLGLL 680
           V WVR LV++     A+D +++     S  +M E+L++GYLCTAD P KRP+MQQV+GLL
Sbjct: 787 VSWVRSLVRKNQASKAIDPKIQ--ETGSEEQMEEALKIGYLCTADLPSKRPSMQQVVGLL 844

Query: 681 KDIRPSAD 688
           KDI P ++
Sbjct: 845 KDIEPKSN 852





Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9LVN2|Y5815_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At5g58150 OS=Arabidopsis thaliana GN=At5g58150 PE=1 SV=1 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description
>sp|Q9ZWC8|BRL1_ARATH Serine/threonine-protein kinase BRI1-like 1 OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1 Back     alignment and function description
>sp|O22476|BRI1_ARATH Protein BRASSINOSTEROID INSENSITIVE 1 OS=Arabidopsis thaliana GN=BRI1 PE=1 SV=1 Back     alignment and function description
>sp|C0LGP9|IMK3_ARATH Probable leucine-rich repeat receptor-like protein kinase IMK3 OS=Arabidopsis thaliana GN=IMK3 PE=1 SV=1 Back     alignment and function description
>sp|Q8L899|BRI1_SOLPE Systemin receptor SR160 OS=Solanum peruvianum PE=1 SV=1 Back     alignment and function description
>sp|Q8GUQ5|BRI1_SOLLC Brassinosteroid LRR receptor kinase OS=Solanum lycopersicum GN=CURL3 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZVR7|PSKR1_ARATH Phytosulfokine receptor 1 OS=Arabidopsis thaliana GN=PSKR1 PE=2 SV=4 Back     alignment and function description
>sp|Q8LPB4|PSKR1_DAUCA Phytosulfokine receptor 1 OS=Daucus carota GN=PSKR PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query690
255562440689 receptor kinase, putative [Ricinus commu 0.973 0.975 0.643 0.0
224116856682 predicted protein [Populus trichocarpa] 0.972 0.983 0.653 0.0
224079077677 predicted protein [Populus trichocarpa] 0.965 0.983 0.656 0.0
359483763683 PREDICTED: probable LRR receptor-like se 0.969 0.979 0.643 0.0
449465010679 PREDICTED: probable LRR receptor-like se 0.946 0.961 0.579 0.0
449500851679 PREDICTED: probable LRR receptor-like se 0.946 0.961 0.579 0.0
356555431682 PREDICTED: probable LRR receptor-like se 0.963 0.975 0.587 0.0
147820561684 hypothetical protein VITISV_009178 [Viti 0.923 0.931 0.630 0.0
297740518601 unnamed protein product [Vitis vinifera] 0.862 0.990 0.605 0.0
358345477696 LRR receptor-like serine/threonine-prote 0.942 0.933 0.577 0.0
>gi|255562440|ref|XP_002522226.1| receptor kinase, putative [Ricinus communis] gi|223538479|gb|EEF40084.1| receptor kinase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  875 bits (2260), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/699 (64%), Positives = 557/699 (79%), Gaps = 27/699 (3%)

Query: 1   MKIFCRLPLLFSLSLVVL-AQSTCNSKDQELVSKAFSSVSTFNISWLKPTNLNGSNPSTP 59
           M++FCR  L+FSL ++V  ++STCNS D++L+SKAF SVS FN+SW   ++ N S+P  P
Sbjct: 1   MEMFCRFLLVFSLLVLVAESESTCNSTDRKLLSKAFKSVSGFNLSWFHLSDFNCSHP--P 58

Query: 60  IRELNLSSRNLSGIISWKFLRNMSELHSIDLSNNSLKGSVPGWFWSTQSLTQVNLSKNRF 119
           I+E+ L SRNLSGIISW++ +NMS+LH IDLS+NS++G VPGWFWST+SL +VNL+KN  
Sbjct: 59  IKEIRLPSRNLSGIISWRYFKNMSKLHVIDLSSNSIQGQVPGWFWSTKSLKEVNLAKNML 118

Query: 120 GGTIGFKPTSRNGPFPSVQVLNLSSNRFTNLVKLSQFSKLMVLDVSNNDLRILPSGFANL 179
           GG+IGF+P   NG F S+++LNLS+NRFTNL KLS F+ L  LD+S+N L  L   F+NL
Sbjct: 119 GGSIGFEPNQGNGSFSSIKLLNLSTNRFTNLGKLSGFANLQSLDLSSNILGSLSFDFSNL 178

Query: 180 SKLRHLDISSCKISGNIKPVSFLHSLKYLDVSNNSMNGTFPSDFPPLSGVKFLNISLNKF 239
           +KL  L+ISSCKI G++K +S LH LKYLDVSNN+MNGTFPSDFPPL G+ FLN+SLN F
Sbjct: 179 TKLEFLNISSCKILGSVKAISGLHLLKYLDVSNNTMNGTFPSDFPPLDGLAFLNVSLNNF 238

Query: 240 TGFVGHDKYQKFGKSAFIQGGSFVFDTTKTP--RPSNNHIMPH-----VDSSRTPPYKIV 292
           TG V  DK+ KFG+SAF+ GGSF F + KTP   PSNN + PH           P    +
Sbjct: 239 TGIVHSDKFNKFGRSAFLHGGSFNFTSLKTPSESPSNNTMKPHPKQIPTHKKNIPKQNEL 298

Query: 293 HKHNPA--VQKHRSKAKALVIGLSCASAFVFVFGIAI-IFCMCRRRKILARRNKWAISKP 349
           H  +P   ++K +SK + L+I +S  S+F F+  IAI  FCM RRRK+ A RNKWAIS P
Sbjct: 299 HPSSPKNPIKKTKSKTETLIICVSSMSSF-FLVSIAICFFCMHRRRKV-AARNKWAISTP 356

Query: 350 VNQQLPFKVEKSGPFSFETESGTSWMADIKEPTSAAVIMCSKPLVNYLTFKDLIAATSHF 409
           +  Q PFK++KSGPFSFETESGTSW+ADIKEPTSA VIM SKPL+N +TFKDLIAATSHF
Sbjct: 357 I--QFPFKMDKSGPFSFETESGTSWVADIKEPTSAPVIMSSKPLMN-MTFKDLIAATSHF 413

Query: 410 GKESLLAEGRCGPVYRAVLPGELHVAIKVLDNAKGIDHDDAVAMFDELSRLKHPNLLPLA 469
           GK+SLL+EGRCGP+YRAVL G+LHVAIKVL+NA+ I+ ++AV +F+ LSRLKHPNLLPL 
Sbjct: 414 GKDSLLSEGRCGPLYRAVLSGDLHVAIKVLENAREINDEEAVTIFEGLSRLKHPNLLPLC 473

Query: 470 GYCIAGKEKLVLLEFMANGDLHRWLHELPTGEPNVEDWSTDTWDHHPGAGSHISSP-EKT 528
           GYCIAGKEKL+L EFMANGDL RWLHELPT +PNVEDWSTDTW+H   +GSH+SSP EKT
Sbjct: 474 GYCIAGKEKLILYEFMANGDLRRWLHELPTLKPNVEDWSTDTWEHQNISGSHVSSPEEKT 533

Query: 529 NWVTRHRIAIGVARGLAYLHHVGSTHGHLVTSSILLAESLEPKIAGFGLRNIG--VKNVG 586
           NW+TRH IA+GVARG+AYLHH GSTHGHLV+S+ILL+++LEP++A FGLRNIG   KN+G
Sbjct: 534 NWLTRHYIAVGVARGVAYLHHAGSTHGHLVSSNILLSDTLEPRVADFGLRNIGPKSKNIG 593

Query: 587 ERSENETCGPESDVYCFGVILMELLTGKRGTDDCVKWVRKLVKEGAGGDALDFRLKLGSG 646
                  CG E DVYCFG +L+E+LTGK G+++ V+WVR+LV+EG GGDALD RL++  G
Sbjct: 594 HE-----CGVEFDVYCFGCVLIEILTGKEGSEESVEWVRRLVREGHGGDALDSRLRV-VG 647

Query: 647 DSVAEMVESLRVGYLCTADSPGKRPTMQQVLGLLKDIRP 685
           DS+ EMVE LR+GYLCTA+ P KRPTMQQVLGLLKDI P
Sbjct: 648 DSMNEMVECLRIGYLCTAELPSKRPTMQQVLGLLKDIHP 686




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224116856|ref|XP_002317411.1| predicted protein [Populus trichocarpa] gi|222860476|gb|EEE98023.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224079077|ref|XP_002305740.1| predicted protein [Populus trichocarpa] gi|222848704|gb|EEE86251.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359483763|ref|XP_002265984.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At2g24230-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449465010|ref|XP_004150222.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At2g24230-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449500851|ref|XP_004161211.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At2g24230-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356555431|ref|XP_003546035.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At2g24230-like [Glycine max] Back     alignment and taxonomy information
>gi|147820561|emb|CAN69833.1| hypothetical protein VITISV_009178 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297740518|emb|CBI30700.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|358345477|ref|XP_003636804.1| LRR receptor-like serine/threonine-protein kinase GSO1 [Medicago truncatula] gi|355502739|gb|AES83942.1| LRR receptor-like serine/threonine-protein kinase GSO1 [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms


Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query690
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-29
cd00192262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 2e-28
pfam07714258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 1e-24
smart00219257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 8e-24
smart00221258 smart00221, STYKc, Protein kinase; unclassified sp 3e-23
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 5e-19
pfam00069260 pfam00069, Pkinase, Protein kinase domain 3e-18
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-18
cd05050288 cd05050, PTKc_Musk, Catalytic domain of the Protei 2e-17
cd05048283 cd05048, PTKc_Ror, Catalytic Domain of the Protein 3e-17
cd05148261 cd05148, PTKc_Srm_Brk, Catalytic domain of the Pro 1e-16
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-16
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-16
cd05068261 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-re 4e-14
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 7e-14
cd05049280 cd05049, PTKc_Trk, Catalytic domain of the Protein 2e-13
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 4e-13
cd05045290 cd05045, PTKc_RET, Catalytic domain of the Protein 1e-12
cd05069260 cd05069, PTKc_Yes, Catalytic domain of the Protein 2e-12
cd05033266 cd05033, PTKc_EphR, Catalytic domain of Ephrin Rec 3e-12
cd05035273 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-li 7e-12
cd05039256 cd05039, PTKc_Csk_like, Catalytic domain of C-term 8e-12
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-11
cd05089297 cd05089, PTKc_Tie1, Catalytic domain of the Protei 3e-11
cd05032277 cd05032, PTKc_InsR_like, Catalytic domain of Insul 4e-11
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-11
cd05034261 cd05034, PTKc_Src_like, Catalytic domain of Src ki 7e-11
cd05092280 cd05092, PTKc_TrkA, Catalytic domain of the Protei 8e-11
cd05047270 cd05047, PTKc_Tie, Catalytic domain of Tie Protein 1e-10
cd05096304 cd05096, PTKc_DDR1, Catalytic domain of the Protei 2e-10
cd05100334 cd05100, PTKc_FGFR3, Catalytic domain of the Prote 9e-10
cd05067260 cd05067, PTKc_Lck_Blk, Catalytic domain of the Pro 2e-09
cd05053293 cd05053, PTKc_FGFR, Catalytic domain of the Protei 2e-09
cd05095296 cd05095, PTKc_DDR2, Catalytic domain of the Protei 3e-09
cd05088303 cd05088, PTKc_Tie2, Catalytic domain of the Protei 3e-09
cd05099314 cd05099, PTKc_FGFR4, Catalytic domain of the Prote 3e-09
cd05063268 cd05063, PTKc_EphR_A2, Catalytic domain of the Pro 4e-09
cd05070260 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Pro 5e-09
cd05059256 cd05059, PTKc_Tec_like, Catalytic domain of Tec-li 5e-09
cd05090283 cd05090, PTKc_Ror1, Catalytic domain of the Protei 5e-09
cd05101304 cd05101, PTKc_FGFR2, Catalytic domain of the Prote 6e-09
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 6e-09
cd05043280 cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Rece 8e-09
cd05093288 cd05093, PTKc_TrkB, Catalytic domain of the Protei 8e-09
cd05058262 cd05058, PTKc_Met_Ron, Catalytic domain of the Pro 9e-09
cd05097295 cd05097, PTKc_DDR_like, Catalytic domain of Discoi 9e-09
COG0515384 COG0515, SPS1, Serine/threonine protein kinase [Ge 1e-08
cd05061288 cd05061, PTKc_InsR, Catalytic domain of the Protei 1e-08
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-08
cd05123250 cd05123, STKc_AGC, Catalytic domain of AGC family 2e-08
cd05051296 cd05051, PTKc_DDR, Catalytic domain of the Protein 3e-08
cd05057279 cd05057, PTKc_EGFR_like, Catalytic domain of Epide 4e-08
cd05044269 cd05044, PTKc_c-ros, Catalytic domain of the Prote 5e-08
cd05062277 cd05062, PTKc_IGF-1R, Catalytic domain of the Prot 6e-08
cd06627254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 1e-07
cd05071262 cd05071, PTKc_Src, Catalytic domain of the Protein 1e-07
cd05094291 cd05094, PTKc_TrkC, Catalytic domain of the Protei 1e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-07
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 2e-07
cd05098307 cd05098, PTKc_FGFR1, Catalytic domain of the Prote 2e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-07
cd08529256 cd08529, STKc_FA2-like, Catalytic domain of the Pr 3e-07
cd05060257 cd05060, PTKc_Syk_like, Catalytic domain of Spleen 3e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-07
cd06623264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 4e-07
cd05052263 cd05052, PTKc_Abl, Catalytic domain of the Protein 5e-07
cd05091283 cd05091, PTKc_Ror2, Catalytic domain of the Protei 6e-07
cd05110303 cd05110, PTKc_HER4, Catalytic domain of the Protei 1e-06
cd05064266 cd05064, PTKc_EphR_A10, Catalytic domain of the Pr 1e-06
cd05074273 cd05074, PTKc_Tyro3, Catalytic domain of the Prote 2e-06
cd05072261 cd05072, PTKc_Lyn, Catalytic domain of the Protein 3e-06
cd05075272 cd05075, PTKc_Axl, Catalytic domain of the Protein 3e-06
cd05113256 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Pro 4e-06
cd05042269 cd05042, PTKc_Aatyk, Catalytic domain of the Prote 4e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-06
cd05114256 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Pro 1e-05
cd05066267 cd05066, PTKc_EphR_A, Catalytic domain of the Prot 1e-05
cd05085250 cd05085, PTKc_Fer, Catalytic domain of the Protein 1e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-05
cd05038284 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai 2e-05
cd05065269 cd05065, PTKc_EphR_B, Catalytic domain of the Prot 2e-05
cd05040257 cd05040, PTKc_Ack_like, Catalytic domain of the Pr 2e-05
cd05083254 cd05083, PTKc_Chk, Catalytic domain of the Protein 3e-05
cd06610267 cd06610, STKc_OSR1_SPAK, Catalytic domain of the P 4e-05
cd05036277 cd05036, PTKc_ALK_LTK, Catalytic domain of the Pro 8e-05
cd05079284 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) doma 9e-05
cd05041251 cd05041, PTKc_Fes_like, Catalytic domain of Fes-li 1e-04
cd06614286 cd06614, STKc_PAK, Catalytic domain of the Protein 1e-04
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 1e-04
cd05046275 cd05046, PTK_CCK4, Pseudokinase domain of the Prot 2e-04
cd06648285 cd06648, STKc_PAK_II, Catalytic domain of the Prot 2e-04
PHA02988283 PHA02988, PHA02988, hypothetical protein; Provisio 3e-04
cd05106374 cd05106, PTKc_CSF-1R, Catalytic domain of the Prot 3e-04
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 3e-04
cd06605265 cd06605, PKc_MAPKK, Catalytic domain of the dual-s 4e-04
cd05080283 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) doma 4e-04
cd05579265 cd05579, STKc_MAST_like, Catalytic domain of Micro 4e-04
cd05073260 cd05073, PTKc_Hck, Catalytic domain of the Protein 5e-04
cd05076274 cd05076, PTK_Tyk2_rpt1, Pseudokinase (repeat 1) do 6e-04
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 7e-04
cd05087269 cd05087, PTKc_Aatyk1_Aatyk3, Catalytic domain of t 7e-04
cd05112256 cd05112, PTKc_Itk, Catalytic domain of the Protein 7e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.001
cd06619279 cd06619, PKc_MKK5, Catalytic domain of the dual-sp 0.001
cd07856328 cd07856, STKc_Sty1_Hog1, Catalytic domain of the S 0.001
cd05037259 cd05037, PTK_Jak_rpt1, Pseudokinase (repeat 1) dom 0.001
cd08221256 cd08221, STKc_Nek9, Catalytic domain of the Protei 0.002
cd07829282 cd07829, STKc_CDK_like, Catalytic domain of Cyclin 0.002
cd07877345 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of 0.002
cd06645267 cd06645, STKc_MAP4K3, Catalytic domain of the Prot 0.002
cd05055302 cd05055, PTKc_PDGFR, Catalytic domain of the Prote 0.002
cd08530256 cd08530, STKc_CNK2-like, Catalytic domain of the P 0.002
cd08216314 cd08216, PK_STRAD, Pseudokinase domain of STE20-re 0.003
cd06657292 cd06657, STKc_PAK4, Catalytic domain of the Protei 0.003
cd05086268 cd05086, PTKc_Aatyk2, Catalytic domain of the Prot 0.003
cd06613262 cd06613, STKc_MAP4K3_like, Catalytic domain of Mit 0.003
cd05108316 cd05108, PTKc_EGFR, Catalytic domain of the Protei 0.004
cd07840287 cd07840, STKc_CDK9_like, Catalytic domain of Cycli 0.004
cd05103343 cd05103, PTKc_VEGFR2, Catalytic domain of the Prot 0.004
cd05077262 cd05077, PTK_Jak1_rpt1, Pseudokinase (repeat 1) do 0.004
cd06917277 cd06917, STKc_NAK1_like, Catalytic domain of Funga 0.004
cd05111279 cd05111, PTK_HER3, Pseudokinase domain of the Prot 0.004
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  124 bits (312), Expect = 3e-29
 Identities = 152/647 (23%), Positives = 266/647 (41%), Gaps = 128/647 (19%)

Query: 60  IRELNLSSRNLSGIISWKFLRNMSELHSIDLSNNSLKGSVPGWFWSTQSLTQVNLSKNRF 119
           +R + L   + SG +  +F + +  ++ +D+SNN+L+G +    W   SL  ++L++N+F
Sbjct: 406 LRRVRLQDNSFSGELPSEFTK-LPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKF 464

Query: 120 GGTIGFKPTSRNGPFPSVQVLNLSSNRFTNLV--KLSQFSKLMVLDVSNNDLR-ILPSGF 176
            G +     S+      ++ L+LS N+F+  V  KL   S+LM L +S N L   +P   
Sbjct: 465 FGGLPDSFGSKR-----LENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDEL 519

Query: 177 ANLSKLRHLDISSCKISGNIKPVSF--LHSLKYLDVSNNSMNGTFPSDFPPLSGVKFLNI 234
           ++  KL  LD+S  ++SG I P SF  +  L  LD+S N ++G  P +   +  +  +NI
Sbjct: 520 SSCKKLVSLDLSHNQLSGQI-PASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNI 578

Query: 235 SLNKFTGFVGHDKYQKFGKSAFIQGGSFVFDTTKTPRPSNNHIMPHVDSSRTPPYKIVHK 294
           S N   G             +    G+F+     +    N  +     +S  PP K V K
Sbjct: 579 SHNHLHG-------------SLPSTGAFL-AINASAVAGNIDLCGGDTTSGLPPCKRVRK 624

Query: 295 HNPAVQKHRSKAKALVIGLSCASAFVFVFGIAIIFCMCRRRKILARRNKWAISKPVNQQL 354
                    + +    I  +   AF+ +  +A  F   R R  L  +             
Sbjct: 625 ---------TPSWWFYITCTLG-AFLVLALVAFGFVFIRGRNNLELK------------- 661

Query: 355 PFKVEKSGPFSFETESGTSWMADIKEPTSAAVIMCSKPLVNYLTFKDLIAATSHFGKESL 414
             +VE         E GT  +       S ++           T  D++++     +E++
Sbjct: 662 --RVEN--------EDGTWELQFFDSKVSKSI-----------TINDILSSLK---EENV 697

Query: 415 LAEGRCGPVYRA-VLPGELHVAIKVLDNAKGIDHDDAVAMFDELSRLKHPNLLPLAGYCI 473
           ++ G+ G  Y+   +   +   +K +++   I      +   ++ +L+HPN++ L G C 
Sbjct: 698 ISRGKKGASYKGKSIKNGMQFVVKEINDVNSI----PSSEIADMGKLQHPNIVKLIGLCR 753

Query: 474 AGKEKLVLLEFMANGDLHRWLHELPTGEPNVEDWSTDTWDHHPGAGSHISSPEKTNWVTR 533
           + K   ++ E++   +L   L  L                               +W  R
Sbjct: 754 SEKGAYLIHEYIEGKNLSEVLRNL-------------------------------SWERR 782

Query: 534 HRIAIGVARGLAYLHHVGSTH---GHLVTSSILLAESLEPK--IAGFGLRNIGVKNVG-- 586
            +IAIG+A+ L +LH   S     G+L    I++    EP   ++  GL     K     
Sbjct: 783 RKIAIGIAKALRFLHCRCSPAVVVGNLSPEKIIIDGKDEPHLRLSLPGLLCTDTKCFISS 842

Query: 587 -----ERSENETCGPESDVYCFGVILMELLTGKRGTD-------DCVKWVRKLVKEGAGG 634
                E  E +    +SD+Y FG+IL+ELLTGK   D         V+W R    +    
Sbjct: 843 AYVAPETRETKDITEKSDIYGFGLILIELLTGKSPADAEFGVHGSIVEWARYCYSDCHLD 902

Query: 635 DALDFRLKLGSGDSVAEMVESLRVGYLCTADSPGKRPTMQQVLGLLK 681
             +D  ++     +  E+VE + +   CTA  P  RP    VL  L+
Sbjct: 903 MWIDPSIRGDVSVNQNEIVEVMNLALHCTATDPTARPCANDVLKTLE 949


Length = 968

>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|133181 cd05050, PTKc_Musk, Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>gnl|CDD|133179 cd05048, PTKc_Ror, Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|133180 cd05049, PTKc_Trk, Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|173631 cd05045, PTKc_RET, Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>gnl|CDD|133200 cd05069, PTKc_Yes, Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>gnl|CDD|133165 cd05033, PTKc_EphR, Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133167 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|133220 cd05089, PTKc_Tie1, Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>gnl|CDD|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173648 cd05092, PTKc_TrkA, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>gnl|CDD|88330 cd05047, PTKc_Tie, Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133227 cd05096, PTKc_DDR1, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>gnl|CDD|173652 cd05100, PTKc_FGFR3, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>gnl|CDD|173640 cd05067, PTKc_Lck_Blk, Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>gnl|CDD|173634 cd05053, PTKc_FGFR, Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|173651 cd05095, PTKc_DDR2, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>gnl|CDD|133219 cd05088, PTKc_Tie2, Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>gnl|CDD|133230 cd05099, PTKc_FGFR4, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>gnl|CDD|133194 cd05063, PTKc_EphR_A2, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>gnl|CDD|133201 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133221 cd05090, PTKc_Ror1, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>gnl|CDD|133232 cd05101, PTKc_FGFR2, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|133175 cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>gnl|CDD|173649 cd05093, PTKc_TrkB, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>gnl|CDD|133189 cd05058, PTKc_Met_Ron, Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>gnl|CDD|133228 cd05097, PTKc_DDR_like, Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|133192 cd05061, PTKc_InsR, Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173632 cd05051, PTKc_DDR, Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>gnl|CDD|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173630 cd05044, PTKc_c-ros, Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>gnl|CDD|133193 cd05062, PTKc_IGF-1R, Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133202 cd05071, PTKc_Src, Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>gnl|CDD|173650 cd05094, PTKc_TrkC, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|133229 cd05098, PTKc_FGFR1, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>gnl|CDD|133191 cd05060, PTKc_Syk_like, Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|173633 cd05052, PTKc_Abl, Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>gnl|CDD|173647 cd05091, PTKc_Ror2, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>gnl|CDD|173655 cd05110, PTKc_HER4, Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>gnl|CDD|133195 cd05064, PTKc_EphR_A10, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>gnl|CDD|133205 cd05074, PTKc_Tyro3, Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>gnl|CDD|173641 cd05072, PTKc_Lyn, Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>gnl|CDD|173642 cd05075, PTKc_Axl, Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>gnl|CDD|173657 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>gnl|CDD|133174 cd05042, PTKc_Aatyk, Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|173658 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>gnl|CDD|173639 cd05066, PTKc_EphR_A, Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>gnl|CDD|133216 cd05085, PTKc_Fer, Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|173638 cd05065, PTKc_EphR_B, Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>gnl|CDD|133172 cd05040, PTKc_Ack_like, Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>gnl|CDD|133214 cd05083, PTKc_Chk, Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>gnl|CDD|133168 cd05036, PTKc_ALK_LTK, Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>gnl|CDD|173644 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|133178 cd05046, PTK_CCK4, Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>gnl|CDD|165291 PHA02988, PHA02988, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|133237 cd05106, PTKc_CSF-1R, Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>gnl|CDD|133211 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>gnl|CDD|133204 cd05073, PTKc_Hck, Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>gnl|CDD|133207 cd05076, PTK_Tyk2_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|173646 cd05087, PTKc_Aatyk1_Aatyk3, Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>gnl|CDD|133243 cd05112, PTKc_Itk, Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|132950 cd06619, PKc_MKK5, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>gnl|CDD|143361 cd07856, STKc_Sty1_Hog1, Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>gnl|CDD|173627 cd05037, PTK_Jak_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|173761 cd08221, STKc_Nek9, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143382 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|132976 cd06645, STKc_MAP4K3, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>gnl|CDD|133186 cd05055, PTKc_PDGFR, Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>gnl|CDD|173756 cd08216, PK_STRAD, Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>gnl|CDD|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>gnl|CDD|133217 cd05086, PTKc_Aatyk2, Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173654 cd05108, PTKc_EGFR, Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133234 cd05103, PTKc_VEGFR2, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>gnl|CDD|173643 cd05077, PTK_Jak1_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173656 cd05111, PTK_HER3, Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 690
PLN00113968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG1187361 consensus Serine/threonine protein kinase [Signal 100.0
KOG0197468 consensus Tyrosine kinases [Signal transduction me 100.0
KOG0192362 consensus Tyrosine kinase specific for activated ( 100.0
KOG1026774 consensus Nerve growth factor receptor TRKA and re 100.0
KOG0196996 consensus Tyrosine kinase, EPH (ephrin) receptor f 100.0
KOG0581364 consensus Mitogen-activated protein kinase kinase 100.0
KOG0575 592 consensus Polo-like serine/threonine protein kinas 100.0
KOG0595 429 consensus Serine/threonine-protein kinase involved 100.0
KOG10951025 consensus Protein tyrosine kinase [Signal transduc 100.0
KOG1094807 consensus Discoidin domain receptor DDR1 [Signal t 100.0
KOG0615475 consensus Serine/threonine protein kinase Chk2 and 100.0
KOG0193678 consensus Serine/threonine protein kinase RAF [Sig 100.0
KOG0194474 consensus Protein tyrosine kinase [Signal transduc 100.0
KOG4278 1157 consensus Protein tyrosine kinase [Signal transduc 100.0
KOG4721 904 consensus Serine/threonine protein kinase, contain 100.0
KOG0593 396 consensus Predicted protein kinase KKIAMRE [Genera 100.0
KOG0582 516 consensus Ste20-like serine/threonine protein kina 100.0
KOG0591375 consensus NIMA (never in mitosis)-related G2-speci 100.0
KOG0600 560 consensus Cdc2-related protein kinase [Cell cycle 100.0
KOG0198313 consensus MEKK and related serine/threonine protei 100.0
KOG0661 538 consensus MAPK related serine/threonine protein ki 100.0
PHA02988283 hypothetical protein; Provisional 100.0
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 100.0
KOG0592 604 consensus 3-phosphoinositide-dependent protein kin 100.0
KOG0598357 consensus Ribosomal protein S6 kinase and related 100.0
KOG1025 1177 consensus Epidermal growth factor receptor EGFR an 100.0
KOG0578550 consensus p21-activated serine/threonine protein k 100.0
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 100.0
KOG4257 974 consensus Focal adhesion tyrosine kinase FAK, cont 100.0
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 100.0
KOG0659318 consensus Cdk activating kinase (CAK)/RNA polymera 100.0
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 100.0
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 100.0
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 100.0
KOG0583370 consensus Serine/threonine protein kinase [Signal 100.0
KOG0611 668 consensus Predicted serine/threonine protein kinas 100.0
KOG2345302 consensus Serine/threonine protein kinase/TGF-beta 100.0
KOG0597 808 consensus Serine-threonine protein kinase FUSED [G 100.0
cd05108316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 100.0
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 100.0
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 100.0
KOG0201 467 consensus Serine/threonine protein kinase [Signal 100.0
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 100.0
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 100.0
KOG0580281 consensus Serine/threonine protein kinase [Cell cy 100.0
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 100.0
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 100.0
KOG0199 1039 consensus ACK and related non-receptor tyrosine ki 100.0
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 100.0
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 100.0
KOG0588 786 consensus Serine/threonine protein kinase [Cell cy 100.0
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 100.0
cd05105400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 100.0
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 100.0
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 100.0
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 100.0
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 100.0
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 100.0
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 100.0
PTZ00263329 protein kinase A catalytic subunit; Provisional 100.0
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 100.0
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 100.0
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 100.0
cd05600333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 100.0
KOG0663419 consensus Protein kinase PITSLRE and related kinas 100.0
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 100.0
KOG0605550 consensus NDR and related serine/threonine kinases 100.0
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 100.0
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 100.0
KOG0616355 consensus cAMP-dependent protein kinase catalytic 100.0
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 100.0
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 100.0
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 100.0
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 100.0
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 100.0
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 100.0
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 100.0
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 100.0
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 100.0
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 100.0
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 100.0
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 100.0
cd06650333 PKc_MEK1 Catalytic domain of the dual-specificity 100.0
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 100.0
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 100.0
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 100.0
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 100.0
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 100.0
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 100.0
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 100.0
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 100.0
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 100.0
KOG1989 738 consensus ARK protein kinase family [Signal transd 100.0
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 100.0
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 100.0
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 100.0
cd07859338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 100.0
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 100.0
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 100.0
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 100.0
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 100.0
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 100.0
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 100.0
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 100.0
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 100.0
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 100.0
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 100.0
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 100.0
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 100.0
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 100.0
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 100.0
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 100.0
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 100.0
KOG0585 576 consensus Ca2+/calmodulin-dependent protein kinase 100.0
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 100.0
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 100.0
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 100.0
PLN00034353 mitogen-activated protein kinase kinase; Provision 100.0
PHA03212391 serine/threonine kinase US3; Provisional 100.0
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 100.0
KOG0658364 consensus Glycogen synthase kinase-3 [Carbohydrate 100.0
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 100.0
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 100.0
cd05042269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 100.0
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 100.0
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 100.0
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 100.0
KOG2052513 consensus Activin A type IB receptor, serine/threo 100.0
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 100.0
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 100.0
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 100.0
PTZ00267 478 NIMA-related protein kinase; Provisional 100.0
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 100.0
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 100.0
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 100.0
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 100.0
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 100.0
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 100.0
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 100.0
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 100.0
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 100.0
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 100.0
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 100.0
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 100.0
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 100.0
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 100.0
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 100.0
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 100.0
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 100.0
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 100.0
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 100.0
cd05596370 STKc_ROCK Catalytic domain of the Protein Serine/T 100.0
cd05038284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 100.0
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 100.0
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 100.0
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 100.0
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 100.0
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 100.0
KOG0589 426 consensus Serine/threonine protein kinase [General 100.0
cd05086268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 100.0
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 100.0
KOG0594323 consensus Protein kinase PCTAIRE and related kinas 100.0
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 100.0
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 100.0
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 100.0
KOG0200609 consensus Fibroblast/platelet-derived growth facto 100.0
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 100.0
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 100.0
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 100.0
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 100.0
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 100.0
cd05110303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 100.0
cd06615308 PKc_MEK Catalytic domain of the dual-specificity P 100.0
PTZ00283 496 serine/threonine protein kinase; Provisional 100.0
cd05614332 STKc_MSK2_N N-terminal catalytic domain of the Pro 100.0
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 100.0
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 100.0
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 100.0
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 100.0
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 100.0
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 100.0
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 100.0
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 100.0
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 100.0
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 100.0
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 100.0
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 100.0
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 100.0
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 100.0
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 100.0
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 100.0
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 100.0
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 100.0
cd05621370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 100.0
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 100.0
cd05598376 STKc_LATS Catalytic domain of the Protein Serine/T 100.0
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 100.0
KOG0694694 consensus Serine/threonine protein kinase [Signal 100.0
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 100.0
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 100.0
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 100.0
cd05629377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 100.0
KOG0599 411 consensus Phosphorylase kinase gamma subunit [Carb 100.0
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 100.0
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 100.0
KOG1024563 consensus Receptor-like protein tyrosine kinase RY 100.0
cd05625382 STKc_LATS1 Catalytic domain of the Protein Serine/ 100.0
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 100.0
cd07853372 STKc_NLK Catalytic domain of the Serine/Threonine 100.0
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 100.0
cd05100334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 100.0
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 100.0
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 100.0
KOG0660359 consensus Mitogen-activated protein kinase [Signal 100.0
cd07876359 STKc_JNK2 Catalytic domain of the Serine/Threonine 100.0
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 100.0
PTZ00036440 glycogen synthase kinase; Provisional 100.0
cd08227327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 100.0
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 100.0
KOG3653534 consensus Transforming growth factor beta/activin 100.0
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 100.0
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 100.0
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 100.0
cd05617327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 100.0
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 100.0
KOG0574 502 consensus STE20-like serine/threonine kinase MST [ 100.0
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 100.0
cd07847286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 100.0
cd05602325 STKc_SGK1 Catalytic domain of the Protein Serine/T 100.0
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 100.0
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 100.0
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 100.0
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 100.0
cd07874355 STKc_JNK3 Catalytic domain of the Serine/Threonine 100.0
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 100.0
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 100.0
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 100.0
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 100.0
cd05622371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 100.0
cd05597331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 100.0
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 100.0
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 100.0
PHA03209357 serine/threonine kinase US3; Provisional 100.0
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 100.0
KOG0033355 consensus Ca2+/calmodulin-dependent protein kinase 100.0
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 100.0
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 100.0
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 100.0
cd07873301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 100.0
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 100.0
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 100.0
cd07878343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 100.0
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 100.0
cd07875364 STKc_JNK1 Catalytic domain of the Serine/Threonine 100.0
KOG0667 586 consensus Dual-specificity tyrosine-phosphorylatio 100.0
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 100.0
cd06607307 STKc_TAO Catalytic domain of the Protein Serine/Th 100.0
PHA03211461 serine/threonine kinase US3; Provisional 100.0
cd06641277 STKc_MST3 Catalytic domain of the Protein Serine/T 100.0
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 100.0
PTZ00284467 protein kinase; Provisional 100.0
cd05609305 STKc_MAST Catalytic domain of the Protein Serine/T 100.0
PTZ00266 1021 NIMA-related protein kinase; Provisional 100.0
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 100.0
cd05623332 STKc_MRCK_alpha Catalytic domain of the Protein Se 100.0
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 100.0
cd07844291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 100.0
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 100.0
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 100.0
cd07870291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 100.0
cd05624331 STKc_MRCK_beta Catalytic domain of the Protein Ser 100.0
KOG0032382 consensus Ca2+/calmodulin-dependent protein kinase 100.0
KOG0577 948 consensus Serine/threonine protein kinase [Signal 100.0
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 100.0
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 100.0
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 100.0
PHA03207392 serine/threonine kinase US3; Provisional 100.0
cd06622286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 100.0
cd07841298 STKc_CDK7 Catalytic domain of the Serine/Threonine 100.0
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 100.0
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 100.0
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 100.0
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 100.0
cd06630268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 100.0
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 100.0
cd06621287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 100.0
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 100.0
cd06635317 STKc_TAO1 Catalytic domain of the Protein Serine/T 100.0
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 100.0
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 100.0
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 100.0
cd06614286 STKc_PAK Catalytic domain of the Protein Serine/Th 100.0
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 100.0
cd07833288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 100.0
KOG0579 1187 consensus Ste20-like serine/threonine protein kina 100.0
cd05580290 STKc_PKA Catalytic domain of the Protein Serine/Th 100.0
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 100.0
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 100.0
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 100.0
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 100.0
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 100.0
KOG0596677 consensus Dual specificity; serine/threonine and t 100.0
cd07835283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 100.0
cd07832286 STKc_CCRK Catalytic domain of the Serine/Threonine 100.0
cd06657292 STKc_PAK4 Catalytic domain of the Protein Serine/T 100.0
cd07843293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 100.0
KOG4717 864 consensus Serine/threonine protein kinase [Signal 100.0
cd05577277 STKc_GRK Catalytic domain of the Protein Serine/Th 100.0
cd08216314 PK_STRAD Pseudokinase domain of STE20-related kina 100.0
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 100.0
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 100.0
KOG0586 596 consensus Serine/threonine protein kinase [General 100.0
KOG0610459 consensus Putative serine/threonine protein kinase 100.0
cd05574316 STKc_phototropin_like Catalytic domain of Phototro 100.0
cd08226328 PK_STRAD_beta Pseudokinase domain of STE20-related 100.0
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 100.0
cd07840287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 100.0
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 100.0
cd06634308 STKc_TAO2 Catalytic domain of the Protein Serine/T 100.0
cd07865310 STKc_CDK9 Catalytic domain of the Serine/Threonine 100.0
cd07845309 STKc_CDK10 Catalytic domain of the Serine/Threonin 100.0
cd07849336 STKc_ERK1_2_like Catalytic domain of Extracellular 100.0
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 100.0
cd07864302 STKc_CDK12 Catalytic domain of the Serine/Threonin 100.0
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 100.0
cd08530256 STKc_CNK2-like Catalytic domain of the Protein Ser 100.0
cd07855334 STKc_ERK5 Catalytic domain of the Serine/Threonine 100.0
cd07830283 STKc_MAK_like Catalytic domain of Male germ cell-A 100.0
cd05579265 STKc_MAST_like Catalytic domain of Microtubule-ass 99.98
cd07838287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 99.98
cd07837295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 99.98
cd07842316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 99.98
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 99.98
cd05606278 STKc_beta_ARK Catalytic domain of the Protein Seri 99.98
cd06633313 STKc_TAO3 Catalytic domain of the Protein Serine/T 99.98
KOG0983391 consensus Mitogen-activated protein kinase (MAPK) 99.98
cd06618296 PKc_MKK7 Catalytic domain of the dual-specificity 99.98
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 99.98
PHA02882294 putative serine/threonine kinase; Provisional 99.98
cd07858337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 99.98
cd07836284 STKc_Pho85 Catalytic domain of the Serine/Threonin 99.98
cd07850353 STKc_JNK Catalytic domain of the Serine/Threonine 99.98
cd07879342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 99.98
cd05118283 STKc_CMGC Catalytic domain of CMGC family Serine/T 99.98
cd07852337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 99.98
cd07834330 STKc_MAPK Catalytic domain of the Serine/Threonine 99.98
cd05583288 STKc_MSK_N N-terminal catalytic domain of the Prot 99.98
PLN00009294 cyclin-dependent kinase A; Provisional 99.98
cd07877345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 99.98
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 99.98
cd07854342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 99.97
cd07856328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 99.97
cd07829282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 99.97
PHA03210501 serine/threonine kinase US3; Provisional 99.97
PTZ00024335 cyclin-dependent protein kinase; Provisional 99.97
cd07866311 STKc_BUR1 Catalytic domain of the Serine/Threonine 99.97
KOG0666 438 consensus Cyclin C-dependent kinase CDK8 [Transcri 99.97
cd05613290 STKc_MSK1_N N-terminal catalytic domain of the Pro 99.97
KOG1006361 consensus Mitogen-activated protein kinase (MAPK) 99.97
KOG4250 732 consensus TANK binding protein kinase TBK1 [Signal 99.97
cd05581280 STKc_PDK1 Catalytic domain of the Protein Serine/T 99.97
cd07880343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 99.97
KOG0584 632 consensus Serine/threonine protein kinase [General 99.97
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 99.97
cd07857332 STKc_MPK1 Catalytic domain of the Serine/Threonine 99.97
KOG46451509 consensus MAPKKK (MAP kinase kinase kinase) SSK2 a 99.97
cd07851343 STKc_p38 Catalytic domain of the Serine/Threonine 99.97
KOG0669376 consensus Cyclin T-dependent kinase CDK9 [Cell cyc 99.97
KOG0604400 consensus MAP kinase-activated protein kinase 2 [S 99.97
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 99.97
KOG0607463 consensus MAP kinase-interacting kinase and relate 99.97
KOG0690516 consensus Serine/threonine protein kinase [Signal 99.97
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 99.97
KOG0603612 consensus Ribosomal protein S6 kinase [Signal tran 99.97
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 99.97
KOG0662292 consensus Cyclin-dependent kinase CDK5 [Intracellu 99.96
KOG0986 591 consensus G protein-coupled receptor kinase [Signa 99.96
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 99.96
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic 99.96
PLN03225 566 Serine/threonine-protein kinase SNT7; Provisional 99.96
KOG0671415 consensus LAMMER dual specificity kinases [Signal 99.96
KOG0984282 consensus Mitogen-activated protein kinase (MAPK) 99.96
PLN03224507 probable serine/threonine protein kinase; Provisio 99.96
KOG0587 953 consensus Traf2- and Nck-interacting kinase and re 99.96
KOG0696683 consensus Serine/threonine protein kinase [Signal 99.95
KOG06081034 consensus Warts/lats-like serine threonine kinases 99.95
KOG1151775 consensus Tousled-like protein kinase [Signal tran 99.95
KOG4236888 consensus Serine/threonine protein kinase PKC mu/P 99.95
KOG0668338 consensus Casein kinase II, alpha subunit [Signal 99.95
KOG0614732 consensus cGMP-dependent protein kinase [Signal tr 99.95
KOG0576 829 consensus Mitogen-activated protein kinase kinase 99.94
KOG0695593 consensus Serine/threonine protein kinase [Signal 99.94
KOG1027 903 consensus Serine/threonine protein kinase and endo 99.94
KOG0664 449 consensus Nemo-like MAPK-related serine/threonine 99.94
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 99.94
KOG1345378 consensus Serine/threonine kinase [Signal transduc 99.94
KOG1152772 consensus Signal transduction serine/threonine kin 99.93
smart00221225 STYKc Protein kinase; unclassified specificity. Ph 99.93
KOG0665369 consensus Jun-N-terminal kinase (JNK) [Signal tran 99.93
KOG0670752 consensus U4/U6-associated splicing factor PRP4 [R 99.91
KOG1290 590 consensus Serine/threonine protein kinase [Signal 99.91
PLN00181 793 protein SPA1-RELATED; Provisional 99.91
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.89
KOG1167418 consensus Serine/threonine protein kinase of the C 99.89
smart00750176 KIND kinase non-catalytic C-lobe domain. It is an 99.88
PRK09188365 serine/threonine protein kinase; Provisional 99.87
cd05147190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 99.85
PRK10359232 lipopolysaccharide core biosynthesis protein; Prov 99.84
PLN00113968 leucine-rich repeat receptor-like protein kinase; 99.84
KOG1023 484 consensus Natriuretic peptide receptor, guanylate 99.83
KOG1163341 consensus Casein kinase (serine/threonine/tyrosine 99.83
cd05145190 RIO1_like RIO kinase family; RIO1, RIO3 and simila 99.83
PRK10345210 hypothetical protein; Provisional 99.8
KOG1164322 consensus Casein kinase (serine/threonine/tyrosine 99.8
COG0515384 SPS1 Serine/threonine protein kinase [General func 99.79
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.77
PRK12274218 serine/threonine protein kinase; Provisional 99.76
KOG0590601 consensus Checkpoint kinase and related serine/thr 99.76
KOG1165 449 consensus Casein kinase (serine/threonine/tyrosine 99.74
PRK14879211 serine/threonine protein kinase; Provisional 99.74
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 99.73
smart00090237 RIO RIO-like kinase. 99.72
cd05144198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 99.72
PRK09605535 bifunctional UGMP family protein/serine/threonine 99.72
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.71
TIGR03724199 arch_bud32 Kae1-associated kinase Bud32. Members o 99.7
KOG0617264 consensus Ras suppressor protein (contains leucine 99.67
KOG0603 612 consensus Ribosomal protein S6 kinase [Signal tran 99.67
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.66
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.66
KOG4158598 consensus BRPK/PTEN-induced protein kinase [Signal 99.64
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.6
PF14531288 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ 99.6
cd05119187 RIO RIO kinase family, catalytic domain. The RIO k 99.59
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.59
PRK01723239 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed 99.59
KOG0617264 consensus Ras suppressor protein (contains leucine 99.57
KOG1166974 consensus Mitotic checkpoint serine/threonine prot 99.55
cd05120155 APH_ChoK_like Aminoglycoside 3'-phosphotransferase 99.54
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.49
KOG1033516 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translati 99.48
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.47
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.46
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.45
KOG0606 1205 consensus Microtubule-associated serine/threonine 99.45
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.44
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.44
TIGR01982437 UbiB 2-polyprenylphenol 6-hydroxylase. This model 99.43
KOG0590 601 consensus Checkpoint kinase and related serine/thr 99.39
KOG4237498 consensus Extracellular matrix protein slit, conta 99.35
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.3
KOG1266 458 consensus Protein kinase [Signal transduction mech 99.28
PLN03150623 hypothetical protein; Provisional 99.25
cd05151170 ChoK Choline Kinase (ChoK). The ChoK subfamily is 99.25
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.22
PLN032101153 Resistant to P. syringae 6; Provisional 99.22
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.22
PRK04750 537 ubiB putative ubiquinone biosynthesis protein UbiB 99.21
PLN032101153 Resistant to P. syringae 6; Provisional 99.2
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.19
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.19
PLN03150623 hypothetical protein; Provisional 99.16
KOG0601524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 99.15
cd05146197 RIO3_euk RIO kinase family; eukaryotic RIO3, catal 99.1
COG3642204 Mn2+-dependent serine/threonine protein kinase [Si 99.08
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.08
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.07
KOG1243 690 consensus Protein kinase [General function predict 99.06
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.05
KOG0601 524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 99.04
cd05154223 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 an 99.03
KOG4237498 consensus Extracellular matrix protein slit, conta 99.02
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.0
KOG3087229 consensus Serine/threonine protein kinase [General 99.0
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.0
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.94
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 98.92
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.91
KOG3741 655 consensus Poly(A) ribonuclease subunit [RNA proces 98.85
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.76
PF01163188 RIO1: RIO1 family; InterPro: IPR018934 Protein pho 98.72
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.71
PRK15123268 lipopolysaccharide core heptose(I) kinase RfaP; Pr 98.7
KOG06061205 consensus Microtubule-associated serine/threonine 98.63
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.61
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.5
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.48
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.42
PRK09902216 hypothetical protein; Provisional 98.4
PF06293206 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; 98.39
COG0478304 RIO-like serine/threonine protein kinase fused to 98.34
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.33
COG0661517 AarF Predicted unusual protein kinase [General fun 98.18
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.14
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.04
KOG2137 700 consensus Protein kinase [Signal transduction mech 98.01
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.99
TIGR02172226 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogou 97.99
PF06176229 WaaY: Lipopolysaccharide core biosynthesis protein 97.94
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=6.2e-63  Score=592.73  Aligned_cols=525  Identities=27%  Similarity=0.448  Sum_probs=318.1

Q ss_pred             CCccEEEccCCCCCCCCchhhhcCCCCccEEeccCCcCCCCCCccccCCccCcEEEccCccCCCccCCCCCCCCCCCCC-
Q 005572           58 TPIRELNLSSRNLSGIISWKFLRNMSELHSIDLSNNSLKGSVPGWFWSTQSLTQVNLSKNRFGGTIGFKPTSRNGPFPS-  136 (690)
Q Consensus        58 ~~l~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~L~~N~l~g~i~~~~~~~~~~l~~-  136 (690)
                      ++|+.|+|++|++++.+| ..+..+++|+.|+|++|++++.+|..|..+++|+.|+|++|++++.+    +..+..+++ 
T Consensus       380 ~~L~~L~l~~n~l~~~~p-~~~~~~~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~----~~~~~~l~~L  454 (968)
T PLN00113        380 GNLFKLILFSNSLEGEIP-KSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRI----NSRKWDMPSL  454 (968)
T ss_pred             CCCCEEECcCCEecccCC-HHHhCCCCCCEEECcCCEeeeECChhHhcCCCCCEEECcCCcccCcc----ChhhccCCCC
Confidence            456666666666666655 33455666666666666666666666666666666666666655543    222333444 


Q ss_pred             ----------------------CcEEEccCCCCCCcc--ccCCCCCCcEEEccCCCCc-cCCccCCCCCCCcEEEcccCc
Q 005572          137 ----------------------VQVLNLSSNRFTNLV--KLSQFSKLMVLDVSNNDLR-ILPSGFANLSKLRHLDISSCK  191 (690)
Q Consensus       137 ----------------------L~~L~Ls~N~l~~~~--~~~~~~~L~~L~ls~N~l~-~~p~~~~~l~~L~~L~ls~N~  191 (690)
                                            |+.|++++|++++..  .+..+++|+.|++++|++. .+|..+.++++|+.|+|++|.
T Consensus       455 ~~L~L~~n~~~~~~p~~~~~~~L~~L~ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~  534 (968)
T PLN00113        455 QMLSLARNKFFGGLPDSFGSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQ  534 (968)
T ss_pred             cEEECcCceeeeecCcccccccceEEECcCCccCCccChhhhhhhccCEEECcCCcceeeCChHHcCccCCCEEECCCCc
Confidence                                  455555555554332  2444555555555555554 345555555555555555555


Q ss_pred             CCcCCCC-cccccccceeecccccCCCCCCCCCCCCCCCCEEEeeCCCCccccCch-hhhcccccceeeCCceeecCCCC
Q 005572          192 ISGNIKP-VSFLHSLKYLDVSNNSMNGTFPSDFPPLSGVKFLNISLNKFTGFVGHD-KYQKFGKSAFIQGGSFVFDTTKT  269 (690)
Q Consensus       192 l~~~~~~-~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~l~l~~N~~~g~~~~~-~~~~~~~~~~~~~~~~~~~~~~~  269 (690)
                      ++|.+|. +..+++|+.|+|++|+++|.+|..+..+++|+.|++++|+++|.+|.. .+..+....+.+  +..+|+.. 
T Consensus       535 l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~~~~~~~~~--n~~lc~~~-  611 (968)
T PLN00113        535 LSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAG--NIDLCGGD-  611 (968)
T ss_pred             ccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCCCcchhcccChhhhcC--CccccCCc-
Confidence            5554443 444555555555555555555555555555555555555555555532 122222222211  11122110 


Q ss_pred             CCCCCCCcCCCCCCCCCCCcccccCCCCccccccccceeeeehhhhhhHHHHHHHhhheeeeeeechhhhhcccccccCC
Q 005572          270 PRPSNNHIMPHVDSSRTPPYKIVHKHNPAVQKHRSKAKALVIGLSCASAFVFVFGIAIIFCMCRRRKILARRNKWAISKP  349 (690)
Q Consensus       270 ~~~~~~~~~~~~~~s~~~p~~~~~~~~~~~~~~~s~~~~~ii~i~~~~~~~~~~~i~i~~~~~rrr~~~~~~~~~~~~~~  349 (690)
                                  .....++.         ....++....+++++++++++++++ ++++++++|||+..+ ......   
T Consensus       612 ------------~~~~~~~c---------~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~-~~~~~~---  665 (968)
T PLN00113        612 ------------TTSGLPPC---------KRVRKTPSWWFYITCTLGAFLVLAL-VAFGFVFIRGRNNLE-LKRVEN---  665 (968)
T ss_pred             ------------cccCCCCC---------ccccccceeeeehhHHHHHHHHHHH-HHHHHHHHHhhhccc-cccccc---
Confidence                        00000000         0001111222333333332222222 222222222222111 000000   


Q ss_pred             cCCCccceecccCCcccccCCCCcccccccCCcccchhccCCCcccccCHHHHHHHhccCCCCceeccCCCccEEEEEc-
Q 005572          350 VNQQLPFKVEKSGPFSFETESGTSWMADIKEPTSAAVIMCSKPLVNYLTFKDLIAATSHFGKESLLAEGRCGPVYRAVL-  428 (690)
Q Consensus       350 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lg~G~~g~Vy~~~~-  428 (690)
                                ..+          .|..          ........+.++++++.   ..|...+.||+|+||.||+|+. 
T Consensus       666 ----------~~~----------~~~~----------~~~~~~~~~~~~~~~~~---~~~~~~~~ig~G~~g~Vy~~~~~  712 (968)
T PLN00113        666 ----------EDG----------TWEL----------QFFDSKVSKSITINDIL---SSLKEENVISRGKKGASYKGKSI  712 (968)
T ss_pred             ----------ccc----------cccc----------cccccccchhhhHHHHH---hhCCcccEEccCCCeeEEEEEEC
Confidence                      000          0000          00000111224555554   3577788999999999999995 


Q ss_pred             CCCcEEEEEEeeccCCCCHHHHHHHHHHHHhcCCCCccceeeEEecCCeeEEEEEecCCCCHhhhhhcCCCCCCCCCCCC
Q 005572          429 PGELHVAIKVLDNAKGIDHDDAVAMFDELSRLKHPNLLPLAGYCIAGKEKLVLLEFMANGDLHRWLHELPTGEPNVEDWS  508 (690)
Q Consensus       429 ~~~~~vavK~l~~~~~~~~~~~~~e~~~l~~l~H~niv~l~g~~~~~~~~~lv~e~~~~gsL~~~l~~~~~~~~~~~~~~  508 (690)
                      .++..||||+++.....    ...|++.+++++|||||+++|+|.+.+..++|||||++|+|.++++.            
T Consensus       713 ~~~~~vavK~~~~~~~~----~~~~~~~l~~l~HpnIv~~~~~~~~~~~~~lv~Ey~~~g~L~~~l~~------------  776 (968)
T PLN00113        713 KNGMQFVVKEINDVNSI----PSSEIADMGKLQHPNIVKLIGLCRSEKGAYLIHEYIEGKNLSEVLRN------------  776 (968)
T ss_pred             CCCcEEEEEEccCCccc----cHHHHHHHhhCCCCCcceEEEEEEcCCCCEEEEeCCCCCcHHHHHhc------------
Confidence            67889999998654322    23468889999999999999999999999999999999999999853            


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHhhh---hcCCCCCCCCCCcEEecCCCCceEcCCCcccccc---
Q 005572          509 TDTWDHHPGAGSHISSPEKTNWVTRHRIAIGVARGLAYLH---HVGSTHGHLVTSSILLAESLEPKIAGFGLRNIGV---  582 (690)
Q Consensus       509 ~~~~~~~~~~~~~~~~~~~l~~~~~~~i~~~ia~gl~yLH---~~~~iHrDlk~~NiLl~~~~~~kl~DfGla~~~~---  582 (690)
                                         ++|.++.+|+.|+|+||+|||   +.+++||||||+||+++.++.+++. ||.+....   
T Consensus       777 -------------------l~~~~~~~i~~~ia~~L~yLH~~~~~~iiH~dlkp~Nil~~~~~~~~~~-~~~~~~~~~~~  836 (968)
T PLN00113        777 -------------------LSWERRRKIAIGIAKALRFLHCRCSPAVVVGNLSPEKIIIDGKDEPHLR-LSLPGLLCTDT  836 (968)
T ss_pred             -------------------CCHHHHHHHHHHHHHHHHHhccCCCCCeecCCCCHHhEEECCCCceEEE-eccccccccCC
Confidence                               789999999999999999999   5689999999999999999998876 66543321   


Q ss_pred             -------cccCcccCCCCCCCCCcchhhHHHHHHHHhCCCCCCc-------hHHHHHHHHHhcCCCCccccccccCCCCC
Q 005572          583 -------KNVGERSENETCGPESDVYCFGVILMELLTGKRGTDD-------CVKWVRKLVKEGAGGDALDFRLKLGSGDS  648 (690)
Q Consensus       583 -------~~~~e~~~~~~~~~~~DVwSfGvvl~el~tg~~p~~~-------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  648 (690)
                             ..+||......+++++|||||||++|||+||+.||+.       ..+|++............|+.+.......
T Consensus       837 ~~~~t~~y~aPE~~~~~~~~~~sDv~S~Gvvl~el~tg~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  916 (968)
T PLN00113        837 KCFISSAYVAPETRETKDITEKSDIYGFGLILIELLTGKSPADAEFGVHGSIVEWARYCYSDCHLDMWIDPSIRGDVSVN  916 (968)
T ss_pred             CccccccccCcccccCCCCCcccchhhHHHHHHHHHhCCCCCCcccCCCCcHHHHHHHhcCccchhheeCccccCCCCcc
Confidence                   1256666556889999999999999999999999853       34555443333223344455554444445


Q ss_pred             HHHHHHHHHHHhhhcCCCCCCCCCHHHHHHHHhccCC
Q 005572          649 VAEMVESLRVGYLCTADSPGKRPTMQQVLGLLKDIRP  685 (690)
Q Consensus       649 ~~~~~~~~~l~~~C~~~dP~~RPt~~ev~~~L~~i~~  685 (690)
                      ..++.++.+++.+||+.||++||||+||++.|+++.+
T Consensus       917 ~~~~~~~~~l~~~Cl~~~P~~RPt~~evl~~L~~~~~  953 (968)
T PLN00113        917 QNEIVEVMNLALHCTATDPTARPCANDVLKTLESASR  953 (968)
T ss_pred             HHHHHHHHHHHHhhCcCCchhCcCHHHHHHHHHHhhc
Confidence            6777888899999999999999999999999999855



>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] Back     alignment and domain information
>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] Back     alignment and domain information
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only] Back     alignment and domain information
>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] Back     alignment and domain information
>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only] Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms] Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0589 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0599 consensus Phosphorylase kinase gamma subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms] Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>KOG4717 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>KOG0586 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms] Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription] Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0584 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0604 consensus MAP kinase-activated protein kinase 2 [Signal transduction mechanisms] Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0984 consensus Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms] Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0608 consensus Warts/lats-like serine threonine kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] Back     alignment and domain information
>KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>KOG1345 consensus Serine/threonine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1152 consensus Signal transduction serine/threonine kinase with PAS/PAC sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>KOG0665 consensus Jun-N-terminal kinase (JNK) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification] Back     alignment and domain information
>KOG1290 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG1023 consensus Natriuretic peptide receptor, guanylate cyclase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1163 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PRK12274 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1165 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>PRK14879 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32 Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4158 consensus BRPK/PTEN-induced protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A Back     alignment and domain information
>cd05119 RIO RIO kinase family, catalytic domain Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG1033 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG1266 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>cd05151 ChoK Choline Kinase (ChoK) Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain Back     alignment and domain information
>COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1243 consensus Protein kinase [General function prediction only] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3087 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3741 consensus Poly(A) ribonuclease subunit [RNA processing and modification] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF01163 RIO1: RIO1 family; InterPro: IPR018934 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PRK15123 lipopolysaccharide core heptose(I) kinase RfaP; Provisional Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PRK09902 hypothetical protein; Provisional Back     alignment and domain information
>PF06293 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; InterPro: IPR010440 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>COG0478 RIO-like serine/threonine protein kinase fused to N-terminal HTH domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>COG0661 AarF Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2137 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>TIGR02172 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogous family TIGR02172 Back     alignment and domain information
>PF06176 WaaY: Lipopolysaccharide core biosynthesis protein (WaaY); InterPro: IPR009330 This family consists of several bacterial lipopolysaccharide core biosynthesis proteins (WaaY or RfaY) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query690
3tl8_A349 The Avrptob-Bak1 Complex Reveals Two Structurally S 2e-24
3uim_A326 Structural Basis For The Impact Of Phosphorylation 5e-24
3hgk_A327 Crystal Structure Of Effect Protein Avrptob Complex 1e-16
2qkw_B321 Structural Basis For Activation Of Plant Immunity B 1e-16
2nry_A307 Crystal Structure Of Irak-4 Length = 307 6e-14
2oib_A301 Crystal Structure Of Irak4 Kinase Domain Apo Form L 9e-14
2nru_A307 Crystal Structure Of Irak-4 Length = 307 9e-14
1luf_A343 Crystal Structure Of The Musk Tyrosine Kinase: Insi 2e-12
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-11
3rgx_A768 Structural Insight Into Brassinosteroid Perception 3e-11
2o8y_A298 Apo Irak4 Kinase Domain Length = 298 5e-11
3dtc_A271 Crystal Structure Of Mixed-Lineage Kinase Mlk1 Comp 8e-10
3p86_A309 Crystal Structure Of Ctr1 Kinase Domain Mutant D676 2e-09
4gt5_A306 Crystal Structure Of The Inactive Trka Kinase Domai 5e-09
4aoj_A329 Human Trka In Complex With The Inhibitor Az-23 Leng 5e-09
4f0i_A300 Crystal Structure Of Apo Trka Length = 300 5e-09
3ppz_A309 Crystal Structure Of Ctr1 Kinase Domain In Complex 6e-09
2wqb_A324 Structure Of The Tie2 Kinase Domain In Complex With 1e-08
3kxx_A317 Structure Of The Mutant Fibroblast Growth Factor Re 2e-08
2oo8_X317 Synthesis, Structural Analysis, And Sar Studies Of 2e-08
1fvr_A327 Tie2 Kinase Domain Length = 327 2e-08
2pz5_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 3e-08
3cly_A334 Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase 3e-08
2psq_A370 Crystal Structure Of Unphosphorylated Unactivated W 3e-08
3b2t_A311 Structure Of Phosphotransferase Length = 311 4e-08
1k3a_A299 Structure Of The Insulin-Like Growth Factor 1 Recep 4e-08
3tt0_A382 Co-Structure Of Fibroblast Growth Factor Receptor 1 4e-08
3ri1_A313 Crystal Structure Of The Catalytic Domain Of Fgfr2 4e-08
1fgk_A310 Crystal Structure Of The Tyrosine Kinase Domain Of 5e-08
3rhx_B306 Crystal Structure Of The Catalytic Domain Of Fgfr1 5e-08
1gjo_A316 The Fgfr2 Tyrosine Kinase Domain Length = 316 5e-08
2pwl_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 5e-08
2pzp_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 5e-08
3js2_A317 Crystal Structure Of Minimal Kinase Domain Of Fibro 6e-08
4f63_A309 Crystal Structure Of Human Fibroblast Growth Factor 6e-08
2zm3_A308 Complex Structure Of Insulin-Like Growth Factor Rec 6e-08
4asz_A299 Crystal Structure Of Apo Trkb Kinase Domain Length 7e-08
1ad5_A438 Src Family Kinase Hck-Amp-Pnp Complex Length = 438 8e-08
2rei_A318 Kinase Domain Of Human Ephrin Type-a Receptor 7 (ep 8e-08
2pzr_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 9e-08
1p14_A306 Crystal Structure Of A Catalytic-Loop Mutant Of The 9e-08
2pvy_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 9e-08
3c4f_A302 Fgfr Tyrosine Kinase Domain In Complex With 3-(3- M 9e-08
3lvp_A336 Crystal Structure Of Bisphosphorylated Igf1-R Kinas 9e-08
3ekk_A307 Insulin Receptor Kinase Complexed With An Inhibitor 1e-07
2hog_A322 Crystal Structure Of Chek1 In Complex With Inhibito 1e-07
1rqq_A306 Crystal Structure Of The Insulin Receptor Kinase In 1e-07
4fsy_A279 Crystal Structure Of The Chk1 Length = 279 1e-07
3sxr_A268 Crystal Structure Of Bmx Non-Receptor Tyrosine Kina 1e-07
3gqi_A326 Crystal Structure Of Activated Receptor Tyrosine Ki 1e-07
2r0u_A323 Crystal Structure Of Chek1 In Complex With Inhibito 1e-07
1ir3_A306 Phosphorylated Insulin Receptor Tyrosine Kinase In 1e-07
3o23_A305 Human Unphosphorylated Igf1-R Kinase Domain In Comp 1e-07
2z8c_A303 Phosphorylated Insulin Receptor Tyrosine Kinase In 1e-07
3gql_A326 Crystal Structure Of Activated Receptor Tyrosine Ki 1e-07
1m7n_A322 Crystal Structure Of Unactivated Apo Insulin-Like G 1e-07
3i81_A315 Crystal Structure Of Insulin-Like Growth Factor 1 R 1e-07
2pvf_A334 Crystal Structure Of Tyrosine Phosphorylated Activa 1e-07
1jqh_A308 Igf-1 Receptor Kinase Domain Length = 308 1e-07
2oj9_A307 Structure Of Igf-1r Kinase Domain Complexed With A 1e-07
1i44_A306 Crystallographic Studies Of An Activation Loop Muta 1e-07
3qqu_A301 Cocrystal Structure Of Unphosphorylated Igf With Py 1e-07
4fsu_A279 Crystal Structure Of The Chk1 Length = 279 2e-07
1irk_A306 Crystal Structure Of The Tyrosine Kinase Domain Of 2e-07
2ivv_A314 Crystal Structure Of Phosphorylated Ret Tyrosine Ki 2e-07
2br1_A297 Structure-Based Design Of Novel Chk1 Inhibitors: In 2e-07
1ia8_A289 The 1.7 A Crystal Structure Of Human Cell Cycle Che 2e-07
1zlt_A295 Crystal Structure Of Chk1 Complexed With A Hymenald 2e-07
2ivt_A314 Crystal Structure Of Phosphorylated Ret Tyrosine Ki 2e-07
2ivs_A314 Crystal Structure Of Non-Phosphorylated Ret Tyrosin 2e-07
3d94_A301 Crystal Structure Of The Insulin-Like Growth Factor 2e-07
4fsm_A279 Crystal Structure Of The Chk1 Length = 279 2e-07
2q0b_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 2e-07
4fsn_A278 Crystal Structure Of The Chk1 Length = 278 2e-07
2x8e_A276 Discovery Of A Novel Class Of Triazolones As Checkp 2e-07
4gt4_A308 Structure Of Unliganded, Inactive Ror2 Kinase Domai 2e-07
3ot3_A273 X-Ray Crystal Structure Of Compound 22k Bound To Hu 2e-07
3cok_A278 Crystal Structure Of Plk4 Kinase Length = 278 3e-07
2ghg_A269 H-Chk1 Complexed With A431994 Length = 269 3e-07
2e9v_A268 Structure Of H-Chk1 Complexed With A859017 Length = 3e-07
3jvr_A271 Characterization Of The Chk1 Allosteric Inhibitor B 3e-07
2ayp_A269 Crystal Structure Of Chk1 With An Indol Inhibitor L 3e-07
3eta_A317 Kinase Domain Of Insulin Receptor Complexed With A 3e-07
1y57_A452 Structure Of Unphosphorylated C-Src In Complex With 3e-07
1p4o_A322 Structure Of Apo Unactivated Igf-1r Kinase Domain A 3e-07
2h8h_A535 Src Kinase In Complex With A Quinazoline Inhibitor 3e-07
1fmk_A452 Crystal Structure Of Human Tyrosine-Protein Kinase 3e-07
3lw0_A304 Igf-1rk In Complex With Ligand Msc1609119a-1 Length 4e-07
1ksw_A452 Structure Of Human C-Src Tyrosine Kinase (Thr338gly 4e-07
2py3_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 4e-07
3qrj_A277 The Crystal Structure Of Human Abl1 Kinase Domain T 4e-07
2v7a_A286 Crystal Structure Of The T315i Abl Mutant In Comple 4e-07
3zzw_A289 Crystal Structure Of The Kinase Domain Of Ror2 Leng 5e-07
2ptk_A453 Chicken Src Tyrosine Kinase Length = 453 5e-07
1zys_A273 Co-Crystal Structure Of Checkpoint Kinase Chk1 With 6e-07
3dqw_A286 C-Src Kinase Domain Thr338ile Mutant In Complex Wit 7e-07
3g6h_A286 Src Thr338ile Inhibited In The Dfg-Asp-Out Conforma 7e-07
1uwh_A276 The Complex Of Wild Type B-Raf And Bay439006 Length 7e-07
3geq_A286 Structural Basis For The Chemical Rescue Of Src Kin 8e-07
2gqg_A278 X-Ray Crystal Structure Of Dasatinib (Bms-354825) B 8e-07
1opl_A537 Structural Basis For The Auto-Inhibition Of C-Abl T 8e-07
3qri_A277 The Crystal Structure Of Human Abl1 Kinase Domain I 9e-07
2fo0_A495 Organization Of The Sh3-Sh2 Unit In Active And Inac 9e-07
1yi6_A276 C-Term Tail Segment Of Human Tyrosine Kinase (258-5 1e-06
2hzi_A277 Abl Kinase Domain In Complex With Pd180970 Length = 1e-06
3q6w_A307 Structure Of Dually-phosphorylated Met Receptor Kin 1e-06
2hyy_A273 Human Abl Kinase Domain In Complex With Imatinib (S 1e-06
2bdf_A279 Src Kinase In Complex With Inhibitor Ap23451 Length 1e-06
2hz0_A270 Abl Kinase Domain In Complex With Nvp-Aeg082 Length 1e-06
3pyy_A298 Discovery And Characterization Of A Cell-Permeable, 1e-06
3qup_A323 Inhibitor Bound Structure Of The Kinase Domain Of T 1e-06
3d7u_B277 Structural Basis For The Recognition Of C-Src By It 1e-06
2f4j_A287 Structure Of The Kinase Domain Of An Imatinib-Resis 1e-06
4gg5_A319 Crystal Structure Of Cmet In Complex With Novel Inh 1e-06
3q6u_A308 Structure Of The Apo Met Receptor Kinase In The Dua 1e-06
2dq7_X283 Crystal Structure Of Fyn Kinase Domain Complexed Wi 1e-06
2qq7_A286 Crystal Structure Of Drug Resistant Src Kinase Doma 1e-06
2wd1_A292 Human C-Met Kinase In Complex With Azaindole Inhibi 1e-06
3u4w_A275 Src In Complex With Dna-Templated Macrocyclic Inhib 1e-06
3bbt_B328 Crystal Structure Of The Erbb4 Kinase In Complex Wi 1e-06
2g1t_A287 A Src-Like Inactive Conformation In The Abl Tyrosin 1e-06
2oiq_A286 Crystal Structure Of Chicken C-Src Kinase Domain In 1e-06
2g2f_A287 A Src-Like Inactive Conformation In The Abl Tyrosin 1e-06
3svv_A286 Crystal Structure Of T338c C-Src Covalently Bound T 1e-06
2hiw_A287 Crystal Structure Of Inactive Conformation Abl Kina 1e-06
2g15_A318 Structural Characterization Of Autoinhibited C-Met 1e-06
3i5n_A309 Crystal Structure Of C-Met With Triazolopyridazine 1e-06
2wgj_A306 X-Ray Structure Of Pf-02341066 Bound To The Kinase 1e-06
2e2b_A293 Crystal Structure Of The C-Abl Kinase Domain In Com 1e-06
2rfn_A310 X-ray Structure Of C-met With Inhibitor. Length = 3 1e-06
2pl0_A289 Lck Bound To Imatinib Length = 289 2e-06
2hk5_A270 Hck Kinase In Complex With Lck Targetted Inhibitor 2e-06
3kxz_A287 The Complex Crystal Structure Of Lck With A Probe M 2e-06
3f66_A298 Human C-Met Kinase In Complex With Quinoxaline Inhi 2e-06
3lq8_A302 Structure Of The Kinase Domain Of C-Met Bound To Xl 2e-06
3mpm_A267 Lck Complexed With A Pyrazolopyrimidine Length = 26 2e-06
2i0v_A335 C-Fms Tyrosine Kinase In Complex With A Quinolone I 2e-06
2zm1_A285 Crystal Structure Of Imidazo Pyrazin 1 Bound To The 2e-06
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 2e-06
3bys_A277 Co-Crystal Structure Of Lck And Aminopyrimidine Ami 2e-06
1mqb_A333 Crystal Structure Of Ephrin A2 (Epha2) Receptor Pro 2e-06
3kmm_A288 Structure Of Human Lck Kinase With A Small Molecule 2e-06
4fsz_A279 Crystal Structure Of The Chk1 Length = 279 2e-06
2r4b_A321 Erbb4 Kinase Domain Complexed With A Thienopyrimidi 2e-06
2ydj_A276 Discovery Of Checkpoint Kinase Inhibitor Azd7762 By 2e-06
3dk7_A277 Crystal Structure Of Mutant Abl Kinase Domain In Co 2e-06
2ofv_A277 Crystal Structure Of Aminoquinazoline 1 Bound To Lc 2e-06
2ofu_A273 X-Ray Crystal Structure Of 2-Aminopyrimidine Carbam 2e-06
2fb8_A281 Structure Of The B-Raf Kinase Domain Bound To Sb-59 2e-06
3lck_A271 The Kinase Domain Of Human Lymphocyte Kinase (Lck), 2e-06
4dbn_A284 Crystal Structure Of The Kinase Domain Of Human B-R 2e-06
3bym_A272 X-Ray Co-Crystal Structure Aminobenzimidazole Triaz 2e-06
2of2_A271 Crystal Structure Of Furanopyrimidine 8 Bound To Lc 2e-06
1qpe_A279 Structural Analysis Of The Lymphocyte-Specific Kina 2e-06
1r0p_A312 Crystal Structure Of The Tyrosine Kinase Domain Of 2e-06
1opk_A495 Structural Basis For The Auto-Inhibition Of C-Abl T 2e-06
3q96_A282 B-Raf Kinase Domain In Complex With A Tetrahydronap 2e-06
3ii5_A306 The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimi 3e-06
3d4q_A307 Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 3e-06
1qpd_A279 Structural Analysis Of The Lymphocyte-specific Kina 3e-06
3oy3_A284 Crystal Structure Of Abl T315i Mutant Kinase Domain 3e-06
2p0c_A313 Catalytic Domain Of The Proto-Oncogene Tyrosine-Pro 3e-06
4h58_A275 Braf In Complex With Compound 3 Length = 275 3e-06
3oez_A286 Crystal Structure Of The L317i Mutant Of The Chicke 3e-06
2z60_A288 Crystal Structure Of The T315i Mutant Of Abl Kinase 3e-06
1qcf_A454 Crystal Structure Of Hck In Complex With A Src Fami 3e-06
3cth_A314 Crystal Structure Of The Tyrosine Kinase Domain Of 3e-06
2qoi_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 3e-06
2hwo_A286 Crystal Structure Of Src Kinase Domain In Complex W 3e-06
1t46_A313 Structural Basis For The Autoinhibition And Sti-571 3e-06
2og8_A265 Crystal Structure Of Aminoquinazoline 36 Bound To L 3e-06
3dkc_A317 Sgx Clone 5698a65kfg1h1 Length = 317 3e-06
2qok_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 3e-06
1pkg_A329 Structure Of A C-kit Kinase Product Complex Length 3e-06
3g0e_A336 Kit Kinase Domain In Complex With Sunitinib Length 3e-06
2qoo_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 4e-06
3qti_A314 C-Met Kinase In Complex With Nvp-Bvu972 Length = 31 4e-06
1t45_A331 Structural Basis For The Autoinhibition And Sti-571 4e-06
3a4p_A319 Human C-Met Kinase Domain Complexed With 6-Benzylox 4e-06
3g0f_A336 Kit Kinase Domain Mutant D816h In Complex With Suni 4e-06
1yoj_A283 Crystal Structure Of Src Kinase Domain Length = 283 4e-06
3c1x_A373 Crystal Structure Of The Tyrosine Kinase Domain Of 4e-06
2qod_A373 Human Epha3 Kinase And Juxtamembrane Region, Y602f 4e-06
3dkg_A317 Sgx Clone 5698a109kfg1h1 Length = 317 4e-06
4fsw_A279 Crystal Structure Of The Chk1 Length = 279 4e-06
2qol_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596:y 5e-06
1yol_A283 Crystal Structure Of Src Kinase Domain In Complex W 5e-06
4fst_A269 Crystal Structure Of The Chk1 Length = 269 5e-06
1jpa_A312 Crystal Structure Of Unphosphorylated Ephb2 Recepto 5e-06
4ft3_A279 Crystal Structure Of The Chk1 Length = 279 6e-06
1fpu_A293 Crystal Structure Of Abl Kinase Domain In Complex W 6e-06
3dk6_A293 Crystal Structure Of Mutant Abl Kinase Domain In Co 6e-06
2qon_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 6e-06
2vwu_A302 Ephb4 Kinase Domain Inhibitor Complex Length = 302 6e-06
3omv_A307 Crystal Structure Of C-Raf (Raf-1) Length = 307 6e-06
3oxz_A284 Crystal Structure Of Abl Kinase Domain Bound With A 7e-06
3dk3_A293 Crystal Structure Of Mutant Abl Kinase Domain In Co 7e-06
2qoh_A288 Crystal Structure Of Abl Kinase Bound With Ppy-a Le 7e-06
2qof_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f 7e-06
2gsf_A373 The Human Epha3 Receptor Tyrosine Kinase And Juxtam 1e-05
3v5q_A297 Discovery Of A Selective Trk Inhibitor With Efficac 1e-05
3fxx_A371 Human Epha3 Kinase And Juxtamembrane Region Bound T 1e-05
2ogv_A317 Crystal Structure Of The Autoinhibited Human C-Fms 1e-05
3c4c_A280 B-Raf Kinase In Complex With Plx4720 Length = 280 1e-05
3idp_A300 B-Raf V600e Kinase Domain In Complex With An Aminoi 1e-05
2z66_A306 Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 A 1e-05
3pls_A298 Ron In Complex With Ligand Amp-Pnp Length = 298 1e-05
3lcd_A329 Inhibitor Bound To A Dfg-In Structure Of The Kinase 1e-05
3kul_A325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 1e-05
4g9r_A307 B-Raf V600e Kinase Domain Bound To A Type Ii Dihydr 1e-05
3bea_A333 Cfms Tyrosine Kinase (Tie2 Kid) In Complex With A P 1e-05
1uwj_A276 The Complex Of Mutant V599e B-raf And Bay439006 Len 2e-05
3kul_B325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 2e-05
3lco_A324 Inhibitor Bound To A Dfg-Out Structure Of The Kinas 2e-05
2qoc_A344 Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp 2e-05
3fxi_A605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 2e-05
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 2e-05
3dzq_A361 Human Epha3 Kinase Domain In Complex With Inhibitor 2e-05
3gvu_A292 The Crystal Structure Of Human Abl2 In Complex With 3e-05
4aw5_A291 Complex Of The Ephb4 Kinase Domain With An Oxindole 3e-05
2hel_A306 Crystal Structure Of A Mutant Epha4 Kinase Domain ( 3e-05
4g8a_A635 Crystal Structure Of Human Tlr4 Polymorphic Variant 3e-05
2r2p_A295 Kinase Domain Of Human Ephrin Type-A Receptor 5 (Ep 3e-05
2i1m_A333 Cfms Tyrosine Kinase (Tie2 Kid) In Complex With An 4e-05
3og7_A289 B-Raf Kinase V600e Oncogenic Mutant In Complex With 4e-05
2qo7_A373 Human Epha3 Kinase And Juxtamembrane Region, Dephos 4e-05
3a4o_X286 Lyn Kinase Domain Length = 286 5e-05
3o8p_A360 Conformational Plasticity Of P38 Map Kinase Dfg Mot 5e-05
2zv7_A279 Lyn Tyrosine Kinase Domain, Apo Form Length = 279 6e-05
2eva_A307 Structural Basis For The Interaction Of Tak1 Kinase 6e-05
4gs6_A315 Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxoz 6e-05
4fk3_A292 B-Raf Kinase V600e Oncogenic Mutant In Complex With 7e-05
1rjb_A344 Crystal Structure Of Flt3 Length = 344 8e-05
2qob_A344 Human Epha3 Kinase Domain, Base Structure Length = 1e-04
2z63_A570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 1e-04
2hen_A286 Crystal Structure Of The Ephb2 Receptor Kinase Doma 1e-04
4e6d_A298 Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex W 1e-04
3qgw_A286 Crystal Structure Of Itk Kinase Bound To An Inhibit 2e-04
2fso_X367 Mitogen Activated Protein Kinase P38alpha (D176a) A 2e-04
2fsl_X367 Mitogen Activated Protein Kinase P38alpha (D176a+f3 2e-04
2fst_X367 Mitogen Activated Protein Kinase P38alpha (d176a+f3 2e-04
3nnx_A354 Crystal Structure Of Phosphorylated P38 Alpha In Co 2e-04
3d83_A360 Crystal Structure Of P38 Kinase In Complex With A B 2e-04
2baq_A365 P38alpha Bound To Ro3201195 Length = 365 2e-04
4f0f_A287 Crystal Structure Of The Roco4 Kinase Domain Bound 2e-04
2bal_A365 P38alpha Map Kinase Bound To Pyrazoloamine Length = 2e-04
3nnu_A354 Crystal Structure Of P38 Alpha In Complex With Dp13 2e-04
4fho_A231 Crystal Structure Of An Internalin C2 (Inlc2) From 2e-04
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 2e-04
1lew_A360 Crystal Structure Of Map Kinase P38 Complexed To Th 2e-04
3odz_X360 Crystal Structure Of P38alpha Y323r Active Mutant L 2e-04
3ody_X360 Crystal Structure Of P38alpha Y323q Active Mutant L 2e-04
2baj_A365 P38alpha Bound To Pyrazolourea Length = 365 3e-04
3s3i_A349 P38 Kinase Crystal Structure In Complex With Small 3e-04
3od6_X360 Crystal Structure Of P38alpha Y323t Active Mutant L 3e-04
3hec_A348 P38 In Complex With Imatinib Length = 348 3e-04
3hrb_A359 P38 Kinase Crystal Structure In Complex With Small 3e-04
3oef_X360 Crystal Structure Of Y323f Inactive Mutant Of P38al 3e-04
3miy_A266 X-Ray Crystal Structure Of Itk Complexed With Sunit 3e-04
3hvc_A362 Crystal Structure Of Human P38alpha Map Kinase Leng 3e-04
2gtm_A348 Mutated Mouse P38 Map Kinase Domain In Complex With 3e-04
2lgc_A359 Joint Nmr And X-Ray Refinement Reveals The Structur 3e-04
3p4k_A370 The Third Conformation Of P38a Map Kinase Observed 3e-04
3k3i_A350 P38alpha Bound To Novel Dgf-Out Compound Pf-0021595 3e-04
3e92_A371 Crystal Structure Of P38 Kinase In Complex With A B 3e-04
3d7z_A360 Crystal Structure Of P38 Kinase In Complex With A B 3e-04
1di9_A360 The Structure Of P38 Mitogen-Activated Protein Kina 3e-04
2npq_A367 A Novel Lipid Binding Site In The P38 Alpha Map Kin 3e-04
1zzl_A351 Crystal Structure Of P38 With Triazolopyridine Leng 3e-04
3zsg_A362 X-Ray Structure Of P38alpha Bound To Tak-715 Length 3e-04
1ian_A366 Human P38 Map Kinase Inhibitor Complex Length = 366 3e-04
3gcu_A360 Human P38 Map Kinase In Complex With Rl48 Length = 3e-04
2puu_A348 Crystal Structure Of P38 Complex With 1-(5-Tert-But 3e-04
4bbe_A298 Aminoalkylpyrimidine Inhibitor Complexes With Jak2 3e-04
4e5a_X360 The W197a Mutant Of P38a Map Kinase Length = 360 3e-04
3k3j_A362 P38alpha Bound To Novel Dfg-Out Compound Pf-0041612 3e-04
2oza_B366 Structure Of P38alpha Complex Length = 366 3e-04
3mpt_A371 Crystal Structure Of P38 Kinase In Complex With A P 3e-04
3fi4_A372 P38 Kinase Crystal Structure In Complex With Ro4499 3e-04
4hct_A269 Crystal Structure Of Itk In Complex With Compound 5 3e-04
1m7q_A366 Crystal Structure Of P38 Map Kinase In Complex With 3e-04
1oz1_A372 P38 Mitogen-Activated Kinase In Complex With 4-Azai 3e-04
2xru_A280 Aurora-A T288e Complexed With Pha-828300 Length = 2 3e-04
2gfs_A372 P38 Kinase Crystal Structure In Complex With Ro3201 3e-04
1bmk_A379 The Complex Structure Of The Map Kinase P38SB218655 3e-04
2oh4_A316 Crystal Structure Of Vegfr2 With A Benzimidazole-Ur 3e-04
3tg1_A380 Crystal Structure Of P38alpha In Complex With A Map 3e-04
1bl6_A379 The Complex Structure Of The Map Kinase P38SB216995 3e-04
3kq7_A380 Structure Of Human P38alpha With N-[4-Methyl-3-(6-{ 3e-04
3dt1_A383 P38 Complexed With A Quinazoline Inhibitor Length = 3e-04
1ywr_A360 Crystal Structure Analysis Of Inactive P38 Kinase D 4e-04
3py3_A380 Crystal Structure Of Phosphorylated P38alpha Map Ki 4e-04
3v5j_A266 Crystal Structure Of Interleukin-2 Inducible T-Cell 4e-04
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 4e-04
1yw2_A360 Mutated Mus Musculus P38 Kinase (Mp38) Length = 360 4e-04
4ewq_A383 Human P38 Alpha Mapk In Complex With A Pyridazine B 4e-04
3vnt_A318 Crystal Structure Of The Kinase Domain Of Human Veg 4e-04
1sm2_A264 Crystal Structure Of The Phosphorylated Interleukin 4e-04
3e62_A293 Fragment Based Discovery Of Jak-2 Inhibitors Length 4e-04
2y8o_A362 Crystal Structure Of Human P38alpha Complexed With 4e-04
2ghl_A348 Mutant Mus Musculus P38 Kinase Domain In Complex Wi 4e-04
1ove_A366 The Structure Of P38 Alpha In Complex With A Dihydr 4e-04
3uiu_A306 Crystal Structure Of Apo-Pkr Kinase Domain Length = 4e-04
2z7q_A321 Crystal Structure Of The N-Terminal Kinase Domain O 4e-04
3rvg_A303 Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido 4e-04
2wtv_A285 Aurora-A Inhibitor Structure Length = 285 4e-04
3gcp_A360 Human P38 Map Kinase In Complex With Sb203580 Lengt 4e-04
4hge_A300 Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 5e-04
3q32_A301 Structure Of Janus Kinase 2 With A Pyrrolotriazine 5e-04
2w1i_A326 Structure Determination Of Aurora Kinase In Complex 5e-04
2b7a_A293 The Structural Basis Of Janus Kinase 2 Inhibition B 5e-04
3tjc_A298 Co-Crystal Structure Of Jak2 With Thienopyridine 8 5e-04
3a79_B562 Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Len 5e-04
3ugc_A295 Structural Basis Of Jak2 Inhibition By The Type Ii 5e-04
4aqc_A301 Triazolopyridine-Based Inhibitor Of Janus Kinase 2 5e-04
4e4m_A302 Jak2 Kinase (Jh1 Domain) In Complex With Compound 3 5e-04
3lpb_A295 Crystal Structure Of Jak2 Complexed With A Potent 2 6e-04
3t9t_A267 Crystal Structure Of Btk Mutant (F435t,K596r) Compl 6e-04
3c7q_A316 Structure Of Vegfr2 Kinase Domain In Complex With B 6e-04
2wtw_A285 Aurora-A Inhibitor Structure (2nd Crystal Form) Len 6e-04
3mh2_A360 Mutagenesis Of P38 Map Kinase Establishes Key Roles 6e-04
3qbn_A281 Structure Of Human Aurora A In Complex With A Diami 6e-04
2p2i_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 6e-04
1vr2_A316 Human Vascular Endothelial Growth Factor Receptor 2 6e-04
2bmc_A306 Aurora-2 T287d T288d Complexed With Pha-680632 Leng 6e-04
3io7_A313 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Sel 6e-04
1h6u_A308 Internalin H: Crystal Structure Of Fused N-Terminal 7e-04
3jy9_A311 Janus Kinase 2 Inhibitors Length = 311 7e-04
2dwb_A285 Aurora-A Kinase Complexed With Amppnp Length = 285 7e-04
3cjg_A309 Crystal Structure Of Vegfr2 In Complex With A 3,4,5 7e-04
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 7e-04
1ywn_A316 Vegfr2 In Complex With A Novel 4-amino-furo[2,3-d]p 7e-04
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 8e-04
2f57_A317 Crystal Structure Of The Human P21-activated Kinase 8e-04
3unz_A279 Aurora A In Complex With Rpm1679 Length = 279 8e-04
2xa4_A298 Inhibitors Of Jak2 Kinase Domain Length = 298 8e-04
2xir_A316 Crystal Structure Of The Vegfr2 Kinase Domain In Co 8e-04
3fdn_A279 Structure-Based Drug Design Of Novel Aurora Kinase 8e-04
3cjf_A309 Crystal Structure Of Vegfr2 In Complex With A 3,4,5 8e-04
4f1o_A287 Crystal Structure Of The L1180t Mutant Roco4 Kinase 8e-04
1ol6_A282 Structure Of Unphosphorylated D274n Mutant Of Auror 9e-04
2c6e_A283 Aurora A Kinase Activated Mutant (T287d) In Complex 9e-04
4agc_A353 Crystal Structure Of Vegfr2 (Juxtamembrane And Kina 9e-04
>pdb|3TL8|A Chain A, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector Length = 349 Back     alignment and structure

Iteration: 1

Score = 110 bits (276), Expect = 2e-24, Method: Compositional matrix adjust. Identities = 96/318 (30%), Positives = 146/318 (45%), Gaps = 63/318 (19%) Query: 397 LTFKDLIAATSHFGKESLLAEGRCGPVYRAVLPGELHVAIKVLDNAKG----IDHDDAVA 452 + ++L A+ +F +++L G G VY+ L VA+K L + + V Sbjct: 28 FSLRELQVASDNFSNKNILGRGGFGKVYKGRLADGTLVAVKRLKEERXQGGELQFQTEVE 87 Query: 453 MFDELSRLKHPNLLPLAGYCIAGKEKLVLLEFMANGDLHRWLHELPTGEPNVEDWSTDTW 512 M +S H NLL L G+C+ E+L++ +MANG + L E P +P + Sbjct: 88 M---ISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASCLRERPESQPPL-------- 136 Query: 513 DHHPGAGSHISSPEKTNWVTRHRIAIGVARGLAYLH-HVGS--THGHLVTSSILLAESLE 569 +W R RIA+G ARGLAYLH H H + ++ILL E E Sbjct: 137 ----------------DWPKRQRIALGSARGLAYLHDHCDPKIIHRDVKAANILLDEEFE 180 Query: 570 PKIAGFGLRNI----------GVK-NVG----ERSENETCGPESDVYCFGVILMELLTGK 614 + FGL + V+ +G E ++DV+ +GV+L+EL+TG+ Sbjct: 181 AVVGDFGLAKLMDYKDXHVXXAVRGTIGHIAPEYLSTGKSSEKTDVFGYGVMLLELITGQ 240 Query: 615 R-------GTDDCV---KWVRKLVKEGAGGDALDFRLKLGSGDSVAEMVESL-RVGYLCT 663 R DD V WV+ L+KE +D L+ G+ E VE L +V LCT Sbjct: 241 RAFDLARLANDDDVMLLDWVKGLLKEKKLEALVDVDLQ---GNYKDEEVEQLIQVALLCT 297 Query: 664 ADSPGKRPTMQQVLGLLK 681 SP +RP M +V+ +L+ Sbjct: 298 QSSPMERPKMSEVVRMLE 315
>pdb|3UIM|A Chain A, Structural Basis For The Impact Of Phosphorylation On Plant Receptor- Like Kinase Bak1 Activation Length = 326 Back     alignment and structure
>pdb|3HGK|A Chain A, Crystal Structure Of Effect Protein Avrptob Complexed With Kinase Pto Length = 327 Back     alignment and structure
>pdb|2QKW|B Chain B, Structural Basis For Activation Of Plant Immunity By Bacterial Effector Protein Avrpto Length = 321 Back     alignment and structure
>pdb|2NRY|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|2OIB|A Chain A, Crystal Structure Of Irak4 Kinase Domain Apo Form Length = 301 Back     alignment and structure
>pdb|2NRU|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|1LUF|A Chain A, Crystal Structure Of The Musk Tyrosine Kinase: Insights Into Receptor Autoregulation Length = 343 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|2O8Y|A Chain A, Apo Irak4 Kinase Domain Length = 298 Back     alignment and structure
>pdb|3DTC|A Chain A, Crystal Structure Of Mixed-Lineage Kinase Mlk1 Complexed With Compound 16 Length = 271 Back     alignment and structure
>pdb|3P86|A Chain A, Crystal Structure Of Ctr1 Kinase Domain Mutant D676n In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|4GT5|A Chain A, Crystal Structure Of The Inactive Trka Kinase Domain Length = 306 Back     alignment and structure
>pdb|4AOJ|A Chain A, Human Trka In Complex With The Inhibitor Az-23 Length = 329 Back     alignment and structure
>pdb|4F0I|A Chain A, Crystal Structure Of Apo Trka Length = 300 Back     alignment and structure
>pdb|3PPZ|A Chain A, Crystal Structure Of Ctr1 Kinase Domain In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|2WQB|A Chain A, Structure Of The Tie2 Kinase Domain In Complex With A Thiazolopyrimidine Inhibitor Length = 324 Back     alignment and structure
>pdb|3KXX|A Chain A, Structure Of The Mutant Fibroblast Growth Factor Receptor 1 Length = 317 Back     alignment and structure
>pdb|2OO8|X Chain X, Synthesis, Structural Analysis, And Sar Studies Of Triazine Derivatives As Potent, Selective Tie-2 Inhibitors Length = 317 Back     alignment and structure
>pdb|1FVR|A Chain A, Tie2 Kinase Domain Length = 327 Back     alignment and structure
>pdb|2PZ5|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic N549t Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|3CLY|A Chain A, Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase Domains Trapped In Trans-Phosphorylation Reaction Length = 334 Back     alignment and structure
>pdb|2PSQ|A Chain A, Crystal Structure Of Unphosphorylated Unactivated Wild Type Fgf Receptor 2 (Fgfr2) Kinase Domain Length = 370 Back     alignment and structure
>pdb|3B2T|A Chain A, Structure Of Phosphotransferase Length = 311 Back     alignment and structure
>pdb|1K3A|A Chain A, Structure Of The Insulin-Like Growth Factor 1 Receptor Kinase Length = 299 Back     alignment and structure
>pdb|3TT0|A Chain A, Co-Structure Of Fibroblast Growth Factor Receptor 1 Kinase Domain With 3-(2,6-Dichloro-3, 5-Dimethoxy-Phenyl)-1-{6-[4-(4-Ethyl-Piperazin-1- Yl)-Phenylamino]-Pyrimidin-4-Yl}-1-Methyl-Urea (Bgj398) Length = 382 Back     alignment and structure
>pdb|3RI1|A Chain A, Crystal Structure Of The Catalytic Domain Of Fgfr2 Kinase In Complex With Arq 069 Length = 313 Back     alignment and structure
>pdb|1FGK|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of Fibroblast Growth Factor Receptor 1 Length = 310 Back     alignment and structure
>pdb|3RHX|B Chain B, Crystal Structure Of The Catalytic Domain Of Fgfr1 Kinase In Complex With Arq 069 Length = 306 Back     alignment and structure
>pdb|1GJO|A Chain A, The Fgfr2 Tyrosine Kinase Domain Length = 316 Back     alignment and structure
>pdb|2PWL|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic N549h Mutation Responsible For Crouzon Syndrome. Length = 324 Back     alignment and structure
>pdb|2PZP|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K526e Mutation Responsible For Crouzon Syndrome Length = 324 Back     alignment and structure
>pdb|3JS2|A Chain A, Crystal Structure Of Minimal Kinase Domain Of Fibroblast Growth Factor Receptor 1 In Complex With 5-(2-Thienyl) Nicotinic Acid Length = 317 Back     alignment and structure
>pdb|4F63|A Chain A, Crystal Structure Of Human Fibroblast Growth Factor Receptor 1 Kinase Domain In Complex With Compound 1 Length = 309 Back     alignment and structure
>pdb|2ZM3|A Chain A, Complex Structure Of Insulin-Like Growth Factor Receptor And Isoquinolinedione Inhibitor Length = 308 Back     alignment and structure
>pdb|4ASZ|A Chain A, Crystal Structure Of Apo Trkb Kinase Domain Length = 299 Back     alignment and structure
>pdb|1AD5|A Chain A, Src Family Kinase Hck-Amp-Pnp Complex Length = 438 Back     alignment and structure
>pdb|2REI|A Chain A, Kinase Domain Of Human Ephrin Type-a Receptor 7 (epha7) Length = 318 Back     alignment and structure
>pdb|2PZR|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K641r Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|1P14|A Chain A, Crystal Structure Of A Catalytic-Loop Mutant Of The Insulin Receptor Tyrosine Kinase Length = 306 Back     alignment and structure
>pdb|2PVY|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K659n Mutation Responsible For An Unclassified Craniosynostosis Syndrome. Length = 324 Back     alignment and structure
>pdb|3C4F|A Chain A, Fgfr Tyrosine Kinase Domain In Complex With 3-(3- Methoxybenzyl)-7-Azaindole Length = 302 Back     alignment and structure
>pdb|3LVP|A Chain A, Crystal Structure Of Bisphosphorylated Igf1-R Kinase Domain (2p) In Complex With A Bis-Azaindole Inhibitor Length = 336 Back     alignment and structure
>pdb|3EKK|A Chain A, Insulin Receptor Kinase Complexed With An Inhibitor Length = 307 Back     alignment and structure
>pdb|2HOG|A Chain A, Crystal Structure Of Chek1 In Complex With Inhibitor 20 Length = 322 Back     alignment and structure
>pdb|1RQQ|A Chain A, Crystal Structure Of The Insulin Receptor Kinase In Complex With The Sh2 Domain Of Aps Length = 306 Back     alignment and structure
>pdb|4FSY|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|3SXR|A Chain A, Crystal Structure Of Bmx Non-Receptor Tyrosine Kinase Complex With Dasatinib Length = 268 Back     alignment and structure
>pdb|3GQI|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 Back     alignment and structure
>pdb|2R0U|A Chain A, Crystal Structure Of Chek1 In Complex With Inhibitor 54 Length = 323 Back     alignment and structure
>pdb|1IR3|A Chain A, Phosphorylated Insulin Receptor Tyrosine Kinase In Complex With Peptide Substrate And Atp Analog Length = 306 Back     alignment and structure
>pdb|3O23|A Chain A, Human Unphosphorylated Igf1-R Kinase Domain In Complex With An Hydantoin Inhibitor Length = 305 Back     alignment and structure
>pdb|2Z8C|A Chain A, Phosphorylated Insulin Receptor Tyrosine Kinase In Complex With (4-{[5-Carbamoyl-4-(3-Methylanilino)pyrimidin-2- Yl]amino}phenyl)acetic Acid Length = 303 Back     alignment and structure
>pdb|3GQL|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 Back     alignment and structure
>pdb|1M7N|A Chain A, Crystal Structure Of Unactivated Apo Insulin-Like Growth Factor-1 Receptor Kinase Domain Length = 322 Back     alignment and structure
>pdb|3I81|A Chain A, Crystal Structure Of Insulin-Like Growth Factor 1 Receptor (Igf-1r-Wt) Complex With Bms-754807 [1-(4-((5-Cyclopropyl- 1h-Pyrazol-3-Yl)amino)pyrrolo[2,1-F][1,2, 4]triazin-2-Yl)-N- (6-Fluoro-3-Pyridinyl)-2-Methyl-L-Prolinamide] Length = 315 Back     alignment and structure
>pdb|2PVF|A Chain A, Crystal Structure Of Tyrosine Phosphorylated Activated Fgf Receptor 2 (Fgfr2) Kinase Domain In Complex With Atp Analog And Substrate Peptide Length = 334 Back     alignment and structure
>pdb|1JQH|A Chain A, Igf-1 Receptor Kinase Domain Length = 308 Back     alignment and structure
>pdb|2OJ9|A Chain A, Structure Of Igf-1r Kinase Domain Complexed With A Benzimidazole Inhibitor Length = 307 Back     alignment and structure
>pdb|1I44|A Chain A, Crystallographic Studies Of An Activation Loop Mutant Of The Insulin Receptor Tyrosine Kinase Length = 306 Back     alignment and structure
>pdb|3QQU|A Chain A, Cocrystal Structure Of Unphosphorylated Igf With Pyrimidine 8 Length = 301 Back     alignment and structure
>pdb|4FSU|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|1IRK|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Human Insulin Receptor Length = 306 Back     alignment and structure
>pdb|2IVV|A Chain A, Crystal Structure Of Phosphorylated Ret Tyrosine Kinase Domain Complexed With The Inhibitor Pp1 Length = 314 Back     alignment and structure
>pdb|2BR1|A Chain A, Structure-Based Design Of Novel Chk1 Inhibitors: Insights Into Hydrogen Bonding And Protein-Ligand Affinity Length = 297 Back     alignment and structure
>pdb|1IA8|A Chain A, The 1.7 A Crystal Structure Of Human Cell Cycle Checkpoint Kinase Chk1 Length = 289 Back     alignment and structure
>pdb|1ZLT|A Chain A, Crystal Structure Of Chk1 Complexed With A Hymenaldisine Analog Length = 295 Back     alignment and structure
>pdb|2IVT|A Chain A, Crystal Structure Of Phosphorylated Ret Tyrosine Kinase Domain Length = 314 Back     alignment and structure
>pdb|2IVS|A Chain A, Crystal Structure Of Non-Phosphorylated Ret Tyrosine Kinase Domain Length = 314 Back     alignment and structure
>pdb|3D94|A Chain A, Crystal Structure Of The Insulin-Like Growth Factor-1 Receptor Kinase In Complex With Pqip Length = 301 Back     alignment and structure
>pdb|4FSM|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|2Q0B|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic E565a Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|4FSN|A Chain A, Crystal Structure Of The Chk1 Length = 278 Back     alignment and structure
>pdb|2X8E|A Chain A, Discovery Of A Novel Class Of Triazolones As Checkpoint Kinase Inhibitors - Hit To Lead Exploration Length = 276 Back     alignment and structure
>pdb|4GT4|A Chain A, Structure Of Unliganded, Inactive Ror2 Kinase Domain Length = 308 Back     alignment and structure
>pdb|3OT3|A Chain A, X-Ray Crystal Structure Of Compound 22k Bound To Human Chk1 Kinase Domain Length = 273 Back     alignment and structure
>pdb|3COK|A Chain A, Crystal Structure Of Plk4 Kinase Length = 278 Back     alignment and structure
>pdb|2GHG|A Chain A, H-Chk1 Complexed With A431994 Length = 269 Back     alignment and structure
>pdb|2E9V|A Chain A, Structure Of H-Chk1 Complexed With A859017 Length = 268 Back     alignment and structure
>pdb|3JVR|A Chain A, Characterization Of The Chk1 Allosteric Inhibitor Binding Site Length = 271 Back     alignment and structure
>pdb|2AYP|A Chain A, Crystal Structure Of Chk1 With An Indol Inhibitor Length = 269 Back     alignment and structure
>pdb|3ETA|A Chain A, Kinase Domain Of Insulin Receptor Complexed With A Pyrrolo Pyridine Inhibitor Length = 317 Back     alignment and structure
>pdb|1Y57|A Chain A, Structure Of Unphosphorylated C-Src In Complex With An Inhibitor Length = 452 Back     alignment and structure
>pdb|1P4O|A Chain A, Structure Of Apo Unactivated Igf-1r Kinase Domain At 1.5a Resolution. Length = 322 Back     alignment and structure
>pdb|2H8H|A Chain A, Src Kinase In Complex With A Quinazoline Inhibitor Length = 535 Back     alignment and structure
>pdb|1FMK|A Chain A, Crystal Structure Of Human Tyrosine-Protein Kinase C-Src Length = 452 Back     alignment and structure
>pdb|3LW0|A Chain A, Igf-1rk In Complex With Ligand Msc1609119a-1 Length = 304 Back     alignment and structure
>pdb|1KSW|A Chain A, Structure Of Human C-Src Tyrosine Kinase (Thr338gly Mutant) In Complex With N6-Benzyl Adp Length = 452 Back     alignment and structure
>pdb|2PY3|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic E565g Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|3QRJ|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain T315i Mutant In Complex With Dcc-2036 Length = 277 Back     alignment and structure
>pdb|2V7A|A Chain A, Crystal Structure Of The T315i Abl Mutant In Complex With The Inhibitor Pha-739358 Length = 286 Back     alignment and structure
>pdb|3ZZW|A Chain A, Crystal Structure Of The Kinase Domain Of Ror2 Length = 289 Back     alignment and structure
>pdb|2PTK|A Chain A, Chicken Src Tyrosine Kinase Length = 453 Back     alignment and structure
>pdb|1ZYS|A Chain A, Co-Crystal Structure Of Checkpoint Kinase Chk1 With A Pyrrolo-Pyridine Inhibitor Length = 273 Back     alignment and structure
>pdb|3DQW|A Chain A, C-Src Kinase Domain Thr338ile Mutant In Complex With Atpgs Length = 286 Back     alignment and structure
>pdb|3G6H|A Chain A, Src Thr338ile Inhibited In The Dfg-Asp-Out Conformation Length = 286 Back     alignment and structure
>pdb|1UWH|A Chain A, The Complex Of Wild Type B-Raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|3GEQ|A Chain A, Structural Basis For The Chemical Rescue Of Src Kinase Activity Length = 286 Back     alignment and structure
>pdb|2GQG|A Chain A, X-Ray Crystal Structure Of Dasatinib (Bms-354825) Bound To Activated Abl Kinase Domain Length = 278 Back     alignment and structure
>pdb|1OPL|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 537 Back     alignment and structure
>pdb|3QRI|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain In Complex With Dcc- 2036 Length = 277 Back     alignment and structure
>pdb|1YI6|A Chain A, C-Term Tail Segment Of Human Tyrosine Kinase (258-533) Length = 276 Back     alignment and structure
>pdb|2HZI|A Chain A, Abl Kinase Domain In Complex With Pd180970 Length = 277 Back     alignment and structure
>pdb|3Q6W|A Chain A, Structure Of Dually-phosphorylated Met Receptor Kinase In Complex With An Mk-2461 Analog With Specificity For The Activated Receptor Length = 307 Back     alignment and structure
>pdb|2HYY|A Chain A, Human Abl Kinase Domain In Complex With Imatinib (Sti571, Glivec) Length = 273 Back     alignment and structure
>pdb|2BDF|A Chain A, Src Kinase In Complex With Inhibitor Ap23451 Length = 279 Back     alignment and structure
>pdb|2HZ0|A Chain A, Abl Kinase Domain In Complex With Nvp-Aeg082 Length = 270 Back     alignment and structure
>pdb|3PYY|A Chain A, Discovery And Characterization Of A Cell-Permeable, Small-Molecule C- Abl Kinase Activator That Binds To The Myristoyl Binding Site Length = 298 Back     alignment and structure
>pdb|3QUP|A Chain A, Inhibitor Bound Structure Of The Kinase Domain Of The Murine Receptor Tyrosine Kinase Tyro3 (Sky) Length = 323 Back     alignment and structure
>pdb|3D7U|B Chain B, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 277 Back     alignment and structure
>pdb|2F4J|A Chain A, Structure Of The Kinase Domain Of An Imatinib-Resistant Abl Mutant In Complex With The Aurora Kinase Inhibitor Vx-680 Length = 287 Back     alignment and structure
>pdb|4GG5|A Chain A, Crystal Structure Of Cmet In Complex With Novel Inhibitor Length = 319 Back     alignment and structure
>pdb|3Q6U|A Chain A, Structure Of The Apo Met Receptor Kinase In The Dually-Phosphorylated, Activated State Length = 308 Back     alignment and structure
>pdb|2DQ7|X Chain X, Crystal Structure Of Fyn Kinase Domain Complexed With Staurosporine Length = 283 Back     alignment and structure
>pdb|2QQ7|A Chain A, Crystal Structure Of Drug Resistant Src Kinase Domain With Irreversible Inhibitor Length = 286 Back     alignment and structure
>pdb|2WD1|A Chain A, Human C-Met Kinase In Complex With Azaindole Inhibitor Length = 292 Back     alignment and structure
>pdb|3U4W|A Chain A, Src In Complex With Dna-Templated Macrocyclic Inhibitor Mc4b Length = 275 Back     alignment and structure
>pdb|3BBT|B Chain B, Crystal Structure Of The Erbb4 Kinase In Complex With Lapatinib Length = 328 Back     alignment and structure
>pdb|2G1T|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|2OIQ|A Chain A, Crystal Structure Of Chicken C-Src Kinase Domain In Complex With The Cancer Drug Imatinib. Length = 286 Back     alignment and structure
>pdb|2G2F|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|3SVV|A Chain A, Crystal Structure Of T338c C-Src Covalently Bound To Vinylsulfonamide- Pyrazolopyrimidine 9 Length = 286 Back     alignment and structure
>pdb|2HIW|A Chain A, Crystal Structure Of Inactive Conformation Abl Kinase Catalytic Domain Complexed With Type Ii Inhibitor Length = 287 Back     alignment and structure
>pdb|2G15|A Chain A, Structural Characterization Of Autoinhibited C-Met Kinase Length = 318 Back     alignment and structure
>pdb|3I5N|A Chain A, Crystal Structure Of C-Met With Triazolopyridazine Inhibitor 13 Length = 309 Back     alignment and structure
>pdb|2WGJ|A Chain A, X-Ray Structure Of Pf-02341066 Bound To The Kinase Domain Of C-Met Length = 306 Back     alignment and structure
>pdb|2E2B|A Chain A, Crystal Structure Of The C-Abl Kinase Domain In Complex With Inno-406 Length = 293 Back     alignment and structure
>pdb|2RFN|A Chain A, X-ray Structure Of C-met With Inhibitor. Length = 310 Back     alignment and structure
>pdb|2PL0|A Chain A, Lck Bound To Imatinib Length = 289 Back     alignment and structure
>pdb|2HK5|A Chain A, Hck Kinase In Complex With Lck Targetted Inhibitor Pg- 1009247 Length = 270 Back     alignment and structure
>pdb|3KXZ|A Chain A, The Complex Crystal Structure Of Lck With A Probe Molecule W259 Length = 287 Back     alignment and structure
>pdb|3F66|A Chain A, Human C-Met Kinase In Complex With Quinoxaline Inhibitor Length = 298 Back     alignment and structure
>pdb|3LQ8|A Chain A, Structure Of The Kinase Domain Of C-Met Bound To Xl880 (Gsk1 Length = 302 Back     alignment and structure
>pdb|3MPM|A Chain A, Lck Complexed With A Pyrazolopyrimidine Length = 267 Back     alignment and structure
>pdb|2I0V|A Chain A, C-Fms Tyrosine Kinase In Complex With A Quinolone Inhibitor Length = 335 Back     alignment and structure
>pdb|2ZM1|A Chain A, Crystal Structure Of Imidazo Pyrazin 1 Bound To The Kinase Domain Of Human Lck, (Auto-Phosphorylated On Tyr394) Length = 285 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|3BYS|A Chain A, Co-Crystal Structure Of Lck And Aminopyrimidine Amide 10b Length = 277 Back     alignment and structure
>pdb|1MQB|A Chain A, Crystal Structure Of Ephrin A2 (Epha2) Receptor Protein Kinase Length = 333 Back     alignment and structure
>pdb|3KMM|A Chain A, Structure Of Human Lck Kinase With A Small Molecule Inhibitor Length = 288 Back     alignment and structure
>pdb|4FSZ|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|2R4B|A Chain A, Erbb4 Kinase Domain Complexed With A Thienopyrimidine Inhibitor Length = 321 Back     alignment and structure
>pdb|2YDJ|A Chain A, Discovery Of Checkpoint Kinase Inhibitor Azd7762 By Structure Based Design And Optimization Of Thiophene Carboxamide Ureas Length = 276 Back     alignment and structure
>pdb|3DK7|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 277 Back     alignment and structure
>pdb|2OFV|A Chain A, Crystal Structure Of Aminoquinazoline 1 Bound To Lck Length = 277 Back     alignment and structure
>pdb|2OFU|A Chain A, X-Ray Crystal Structure Of 2-Aminopyrimidine Carbamate 43 Bound To Lck Length = 273 Back     alignment and structure
>pdb|2FB8|A Chain A, Structure Of The B-Raf Kinase Domain Bound To Sb-590885 Length = 281 Back     alignment and structure
>pdb|3LCK|A Chain A, The Kinase Domain Of Human Lymphocyte Kinase (Lck), Activated Form (Auto-Phosphorylated On Tyr394) Length = 271 Back     alignment and structure
>pdb|4DBN|A Chain A, Crystal Structure Of The Kinase Domain Of Human B-Raf With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 284 Back     alignment and structure
>pdb|3BYM|A Chain A, X-Ray Co-Crystal Structure Aminobenzimidazole Triazine 1 Bound To Lck Length = 272 Back     alignment and structure
>pdb|2OF2|A Chain A, Crystal Structure Of Furanopyrimidine 8 Bound To Lck Length = 271 Back     alignment and structure
>pdb|1QPE|A Chain A, Structural Analysis Of The Lymphocyte-Specific Kinase Lck In Complex With Non-Selective And Src Family Selective Kinase Inhibitors Length = 279 Back     alignment and structure
>pdb|1R0P|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With The Microbial Alkaloid K-252a Length = 312 Back     alignment and structure
>pdb|1OPK|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 495 Back     alignment and structure
>pdb|3Q96|A Chain A, B-Raf Kinase Domain In Complex With A Tetrahydronaphthalene Inhibitor Length = 282 Back     alignment and structure
>pdb|3II5|A Chain A, The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimidine Inhibitor Length = 306 Back     alignment and structure
>pdb|3D4Q|A Chain A, Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 307 Back     alignment and structure
>pdb|1QPD|A Chain A, Structural Analysis Of The Lymphocyte-specific Kinase Lck In Complex With Non-selective And Src Family Selective Kinase Inhibitors Length = 279 Back     alignment and structure
>pdb|3OY3|A Chain A, Crystal Structure Of Abl T315i Mutant Kinase Domain Bound With A Dfg- Out Inhibitor Ap24589 Length = 284 Back     alignment and structure
>pdb|2P0C|A Chain A, Catalytic Domain Of The Proto-Oncogene Tyrosine-Protein Kina Length = 313 Back     alignment and structure
>pdb|4H58|A Chain A, Braf In Complex With Compound 3 Length = 275 Back     alignment and structure
>pdb|3OEZ|A Chain A, Crystal Structure Of The L317i Mutant Of The Chicken C-Src Tyrosine Kinase Domain Complexed With Imatinib Length = 286 Back     alignment and structure
>pdb|2Z60|A Chain A, Crystal Structure Of The T315i Mutant Of Abl Kinase Bound With Ppy-A Length = 288 Back     alignment and structure
>pdb|1QCF|A Chain A, Crystal Structure Of Hck In Complex With A Src Family- Selective Tyrosine Kinase Inhibitor Length = 454 Back     alignment and structure
>pdb|3CTH|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With A Aminopyridine Based Inhibitor Length = 314 Back     alignment and structure
>pdb|2QOI|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f Double Mutant Length = 373 Back     alignment and structure
>pdb|2HWO|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Covalent Inhibitor Length = 286 Back     alignment and structure
>pdb|1T46|A Chain A, Structural Basis For The Autoinhibition And Sti-571 Inhibition Of C-kit Tyrosine Kinase Length = 313 Back     alignment and structure
>pdb|2OG8|A Chain A, Crystal Structure Of Aminoquinazoline 36 Bound To Lck Length = 265 Back     alignment and structure
>pdb|3DKC|A Chain A, Sgx Clone 5698a65kfg1h1 Length = 317 Back     alignment and structure
>pdb|2QOK|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:s768a Triple Mutant Length = 373 Back     alignment and structure
>pdb|1PKG|A Chain A, Structure Of A C-kit Kinase Product Complex Length = 329 Back     alignment and structure
>pdb|3G0E|A Chain A, Kit Kinase Domain In Complex With Sunitinib Length = 336 Back     alignment and structure
>pdb|2QOO|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742f Triple Mutant Length = 373 Back     alignment and structure
>pdb|3QTI|A Chain A, C-Met Kinase In Complex With Nvp-Bvu972 Length = 314 Back     alignment and structure
>pdb|1T45|A Chain A, Structural Basis For The Autoinhibition And Sti-571 Inhibition Of C- Kit Tyrosine Kinase Length = 331 Back     alignment and structure
>pdb|3A4P|A Chain A, Human C-Met Kinase Domain Complexed With 6-Benzyloxyquinoline Inhibitor Length = 319 Back     alignment and structure
>pdb|3G0F|A Chain A, Kit Kinase Domain Mutant D816h In Complex With Sunitinib Length = 336 Back     alignment and structure
>pdb|1YOJ|A Chain A, Crystal Structure Of Src Kinase Domain Length = 283 Back     alignment and structure
>pdb|3C1X|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With A Pyrrolotriazine Based Inhibitor Length = 373 Back     alignment and structure
>pdb|2QOD|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y602f Mutant Length = 373 Back     alignment and structure
>pdb|3DKG|A Chain A, Sgx Clone 5698a109kfg1h1 Length = 317 Back     alignment and structure
>pdb|4FSW|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|2QOL|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596:y602:s768g Triple Mutant Length = 373 Back     alignment and structure
>pdb|1YOL|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Cgp77675 Length = 283 Back     alignment and structure
>pdb|4FST|A Chain A, Crystal Structure Of The Chk1 Length = 269 Back     alignment and structure
>pdb|1JPA|A Chain A, Crystal Structure Of Unphosphorylated Ephb2 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 312 Back     alignment and structure
>pdb|4FT3|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|1FPU|A Chain A, Crystal Structure Of Abl Kinase Domain In Complex With A Small Molecule Inhibitor Length = 293 Back     alignment and structure
>pdb|3DK6|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|2QON|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742a Triple Mutant Length = 373 Back     alignment and structure
>pdb|2VWU|A Chain A, Ephb4 Kinase Domain Inhibitor Complex Length = 302 Back     alignment and structure
>pdb|3OMV|A Chain A, Crystal Structure Of C-Raf (Raf-1) Length = 307 Back     alignment and structure
>pdb|3OXZ|A Chain A, Crystal Structure Of Abl Kinase Domain Bound With A Dfg-Out Inhibitor Ap24534 Length = 284 Back     alignment and structure
>pdb|3DK3|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|2QOH|A Chain A, Crystal Structure Of Abl Kinase Bound With Ppy-a Length = 288 Back     alignment and structure
>pdb|2QOF|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f Mutant Length = 373 Back     alignment and structure
>pdb|2GSF|A Chain A, The Human Epha3 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 373 Back     alignment and structure
>pdb|3V5Q|A Chain A, Discovery Of A Selective Trk Inhibitor With Efficacy In Rodent Cancer Tumor Models Length = 297 Back     alignment and structure
>pdb|3FXX|A Chain A, Human Epha3 Kinase And Juxtamembrane Region Bound To Substrate Kqwdnye[ptyr]iw Length = 371 Back     alignment and structure
>pdb|2OGV|A Chain A, Crystal Structure Of The Autoinhibited Human C-Fms Kinase Domain Length = 317 Back     alignment and structure
>pdb|3C4C|A Chain A, B-Raf Kinase In Complex With Plx4720 Length = 280 Back     alignment and structure
>pdb|3IDP|A Chain A, B-Raf V600e Kinase Domain In Complex With An Aminoisoquinoline Inhibitor Length = 300 Back     alignment and structure
>pdb|2Z66|A Chain A, Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 306 Back     alignment and structure
>pdb|3PLS|A Chain A, Ron In Complex With Ligand Amp-Pnp Length = 298 Back     alignment and structure
>pdb|3LCD|A Chain A, Inhibitor Bound To A Dfg-In Structure Of The Kinase Domain Of Csf-1r Length = 329 Back     alignment and structure
>pdb|3KUL|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|4G9R|A Chain A, B-Raf V600e Kinase Domain Bound To A Type Ii Dihydroquinazoline Inhibitor Length = 307 Back     alignment and structure
>pdb|3BEA|A Chain A, Cfms Tyrosine Kinase (Tie2 Kid) In Complex With A Pyrimidinopyridone Inhibitor Length = 333 Back     alignment and structure
>pdb|1UWJ|A Chain A, The Complex Of Mutant V599e B-raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|3KUL|B Chain B, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|3LCO|A Chain A, Inhibitor Bound To A Dfg-Out Structure Of The Kinase Domain Of Csf-1r Length = 324 Back     alignment and structure
>pdb|2QOC|A Chain A, Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp Bound Structure Length = 344 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure
>pdb|3DZQ|A Chain A, Human Epha3 Kinase Domain In Complex With Inhibitor Awl-Ii- 38.3 Length = 361 Back     alignment and structure
>pdb|3GVU|A Chain A, The Crystal Structure Of Human Abl2 In Complex With Gleevec Length = 292 Back     alignment and structure
>pdb|4AW5|A Chain A, Complex Of The Ephb4 Kinase Domain With An Oxindole Inhibitor Length = 291 Back     alignment and structure
>pdb|2HEL|A Chain A, Crystal Structure Of A Mutant Epha4 Kinase Domain (Y742a) Length = 306 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|2R2P|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 5 (Epha5) Length = 295 Back     alignment and structure
>pdb|2I1M|A Chain A, Cfms Tyrosine Kinase (Tie2 Kid) In Complex With An Arylamide Inhibitor Length = 333 Back     alignment and structure
>pdb|3OG7|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx4032 Length = 289 Back     alignment and structure
>pdb|2QO7|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Dephosphorylated, Amp-Pnp Bound Length = 373 Back     alignment and structure
>pdb|3A4O|X Chain X, Lyn Kinase Domain Length = 286 Back     alignment and structure
>pdb|3O8P|A Chain A, Conformational Plasticity Of P38 Map Kinase Dfg Motif Mutants In Response To Inhibitor Binding Length = 360 Back     alignment and structure
>pdb|2ZV7|A Chain A, Lyn Tyrosine Kinase Domain, Apo Form Length = 279 Back     alignment and structure
>pdb|2EVA|A Chain A, Structural Basis For The Interaction Of Tak1 Kinase With Its Activating Protein Tab1 Length = 307 Back     alignment and structure
>pdb|4GS6|A Chain A, Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxozeaenol Length = 315 Back     alignment and structure
>pdb|4FK3|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx3203 Length = 292 Back     alignment and structure
>pdb|1RJB|A Chain A, Crystal Structure Of Flt3 Length = 344 Back     alignment and structure
>pdb|2QOB|A Chain A, Human Epha3 Kinase Domain, Base Structure Length = 344 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure
>pdb|2HEN|A Chain A, Crystal Structure Of The Ephb2 Receptor Kinase Domain In Complex With Adp Length = 286 Back     alignment and structure
>pdb|4E6D|A Chain A, Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex With Compound 7 Length = 298 Back     alignment and structure
>pdb|3QGW|A Chain A, Crystal Structure Of Itk Kinase Bound To An Inhibitor Length = 286 Back     alignment and structure
>pdb|2FSO|X Chain X, Mitogen Activated Protein Kinase P38alpha (D176a) Activating Mutant Length = 367 Back     alignment and structure
>pdb|2FSL|X Chain X, Mitogen Activated Protein Kinase P38alpha (D176a+f327s) Activating Mutant Form-A Length = 367 Back     alignment and structure
>pdb|2FST|X Chain X, Mitogen Activated Protein Kinase P38alpha (d176a+f327l) Activating Mutant Length = 367 Back     alignment and structure
>pdb|3NNX|A Chain A, Crystal Structure Of Phosphorylated P38 Alpha In Complex With Dp802 Length = 354 Back     alignment and structure
>pdb|3D83|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biphenyl Amide Inhibitor Length = 360 Back     alignment and structure
>pdb|2BAQ|A Chain A, P38alpha Bound To Ro3201195 Length = 365 Back     alignment and structure
>pdb|4F0F|A Chain A, Crystal Structure Of The Roco4 Kinase Domain Bound To Appcp From D. Discoideum Length = 287 Back     alignment and structure
>pdb|2BAL|A Chain A, P38alpha Map Kinase Bound To Pyrazoloamine Length = 365 Back     alignment and structure
>pdb|3NNU|A Chain A, Crystal Structure Of P38 Alpha In Complex With Dp1376 Length = 354 Back     alignment and structure
>pdb|4FHO|A Chain A, Crystal Structure Of An Internalin C2 (Inlc2) From Listeria Monocytogenes Str. 4b F2365 At 1.90 A Resolution Length = 231 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|1LEW|A Chain A, Crystal Structure Of Map Kinase P38 Complexed To The Docking Site On Its Nuclear Substrate Mef2a Length = 360 Back     alignment and structure
>pdb|3ODZ|X Chain X, Crystal Structure Of P38alpha Y323r Active Mutant Length = 360 Back     alignment and structure
>pdb|3ODY|X Chain X, Crystal Structure Of P38alpha Y323q Active Mutant Length = 360 Back     alignment and structure
>pdb|2BAJ|A Chain A, P38alpha Bound To Pyrazolourea Length = 365 Back     alignment and structure
>pdb|3S3I|A Chain A, P38 Kinase Crystal Structure In Complex With Small Molecule Inhibitor Length = 349 Back     alignment and structure
>pdb|3OD6|X Chain X, Crystal Structure Of P38alpha Y323t Active Mutant Length = 360 Back     alignment and structure
>pdb|3HEC|A Chain A, P38 In Complex With Imatinib Length = 348 Back     alignment and structure
>pdb|3HRB|A Chain A, P38 Kinase Crystal Structure In Complex With Small Molecule Inhibitor Length = 359 Back     alignment and structure
>pdb|3OEF|X Chain X, Crystal Structure Of Y323f Inactive Mutant Of P38alpha Map Kinase Length = 360 Back     alignment and structure
>pdb|3MIY|A Chain A, X-Ray Crystal Structure Of Itk Complexed With Sunitinib Length = 266 Back     alignment and structure
>pdb|3HVC|A Chain A, Crystal Structure Of Human P38alpha Map Kinase Length = 362 Back     alignment and structure
>pdb|2GTM|A Chain A, Mutated Mouse P38 Map Kinase Domain In Complex With Inhibitor Pg-892579 Length = 348 Back     alignment and structure
>pdb|2LGC|A Chain A, Joint Nmr And X-Ray Refinement Reveals The Structure Of A Novel Dibenzo[a,D]cycloheptenone InhibitorP38 MAP KINASE COMPLEX IN Solution Length = 359 Back     alignment and structure
>pdb|3P4K|A Chain A, The Third Conformation Of P38a Map Kinase Observed In Phosphorylated P38a And In Solution Length = 370 Back     alignment and structure
>pdb|3K3I|A Chain A, P38alpha Bound To Novel Dgf-Out Compound Pf-00215955 Length = 350 Back     alignment and structure
>pdb|3E92|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biaryl Amide Inhibitor Length = 371 Back     alignment and structure
>pdb|3D7Z|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biphenyl Amide Inhibitor Length = 360 Back     alignment and structure
>pdb|1DI9|A Chain A, The Structure Of P38 Mitogen-Activated Protein Kinase In Complex With 4-[3-Methylsulfanylanilino]-6,7- Dimethoxyquinazoline Length = 360 Back     alignment and structure
>pdb|2NPQ|A Chain A, A Novel Lipid Binding Site In The P38 Alpha Map Kinase Length = 367 Back     alignment and structure
>pdb|1ZZL|A Chain A, Crystal Structure Of P38 With Triazolopyridine Length = 351 Back     alignment and structure
>pdb|3ZSG|A Chain A, X-Ray Structure Of P38alpha Bound To Tak-715 Length = 362 Back     alignment and structure
>pdb|1IAN|A Chain A, Human P38 Map Kinase Inhibitor Complex Length = 366 Back     alignment and structure
>pdb|3GCU|A Chain A, Human P38 Map Kinase In Complex With Rl48 Length = 360 Back     alignment and structure
>pdb|2PUU|A Chain A, Crystal Structure Of P38 Complex With 1-(5-Tert-Butyl-2-P- Tolyl-2h-Pyrazol-3-Yl)-3-[4-(6-Morpholin-4-Ylmethyl- Pyridin-3-Yl)naphthalen-1-Yl]urea Length = 348 Back     alignment and structure
>pdb|4BBE|A Chain A, Aminoalkylpyrimidine Inhibitor Complexes With Jak2 Length = 298 Back     alignment and structure
>pdb|4E5A|X Chain X, The W197a Mutant Of P38a Map Kinase Length = 360 Back     alignment and structure
>pdb|3K3J|A Chain A, P38alpha Bound To Novel Dfg-Out Compound Pf-00416121 Length = 362 Back     alignment and structure
>pdb|2OZA|B Chain B, Structure Of P38alpha Complex Length = 366 Back     alignment and structure
>pdb|3MPT|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Pyrrole-2- Carboxamide Inhibitor Length = 371 Back     alignment and structure
>pdb|3FI4|A Chain A, P38 Kinase Crystal Structure In Complex With Ro4499 Length = 372 Back     alignment and structure
>pdb|4HCT|A Chain A, Crystal Structure Of Itk In Complex With Compound 52 Length = 269 Back     alignment and structure
>pdb|1M7Q|A Chain A, Crystal Structure Of P38 Map Kinase In Complex With A Dihydroquinazolinone Inhibitor Length = 366 Back     alignment and structure
>pdb|1OZ1|A Chain A, P38 Mitogen-Activated Kinase In Complex With 4-Azaindole Inhibitor Length = 372 Back     alignment and structure
>pdb|2XRU|A Chain A, Aurora-A T288e Complexed With Pha-828300 Length = 280 Back     alignment and structure
>pdb|2GFS|A Chain A, P38 Kinase Crystal Structure In Complex With Ro3201195 Length = 372 Back     alignment and structure
>pdb|1BMK|A Chain A, The Complex Structure Of The Map Kinase P38SB218655 Length = 379 Back     alignment and structure
>pdb|2OH4|A Chain A, Crystal Structure Of Vegfr2 With A Benzimidazole-Urea Inhibitor Length = 316 Back     alignment and structure
>pdb|3TG1|A Chain A, Crystal Structure Of P38alpha In Complex With A Mapk Docking Partner Length = 380 Back     alignment and structure
>pdb|1BL6|A Chain A, The Complex Structure Of The Map Kinase P38SB216995 Length = 379 Back     alignment and structure
>pdb|3KQ7|A Chain A, Structure Of Human P38alpha With N-[4-Methyl-3-(6-{[2-(1- Methylpyrrolidin-2-Yl)ethyl]amino}pyridine-3- Amido)phenyl]- 2-(Morpholin-4-Yl)pyridine-4-Carboxamide Length = 380 Back     alignment and structure
>pdb|3DT1|A Chain A, P38 Complexed With A Quinazoline Inhibitor Length = 383 Back     alignment and structure
>pdb|1YWR|A Chain A, Crystal Structure Analysis Of Inactive P38 Kinase Domain In Complex With A Monocyclic Pyrazolone Inhibitor Length = 360 Back     alignment and structure
>pdb|3PY3|A Chain A, Crystal Structure Of Phosphorylated P38alpha Map Kinase Length = 380 Back     alignment and structure
>pdb|3V5J|A Chain A, Crystal Structure Of Interleukin-2 Inducible T-Cell Kinase Itk Catalytic Domain With Thienopyrazolylindole Inhibitor 090 Length = 266 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|1YW2|A Chain A, Mutated Mus Musculus P38 Kinase (Mp38) Length = 360 Back     alignment and structure
>pdb|4EWQ|A Chain A, Human P38 Alpha Mapk In Complex With A Pyridazine Based Inhibitor Length = 383 Back     alignment and structure
>pdb|3VNT|A Chain A, Crystal Structure Of The Kinase Domain Of Human Vegfr2 With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 318 Back     alignment and structure
>pdb|1SM2|A Chain A, Crystal Structure Of The Phosphorylated Interleukin-2 Tyrosine Kinase Catalytic Domain Length = 264 Back     alignment and structure
>pdb|3E62|A Chain A, Fragment Based Discovery Of Jak-2 Inhibitors Length = 293 Back     alignment and structure
>pdb|2Y8O|A Chain A, Crystal Structure Of Human P38alpha Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|2GHL|A Chain A, Mutant Mus Musculus P38 Kinase Domain In Complex With Inhibitor Pg-874743 Length = 348 Back     alignment and structure
>pdb|1OVE|A Chain A, The Structure Of P38 Alpha In Complex With A Dihydroquinolinone Length = 366 Back     alignment and structure
>pdb|3UIU|A Chain A, Crystal Structure Of Apo-Pkr Kinase Domain Length = 306 Back     alignment and structure
>pdb|2Z7Q|A Chain A, Crystal Structure Of The N-Terminal Kinase Domain Of Human Rsk-1 Bound To Amp-Pcp Length = 321 Back     alignment and structure
>pdb|3RVG|A Chain A, Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido[4,3-B]indol-4- Carboxamide Inhibitor Length = 303 Back     alignment and structure
>pdb|2WTV|A Chain A, Aurora-A Inhibitor Structure Length = 285 Back     alignment and structure
>pdb|3GCP|A Chain A, Human P38 Map Kinase In Complex With Sb203580 Length = 360 Back     alignment and structure
>pdb|4HGE|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 Length = 300 Back     alignment and structure
>pdb|3Q32|A Chain A, Structure Of Janus Kinase 2 With A Pyrrolotriazine Inhibitor Length = 301 Back     alignment and structure
>pdb|2W1I|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 326 Back     alignment and structure
>pdb|2B7A|A Chain A, The Structural Basis Of Janus Kinase 2 Inhibition By A Potent And Specific Pan-Janus Kinase Inhibitor Length = 293 Back     alignment and structure
>pdb|3TJC|A Chain A, Co-Crystal Structure Of Jak2 With Thienopyridine 8 Length = 298 Back     alignment and structure
>pdb|3A79|B Chain B, Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Length = 562 Back     alignment and structure
>pdb|3UGC|A Chain A, Structural Basis Of Jak2 Inhibition By The Type Ii Inhibtor Nvp-Bbt594 Length = 295 Back     alignment and structure
>pdb|4AQC|A Chain A, Triazolopyridine-Based Inhibitor Of Janus Kinase 2 Length = 301 Back     alignment and structure
>pdb|4E4M|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 30 Length = 302 Back     alignment and structure
>pdb|3LPB|A Chain A, Crystal Structure Of Jak2 Complexed With A Potent 2,8-Diaryl Quinoxaline Inhibitor Length = 295 Back     alignment and structure
>pdb|3T9T|A Chain A, Crystal Structure Of Btk Mutant (F435t,K596r) Complexed With Imidazo[1,5-A]quinoxaline Length = 267 Back     alignment and structure
>pdb|3C7Q|A Chain A, Structure Of Vegfr2 Kinase Domain In Complex With Bibf1120 Length = 316 Back     alignment and structure
>pdb|2WTW|A Chain A, Aurora-A Inhibitor Structure (2nd Crystal Form) Length = 285 Back     alignment and structure
>pdb|3MH2|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|3QBN|A Chain A, Structure Of Human Aurora A In Complex With A Diaminopyrimidine Length = 281 Back     alignment and structure
>pdb|2P2I|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Nicotinamide Inhibitor Length = 314 Back     alignment and structure
>pdb|1VR2|A Chain A, Human Vascular Endothelial Growth Factor Receptor 2 (Kdr) Kinase Domain Length = 316 Back     alignment and structure
>pdb|2BMC|A Chain A, Aurora-2 T287d T288d Complexed With Pha-680632 Length = 306 Back     alignment and structure
>pdb|3IO7|A Chain A, 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Selective Inhibitors Of Jak2 Length = 313 Back     alignment and structure
>pdb|1H6U|A Chain A, Internalin H: Crystal Structure Of Fused N-Terminal Domains Length = 308 Back     alignment and structure
>pdb|3JY9|A Chain A, Janus Kinase 2 Inhibitors Length = 311 Back     alignment and structure
>pdb|2DWB|A Chain A, Aurora-A Kinase Complexed With Amppnp Length = 285 Back     alignment and structure
>pdb|3CJG|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 3,4,5-Trimethoxy Aniline Containing Pyrimidine Length = 309 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|1YWN|A Chain A, Vegfr2 In Complex With A Novel 4-amino-furo[2,3-d]pyrimidine Length = 316 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2F57|A Chain A, Crystal Structure Of The Human P21-activated Kinase 5 Length = 317 Back     alignment and structure
>pdb|3UNZ|A Chain A, Aurora A In Complex With Rpm1679 Length = 279 Back     alignment and structure
>pdb|2XA4|A Chain A, Inhibitors Of Jak2 Kinase Domain Length = 298 Back     alignment and structure
>pdb|2XIR|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With Pf-00337210 (N,2-Dimethyl-6-(7-(2-Morpholinoethoxy) Quinolin-4-Yloxy)benzofuran-3-Carboxamide) Length = 316 Back     alignment and structure
>pdb|3FDN|A Chain A, Structure-Based Drug Design Of Novel Aurora Kinase A Inhibitors: Structure Basis For Potency And Specificity Length = 279 Back     alignment and structure
>pdb|3CJF|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 3,4,5-Trimethoxy Aniline Containing Pyrimidine Length = 309 Back     alignment and structure
>pdb|4F1O|A Chain A, Crystal Structure Of The L1180t Mutant Roco4 Kinase Domain From D. Discoideum Bound To Appcp Length = 287 Back     alignment and structure
>pdb|1OL6|A Chain A, Structure Of Unphosphorylated D274n Mutant Of Aurora-a Length = 282 Back     alignment and structure
>pdb|2C6E|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With A 5-Aminopyrimidinyl Quinazoline Inhibitor Length = 283 Back     alignment and structure
>pdb|4AGC|A Chain A, Crystal Structure Of Vegfr2 (Juxtamembrane And Kinase Domains) In Complex With Axitinib (Ag-013736) (N-Methyl-2-( 3-((E)-2-Pyridin-2-Yl-Vinyl)-1h-Indazol-6-Ylsulfanyl)- Benzamide) Length = 353 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query690
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 3e-65
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 2e-56
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 5e-55
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 9e-37
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 9e-36
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-33
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 8e-32
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 8e-32
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-31
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-25
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-25
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-22
3soc_A322 Activin receptor type-2A; structural genomics cons 1e-35
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-33
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-33
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-31
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-27
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-27
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-26
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-24
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-21
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-21
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-31
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-26
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-23
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 8e-31
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 1e-30
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-30
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-30
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-27
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-24
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-24
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-24
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-15
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 2e-30
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-30
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-29
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-26
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-26
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-24
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-23
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 4e-30
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-29
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-26
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-26
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-24
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 2e-29
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-29
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-28
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-28
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-27
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-22
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-19
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-17
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-16
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 7e-29
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-28
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-24
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-24
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-22
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-22
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-21
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-21
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 4e-28
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-27
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-25
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-25
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-20
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-19
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-19
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-17
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-15
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-11
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-27
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-25
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-22
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-20
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-18
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-17
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-15
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 4e-27
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-27
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-26
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-26
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-24
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-24
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-24
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-14
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 3e-26
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 4e-26
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-26
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-22
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-22
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-21
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-15
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-25
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-11
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-07
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 8e-25
3q4u_A301 Activin receptor type-1; structural genomics conso 1e-24
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-24
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-24
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-22
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-21
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-10
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-06
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 4e-24
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-23
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-23
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-22
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-16
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-23
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-22
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-20
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-23
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-20
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-20
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-07
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 3e-23
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-22
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-22
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-20
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-19
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-19
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-14
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-22
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-20
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-20
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-20
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-22
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-20
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-21
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-19
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-18
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-13
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 3e-21
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-21
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-20
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-18
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 3e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-21
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-18
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-20
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-18
3v5q_A297 NT-3 growth factor receptor; kinase domain, kinase 4e-21
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-21
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-15
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-14
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-12
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-06
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 1e-20
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-20
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-19
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-18
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 6e-20
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 8e-20
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 1e-19
3zzw_A289 Tyrosine-protein kinase transmembrane receptor RO; 1e-19
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 1e-19
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-14
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-08
4aoj_A329 High affinity nerve growth factor receptor; transf 3e-19
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 5e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-19
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-18
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 6e-19
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 8e-19
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-19
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-16
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-16
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-14
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-04
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 1e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-10
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 1e-18
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-18
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-18
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-17
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-14
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-13
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-10
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-05
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 3e-18
2xir_A316 Vascular endothelial growth factor receptor 2; ang 4e-18
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 4e-18
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 5e-18
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-18
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-17
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-08
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 8e-18
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 8e-18
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 9e-18
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 1e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-17
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-15
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-13
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 2e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-17
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 2e-17
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 2e-17
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 3e-17
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-17
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-14
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-12
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-11
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-07
3lzb_A327 Epidermal growth factor receptor; epidermal growth 3e-17
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 3e-17
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 4e-17
3pls_A298 Macrophage-stimulating protein receptor; protein k 1e-16
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 1e-16
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 1e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-15
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 2e-16
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 2e-16
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-16
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 9e-14
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-12
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 3e-16
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 3e-16
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 6e-16
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-16
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-14
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 8e-11
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 7e-16
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 7e-16
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 1e-15
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 1e-15
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 2e-15
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 2e-15
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-15
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-14
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-13
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-12
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 3e-15
3poz_A327 Epidermal growth factor receptor; kinase domain, a 3e-15
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 5e-15
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 9e-15
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 1e-14
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 1e-14
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-14
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-11
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-10
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-10
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-06
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 2e-14
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-14
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 9e-08
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 2e-14
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 4e-14
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-14
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-06
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 1e-13
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 1e-13
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 2e-13
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 3e-13
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-12
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-11
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-04
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 3e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-08
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 4e-12
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 9e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-11
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-07
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 3e-11
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-11
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-08
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 5e-11
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 6e-11
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-11
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-10
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-09
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-10
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-10
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-04
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 6e-10
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 6e-10
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 6e-10
3uqc_A286 Probable conserved transmembrane protein; structur 6e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-06
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 4e-09
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 4e-09
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 1e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 4e-08
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 4e-08
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 2e-07
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 2e-07
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 2e-07
4apc_A350 Serine/threonine-protein kinase NEK1; transferase; 3e-07
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 4e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-06
2eue_A275 Carbon catabolite derepressing protein kinase; kin 7e-07
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 7e-07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 8e-07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 8e-05
2a19_B284 Interferon-induced, double-stranded RNA-activated 9e-07
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 9e-07
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 1e-06
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 1e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-06
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 2e-06
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 2e-06
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 3e-06
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 4e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 4e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 8e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-06
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 4e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-06
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 5e-06
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 6e-06
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 7e-06
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 9e-06
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 1e-05
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 1e-05
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 1e-05
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 1e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-05
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 2e-05
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 2e-05
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 2e-05
3ork_A311 Serine/threonine protein kinase; structural genomi 2e-05
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 2e-05
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 3e-05
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 3e-05
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 4e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 4e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-04
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 4e-05
3eqc_A360 Dual specificity mitogen-activated protein kinase; 6e-05
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 6e-05
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 1e-04
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 1e-04
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 2e-04
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 2e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-04
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 5e-04
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 6e-04
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 Back     alignment and structure
 Score =  217 bits (556), Expect = 3e-65
 Identities = 88/325 (27%), Positives = 139/325 (42%), Gaps = 79/325 (24%)

Query: 398 TFKDLIAATSHFGKESLLAEGRCGPVYRAVLPGELHVAIKVLDNAKGIDHDDA----VAM 453
           + ++L  A+ +F  +++L  G  G VY+  L     VA+K L   +    +      V M
Sbjct: 21  SLRELQVASDNFSNKNILGRGGFGKVYKGRLADGTLVAVKRLKEERTQGGELQFQTEVEM 80

Query: 454 FDELSRLKHPNLLPLAGYCIAGKEKLVLLEFMANGDLHRWLHELPTGEPNVEDWSTDTWD 513
              +S   H NLL L G+C+   E+L++  +MANG +   L E P  +P +         
Sbjct: 81  ---ISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASCLRERPESQPPL--------- 128

Query: 514 HHPGAGSHISSPEKTNWVTRHRIAIGVARGLAYLHHVGSTHGHLV-----TSSILLAESL 568
                          +W  R RIA+G ARGLAYLH        ++      ++ILL E  
Sbjct: 129 ---------------DWPKRQRIALGSARGLAYLHD--HCDPKIIHRDVKAANILLDEEF 171

Query: 569 EPKIAGFGLRNIGVKNVGERSENET------------CGPE----------SDVYCFGVI 606
           E  +  FGL  +           +T              PE          +DV+ +GV+
Sbjct: 172 EAVVGDFGLAKLM-------DYKDTHVTTAVRGTIGHIAPEYLSTGKSSEKTDVFGYGVM 224

Query: 607 LMELLTGKRGTDDC----------VKWVRKLVKEGAGGDALDFRLKLGSGDSVAEMVESL 656
           L+EL+TG+R  D            + WV+ L+KE      +D    L       E+ + +
Sbjct: 225 LLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKLEALVDVD--LQGNYKDEEVEQLI 282

Query: 657 RVGYLCTADSPGKRPTMQQVLGLLK 681
           +V  LCT  SP +RP M +V+ +L+
Sbjct: 283 QVALLCTQSSPMERPKMSEVVRMLE 307


>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Length = 286 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Length = 309 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Length = 336 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Length = 324 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 690
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 4e-39
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 2e-35
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 1e-34
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 2e-34
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 8e-33
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 8e-33
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 2e-32
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 2e-32
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 4e-31
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 1e-30
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 1e-30
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 3e-30
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 6e-30
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 6e-30
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 8e-30
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 1e-29
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 9e-29
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 1e-28
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 1e-28
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 2e-28
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 4e-28
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 5e-28
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 9e-28
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 9e-28
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 1e-27
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 6e-27
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 7e-27
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 9e-25
d1xkka_317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 4e-24
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 8e-24
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 1e-23
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 1e-23
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 4e-23
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 8e-23
d1omwa3364 d.144.1.7 (A:186-549) G-protein coupled receptor k 1e-22
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-22
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-05
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 1e-21
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 7e-21
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 2e-20
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 1e-19
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 2e-19
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 5e-19
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 2e-18
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 4e-18
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 8e-18
d1q5ka_350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 3e-17
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 8e-17
d1pmea_345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 2e-16
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 3e-16
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 4e-16
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 6e-16
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 2e-15
d1ua2a_299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 3e-15
d1o6la_337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 3e-15
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-15
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 3e-09
d3blha1318 d.144.1.7 (A:8-325) Cell division protein kinase 9 9e-15
d1unla_292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 2e-14
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 3e-14
d1cm8a_346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 3e-14
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 4e-13
d3bqca1328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 3e-12
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 7e-12
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.001
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-05
d2gfsa1348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 5e-11
d1q8ya_362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 6e-11
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 9e-10
d2b1pa1355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 7e-09
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 3e-08
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 1e-05
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.003
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 6e-08
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.003
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 7e-08
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.003
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 8e-08
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-07
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.001
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.002
d1zara2191 d.144.1.9 (A:91-281) Rio2 serine protein kinase C- 2e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 0.002
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 5e-05
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 2e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 8e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-04
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: B-Raf kinase
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  143 bits (362), Expect = 4e-39
 Identities = 69/304 (22%), Positives = 107/304 (35%), Gaps = 62/304 (20%)

Query: 407 SHFGKESLLAEGRCGPVYRAVLPGELHVAIKVLDNAKGIDHDDAVAMFDE---LSRLKHP 463
                   +  G  G VY+    G+  VA+K+L N          A  +E   L + +H 
Sbjct: 8   GQITVGQRIGSGSFGTVYKGKWHGD--VAVKML-NVTAPTPQQLQAFKNEVGVLRKTRHV 64

Query: 464 NLLPLAGYCIAGKEKLVLLEFMANGDLHRWLHELPTGEPNVEDWSTDTWDHHPGAGSHIS 523
           N+L   GY  A +  +V  ++     L+  LH + T                        
Sbjct: 65  NILLFMGYSTAPQLAIVT-QWCEGSSLYHHLHIIET------------------------ 99

Query: 524 SPEKTNWVTRHRIAIGVARGLAYLHHVGSTHGHLVTSSILLAESLEPKIAGFGLRNIGVK 583
              K   +    IA   A+G+ YLH     H  L +++I L E L  KI  FGL  +  +
Sbjct: 100 ---KFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSR 156

Query: 584 NVGERSENETCG------PE-------------SDVYCFGVILMELLTGKR--GTDDCVK 622
             G     +  G      PE             SDVY FG++L EL+TG+      +   
Sbjct: 157 WSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRD 216

Query: 623 WVRKLVKEGAGGDALDFRLKLGSGDSVAEMVESLRVGYLCTADSPGKRPTMQQVLGLLKD 682
            +  +V  G     L   L     +    M   +     C      +RP   Q+L  ++ 
Sbjct: 217 QIIFMVGRG----YLSPDLSKVRSNCPKAMKRLMA---ECLKKKRDERPLFPQILASIEL 269

Query: 683 IRPS 686
           +  S
Sbjct: 270 LARS 273


>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query690
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 100.0
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 100.0
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 100.0
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 100.0
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 100.0
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 100.0
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 100.0
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 100.0
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 100.0
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 100.0
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 100.0
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 100.0
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 100.0
d1s9ja_322 Dual specificity mitogen-activated protein kinase 100.0
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 100.0
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 100.0
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 100.0
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 100.0
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 100.0
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 100.0
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 100.0
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 100.0
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 100.0
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 100.0
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 100.0
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 100.0
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 100.0
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 100.0
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 100.0
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 100.0
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 100.0
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 100.0
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 100.0
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 100.0
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 100.0
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 100.0
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 100.0
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 100.0
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 100.0
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 100.0
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 100.0
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 100.0
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 100.0
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 100.0
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 100.0
d1pmea_345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 100.0
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 100.0
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 100.0
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 100.0
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 100.0
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 100.0
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 100.0
d2gfsa1348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 100.0
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 100.0
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 100.0
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 100.0
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 100.0
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 100.0
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.94
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.94
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 99.93
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.93
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.92
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.9
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.9
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.9
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.87
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.86
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.86
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.85
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.85
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.84
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.83
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.82
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.81
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.76
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.74
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.62
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.61
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.6
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.59
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.58
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.58
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.47
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.45
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.44
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.33
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.33
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.27
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.27
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.15
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.81
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.77
d1j7la_263 Type IIIa 3',5"-aminoglycoside phosphotransferase 98.72
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.35
d1nd4a_255 Aminoglycoside 3'-phosphotransferase IIa (Kanamyci 98.32
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.2
d2pula1392 Methylthioribose kinase MtnK {Bacillus subtilis [T 98.0
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.82
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.75
d1zyla1325 RdoA {Escherichia coli [TaxId: 562]} 97.54
d1nw1a_395 Choline kinase {Caenorhabditis elegans [TaxId: 623 97.42
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.94
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.85
d2ppqa1316 Homoserine kinase ThrB {Agrobacterium tumefaciens 94.84
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: ephb2 receptor tyrosine kinase
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=100.00  E-value=0  Score=361.02  Aligned_cols=253  Identities=23%  Similarity=0.371  Sum_probs=196.6

Q ss_pred             CCHHHHHHHHCCC---------CCCCEECCCCCCCEEEEECCC-C---CEEEEEEEECCCC-CCHHHHHHHHHHHHHCCC
Q ss_conf             4988899995067---------987600457972289998399-9---3799999304689-997899999999872589
Q 005572          397 LTFKDLIAATSHF---------GKESLLAEGRCGPVYRAVLPG-E---LHVAIKVLDNAKG-IDHDDAVAMFDELSRLKH  462 (690)
Q Consensus       397 ~~~~~~~~~~~~~---------~~~~~ig~G~~g~V~~~~~~~-~---~~vavK~~~~~~~-~~~~~~~~e~~~l~~l~H  462 (690)
                      ++++++..++.+|         ...+.||+|+||.||+|+... +   ..||||.+..... ...+++.+|+++|++++|
T Consensus         7 ~t~~d~~~a~~~f~~~i~~~~~~~~~~lG~G~fg~Vy~~~~~~~~~~~~~vavK~~~~~~~~~~~~~~~~E~~~l~~l~H   86 (299)
T d1jpaa_           7 FTFEDPNEAVREFAKEIDISCVKIEQVIGAGEFGEVCSGHLKLPGKREIFVAIKTLKSGYTEKQRRDFLSEASIMGQFDH   86 (299)
T ss_dssp             GGSSSHHHHHHHHSCBCCGGGEEEEEEEEECSSSEEEEEEECC---CCEEEEEEECCSSCCHHHHHHHHHHHHHHTTCCC
T ss_pred             CCHHHHHHHHHHHCHHHCHHHCEEEEEEEECCCEEEEEEEEECCCCEEEEEEEEEECCCCCHHHHHHHHHHHHHHHHCCC
T ss_conf             88798999996046220800427856980278829999999579978899999997844598999999999999985799


Q ss_pred             CCCCCEEEEEECCCEEEEEEEECCCCCHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             98101212896398148999715899776653008999999777888877899999977789998997899999999998
Q 005572          463 PNLLPLAGYCIAGKEKLVLLEFMANGDLHRWLHELPTGEPNVEDWSTDTWDHHPGAGSHISSPEKTNWVTRHRIAIGVAR  542 (690)
Q Consensus       463 ~niv~l~g~~~~~~~~~lv~e~~~~gsL~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~i~~~ia~  542 (690)
                      ||||+++|+|.+.+..++|||||++|+|.+++..                           ....++|.+++.++.|+|.
T Consensus        87 pnIv~l~g~~~~~~~~~iv~Ey~~~g~L~~~~~~---------------------------~~~~l~~~~~~~i~~qia~  139 (299)
T d1jpaa_          87 PNVIHLEGVVTKSTPVMIITEFMENGSLDSFLRQ---------------------------NDGQFTVIQLVGMLRGIAA  139 (299)
T ss_dssp             TTBCCEEEEECSSSSCEEEEECCTTEEHHHHHHT---------------------------TTTCSCHHHHHHHHHHHHH
T ss_pred             CCCCCEEEEEEECCEEEEEEEECCCCCCEEEECC---------------------------CCCCCCHHHHHHHHHHHHH
T ss_conf             8886189999628877999972279853002104---------------------------5679999999999999999


Q ss_pred             HHHHHHHCCCCCCCCCCCCEEECCCCCCEECCCCCCCCCCC-------------------CCCCCCCCCCCCCCCCCHHH
Q ss_conf             88764306988878777847855999926747776554345-------------------66765688899987753236
Q 005572          543 GLAYLHHVGSTHGHLVTSSILLAESLEPKIAGFGLRNIGVK-------------------NVGERSENETCGPESDVYCF  603 (690)
Q Consensus       543 ~l~yLH~~~~~H~dlk~~Nill~~~~~~ki~dfGl~~~~~~-------------------~~~e~~~~~~~~~~~DVwSf  603 (690)
                      ||.|||+++++||||||+|||++.++.+||+|||+++....                   .+||......++.++|||||
T Consensus       140 gl~yLH~~~iiHrDlKp~NILl~~~~~~Kl~DFGla~~~~~~~~~~~~~~~~~~~~t~~y~aPE~~~~~~~~~~sDvwS~  219 (299)
T d1jpaa_         140 GMKYLADMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSASDVWSY  219 (299)
T ss_dssp             HHHHHHHTTCCCSCCCGGGEEECTTCCEEECCC-----------------------CGGGSCHHHHHSCCCCHHHHHHHH
T ss_pred             HHHHHHHCCCCCCCCCCCEEEECCCCCEEECCCCCCEECCCCCCCCEEEECCCCCCCCCCCCHHHHHCCCCCCCCCCCCC
T ss_conf             88988527983576150448988999199888443157567777653650256668830038788836997861214453


Q ss_pred             HHHHHHHHH-CCCCCCCHHH-HHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHH
Q ss_conf             899999984-8999973489-99999993689975430111699998999999999983301899999999999999972
Q 005572          604 GVILMELLT-GKRGTDDCVK-WVRKLVKEGAGGDALDFRLKLGSGDSVAEMVESLRVGYLCTADSPGKRPTMQQVLGLLK  681 (690)
Q Consensus       604 Gvil~el~t-g~~p~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~C~~~dP~~RPs~~~i~~~L~  681 (690)
                      ||++|||+| |+.||.+... .....+..+..     +..+..++   .   .+.+++.+||+.||++||||.+|++.|+
T Consensus       220 Gvvl~el~t~g~~Pf~~~~~~~~~~~i~~~~~-----~~~~~~~~---~---~l~~li~~cl~~~P~~RPs~~ei~~~L~  288 (299)
T d1jpaa_         220 GIVMWEVMSYGERPYWDMTNQDVINAIEQDYR-----LPPPMDCP---S---ALHQLMLDCWQKDRNHRPKFGQIVNTLD  288 (299)
T ss_dssp             HHHHHHHHTTSCCTTTTCCHHHHHHHHHTTCC-----CCCCTTCC---H---HHHHHHHHHTCSSTTTSCCHHHHHHHHH
T ss_pred             HHHHHHHHHCCCCCCCCCCHHHHHHHHHCCCC-----CCCCCCCH---H---HHHHHHHHHCCCCHHHCCCHHHHHHHHH
T ss_conf             57899998679999999999999999973788-----99974226---9---9999999975879768929999999999


Q ss_pred             CCCCCC
Q ss_conf             128999
Q 005572          682 DIRPSA  687 (690)
Q Consensus       682 ~i~~~~  687 (690)
                      .+.+.+
T Consensus       289 ~~l~~p  294 (299)
T d1jpaa_         289 KMIRNP  294 (299)
T ss_dssp             HHHHSG
T ss_pred             HHHCCH
T ss_conf             984186



>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pula1 d.144.1.6 (A:5-396) Methylthioribose kinase MtnK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1zyla1 d.144.1.6 (A:4-328) RdoA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nw1a_ d.144.1.8 (A:) Choline kinase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2ppqa1 d.144.1.6 (A:5-320) Homoserine kinase ThrB {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure