Citrus Sinensis ID: 005592

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------69
MAGPTMISKVKAYWAPLILFGLGLFYQLVVLPRSFPPSHYDALGIKPYSSVEQVKEAYEKFSSKWNSGEEIPSTADFLKIQYAYELLTDPLWKRNYDVYGIDEQLHILEKVREQYGEESYSRIDLPLLDATDHSVHAFNVVTSEDFPSIFHDSKPWLIQVYSDGSYLCGQFSGAWKTIAALLEGIANTGMVELGDIRLATHLAERKPIGQIFFRRGLPSLVAFPPGCKSSDCMTRFEGELSVDAVTDWFATAILKLPRIFYYTKESMGKNFLAKTGPHKVKVIFFSKTGERASPFVRQISRNYWAYASFAFVLWREEESSIWWNTFEVESAPAIVFLKDPGVKPVVYYGSFNNSRLSEVMEQNKLQELPQLRSVTSMELGCDARGYSRAGSDTTIWYCVILAGRLSPELNKMRETIRRVQETLLSDDESNAADTDQSLAPAAVAFRNKRLTFAWLDGEAQDRYCSFYLFSETSFETCGARRDMSDVPRLFIVRYKRNTTEDEAKIERKPRNIWDAMQEQEVDPASQLVVRYNGSDEIPQIAKWVSEIIQDGDSKDLPFYRAKTPELVPEDSEPLLTRSAQSLFSKSIGMKQRIRNIMGQCYDYLGDPRIGPALLLAALMSFGTIWLMRGQQRAHPSQSGQPGPSANEDENRPARRKRAKQGSNEGRPPSITDEEPKDAYQMPLLDSDSD
cccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccHHHHHHHccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccHHHHHHHHHHHHHccEEEEEEEEccHHHHHHHHHccccccccccccccEEEEEccccccccccccccccccHHHHHHHHHHHHcccccEEEEccccccHHHccccccccEEEEEEEcccccccHHHHHHHHHHcccEEEEEEEccccccHHHHHccccccccEEEEEccccccEEEEcccccHHHHHHHHHHHHHccccccccHHHHHHcccccccccccccccEEEEEEEcccccHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHccccEEEEEEEEccccHHHHHHHHccccccccccccccccccccEEEEEEEccccccccEEEEccccccccccccccccHHHHHHHccccccHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccHHHHHHHHHcccccccccccccccccccccccccccccccccccHccccEEccHHHHHHHccccccEEEEEEccccHHHHHHHHHHHHHHHHHcccEEEEEEEccccEEEEcHHHHHHHHHHcccccccEEEEEEccccccccEEEEcccccHHHHHHHHHHHccccccEEEEccHcHHHHHHccccccccEEEEEcccccccHHHHHHHHHHHHHHcEEEEEEcccHHHHHHHHHcccccccEEEEEcccccccEEEEccccHHHHHHHHHHcccccccccccHHHHHHccccccccccccccEEEEEEEEEccccccHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHccccEEEEEEEccHHHHHHHHHHccccccHHHcccccccccccEEEEEEEEccccHHHccccEccccHHHHHHHcccccHHHHEcccccHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHEHHHHccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccc
MAGPTMISKVKAYWAPLILFGLGLFYQlvvlprsfppshydalgikpyssVEQVKEAYEKFSSkwnsgeeipstaDFLKIQYAYELLTdplwkrnydvygidEQLHILEKVREQygeesysridlplldatdhsvhafnvvtsedfpsifhdskpwliqvysdgsylcgqfSGAWKTIAALLEGIANTGMVELGDIRLATHlaerkpigqiffrrglpslvafppgckssdcmtrfegelSVDAVTDWFATAILKLPRIFyytkesmgknflaktgphKVKVIFFSktgeraspFVRQISRNYWAYASFAFVLWREEESSIWWNtfevesapaivflkdpgvkpvvyygsfnnsrlSEVMEQNKlqelpqlrsvtsmelgcdargysragsdttIWYCVILAGRLSPELNKMRETIRRVQETLlsddesnaadtdqslaPAAVAFRNKRLTfawldgeaqdrycsfylfsetsfetcgarrdmsdvpRLFIVRYKrnttedeakierkprNIWDamqeqevdpasqlvvryngsdeipQIAKWVSEIiqdgdskdlpfyraktpelvpedseplltRSAQSLFSKSIGMKQRIRNIMGQcydylgdpriGPALLLAALMSFGTIWLMrgqqrahpsqsgqpgpsanedenrparrkrakqgsnegrppsitdeepkdayqmplldsdsd
MAGPTMISKVKAYWAPLILFGLGLFYQLVVLPRSFPPSHYDALGIKPYSSVEQVKEAYEKFSskwnsgeeIPSTADFLKIQYAYELLTDPLWKRNYDVYGIDEQLHILEKVREQYGEESYSRIDLPLLDATDHSVHAFNVVTSEDFPSIFHDSKPWLIQVYSDGSYLCGQFSGAWKTIAALLEGIANTGMVELGDIRLATHLAERKPIGQIFFRRGLPSLVAFPPGCKSSDCMTRFEGELSVDAVTDWFATAILKLPRIFYYTKESMGKnflaktgpHKVKVIFFsktgeraspfVRQISRNYWAYASFAFVLWREEESSIWWNTFEVESAPAIVFLKDPGVKPVVYYGSFNNSRLSEVMEQNKLQELPQLRSVTSMELGCDARgysragsdttIWYCVILAGrlspelnkMRETIRRVQETLLSDDESNAADTDQSLAPAAVAFRNKRLTFAWLDGEAQDRYCSFYLFSETsfetcgarrdmsdvprLFIVrykrnttedeakierkprniwdamqeqevdpaSQLVVRYNGSDEIPQIAKWVSEIIQDGDSKDLPFYRAKTpelvpedsepllTRSAQSLFSKSIGMKQRIRNIMGQCYDYLGDPRIGPALLLAALMSFGTIWLMRGQQRAhpsqsgqpgpsanedenrparrkrakqgsnegrppsitdeepkdayqmplldsdsd
MAGPTMISKVKAYWAPLILFGLGLFYQLVVLPRSFPPSHYDALGIKPYSSVEQVKEAYEKFSSKWNSGEEIPSTADFLKIQYAYELLTDPLWKRNYDVYGIDEQLHILEKVREQYGEESYSRIDLPLLDATDHSVHAFNVVTSEDFPSIFHDSKPWLIQVYSDGSYLCGQFSGAWKTIAALLEGIANTGMVELGDIRLATHLAERKPIGQIFFRRGLPSLVAFPPGCKSSDCMTRFEGELSVDAVTDWFATAILKLPRIFYYTKESMGKNFLAKTGPHKVKVIFFSKTGERASPFVRQISRNYWAYASFAFVLWREEESSIWWNTFEVESAPAIVFLKDPGVKPVVYYGSFNNSRLSEVMEQNKLQELPQLRSVTSMELGCDARGYSRAGSDTTIWYCVILAGRLSPELNKMRETIRRVQETLLSDDESNAADTDQSLAPAAVAFRNKRLTFAWLDGEAQDRYCSFYLFSETSFETCGARRDMSDVPRLFIVRYKRNTTEDEAKIERKPRNIWDAMQEQEVDPASQLVVRYNGSDEIPQIAKWVSEIIQDGDSKDLPFYRAKTPELVPEDSEPLLTRSAQSLFSKSIGMKQRIRNIMGQCYDYLGDPRIGPALLLAALMSFGTIWLMRGQQRAHPSQSGQPGPSANEDENRPARRKRAKQGSNEGRPPSITDEEPKDAYQMPLLDSDSD
******ISKVKAYWAPLILFGLGLFYQLVVLPRSFPPSHYDALGIKPYSSVEQVKEAYEKFSSKWNSGEEIPSTADFLKIQYAYELLTDPLWKRNYDVYGIDEQLHILEKVREQYGEESYSRIDLPLLDATDHSVHAFNVVTSEDFPSIFHDSKPWLIQVYSDGSYLCGQFSGAWKTIAALLEGIANTGMVELGDIRLATHLAERKPIGQIFFRRGLPSLVAFPPGCKSSDCMTRFEGELSVDAVTDWFATAILKLPRIFYYTKESMGKNFLAKTGPHKVKVIFFSKTGERASPFVRQISRNYWAYASFAFVLWREEESSIWWNTFEVESAPAIVFLKDPGVKPVVYYGSFNNS**********************MELGCDARGYSRAGSDTTIWYCVILAGRLSP*********************************AAVAFRNKRLTFAWLDGEAQDRYCSFYLFSETSFETCGARRDMSDVPRLFIVRYKR*****************************QLVVRYNGSDEIPQIAKWVSEIIQDGD***LPFY**************************SIGMKQRIRNIMGQCYDYLGDPRIGPALLLAALMSFGTIWLMR*************************************************************
************YWAPLILFGLGLFYQLVVLPRSFPPSHYDALGIKPYSSVEQVKEAYEKFSSKWNSGEEIPSTADFLKIQYAYELLTDPLWKRNYDVYGIDE****************YSRIDLPLLDATDHSVHAFNVVTSEDFPSIFHDSKPWLIQVYSDGSYLCGQFSGAWKTIAALLEGIANTGMVELGDIRLATHLAERKPIGQIFFRRGLPSLVAFPPGCKSSDCMTRFEGELSVDAVTDWFATAILKLPRIFYYTKESMGKNFLAKTGPHKVKVIFFSKTGERASPFVRQISRNYWAYASFAFVLWREEESSIWWNTFEVESAPAIVFLKDPGVKPVVYYGSFNNSRLSEVMEQNKLQELP*********************SDTTIWYCVILAGRLS*******ETIRRVQETLLSDDE****D*DQSLAPAAVAFRNKRLTFAWLDGEAQDRYCSFYLFSETS*********MSDVPRLFIVRYKRNTTEDEAKIERKPRNIWDAMQEQEVDPASQLVVRYNGSDEIPQIAKWVSEIIQDGDSKDLPFYRAKTPELVPEDSEPLLTRSAQSLFSKSIGMKQRIRNIMGQCYDYLGDPRIGPALLLAALMSFGTIWL********************************************************L******
MAGPTMISKVKAYWAPLILFGLGLFYQLVVLPRSFPPSHYDALGIKPYSSVEQVKEAYEKFSSKWNSGEEIPSTADFLKIQYAYELLTDPLWKRNYDVYGIDEQLHILEKVREQYGEESYSRIDLPLLDATDHSVHAFNVVTSEDFPSIFHDSKPWLIQVYSDGSYLCGQFSGAWKTIAALLEGIANTGMVELGDIRLATHLAERKPIGQIFFRRGLPSLVAFPPGCKSSDCMTRFEGELSVDAVTDWFATAILKLPRIFYYTKESMGKNFLAKTGPHKVKVIFFSKTGERASPFVRQISRNYWAYASFAFVLWREEESSIWWNTFEVESAPAIVFLKDPGVKPVVYYGSFNNSRLSEVMEQNKLQELPQLRSVTSMELGCDARGYSRAGSDTTIWYCVILAGRLSPELNKMRETIRRVQETLLSDDESNAADTDQSLAPAAVAFRNKRLTFAWLDGEAQDRYCSFYLFSETSFETCGARRDMSDVPRLFIVRYKRNTTEDEAKIERKPRNIWDAMQEQEVDPASQLVVRYNGSDEIPQIAKWVSEIIQDGDSKDLPFYRAKTPELVPEDSEPLLTRSAQSLFSKSIGMKQRIRNIMGQCYDYLGDPRIGPALLLAALMSFGTIWLMRG****************************************ITDEEPKDAYQMPLLDSDSD
****TMISKVKAYWAPLILFGLGLFYQLVVLPRSFPPSHYDALGIKPYSSVEQVKEAYEKFSSKWNSGEEIPSTADFLKIQYAYELLTDPLWKRNYDVYGIDEQLHILEKVREQYGEESYSRIDLPLLDATDHSVHAFNVVTSEDFPSIFHDSKPWLIQVYSDGSYLCGQFSGAWKTIAALLEGIANTGMVELGDIRLATHLAERKPIGQIFFRRGLPSLVAFPPGCKSSDCMTRFEGELSVDAVTDWFATAILKLPRIFYYTKESMGKNFLAKTGPHKVKVIFFSKTGERASPFVRQISRNYWAYASFAFVLWREEESSIWWNTFEVESAPAIVFLKDPGVKPVVYYGSFNNSRLSEVMEQNKLQELPQLRSVTSMELGCDARGYSRAGSDTTIWYCVILAGRLSPELNKMRETIRRVQETLLSDDESNAADTDQSLAPAAVAFRNKRLTFAWLDGEAQDRYCSFYLFSETSFETCGARRDMSDVPRLFIVRYKRNTTEDEAKIERKPRNIWDAMQEQEVDPASQLVVRYNGSDEIPQIAKWVSEIIQDGDSKDLPFYRAKTPELVPEDSEPLLTRSAQSLFSKSIGMKQRIRNIMGQCYDYLGDPRIGPALLLAALMSFGTIWLMRG***************************************SITDEEPKDAY**P*******
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGPTMISKVKAYWAPLILFGLGLFYQLVVLPRSFPPSHYDALGIKPYSSVEQVKEAYEKFSSKWNSGEEIPSTADFLKIQYAYELLTDPLWKRNYDVYGIDEQLHILEKVREQYGEESYSRIDLPLLDATDHSVHAFNVVTSEDFPSIFHDSKPWLIQVYSDGSYLCGQFSGAWKTIAALLEGIANTGMVELGDIRLATHLAERKPIGQIFFRRGLPSLVAFPPGCKSSDCMTRFEGELSVDAVTDWFATAILKLPRIFYYTKESMGKNFLAKTGPHKVKVIFFSKTGERASPFVRQISRNYWAYASFAFVLWREEESSIWWNTFEVESAPAIVFLKDPGVKPVVYYGSFNNSRLSEVMEQNKLQELPQLRSVTSMELGCDARGYSRAGSDTTIWYCVILAGRLSPELNKMRETIRRVQETLLSDDESNAADTDQSLAPAAVAFRNKRLTFAWLDGEAQDRYCSFYLFSETSFETCGARRDMSDVPRLFIVRYKRNTTEDEAKIERKPRNIWDAMQEQEVDPASQLVVRYNGSDEIPQIAKWVSEIIQDGDSKDLPFYRAKTPELVPEDSEPLLTRSAQSLFSKSIGMKQRIRNIMGQCYDYLGDPRIGPALLLAALMSFGTIWLMRGQQRAHPSQSGQPGPSANEDENRPARRKRAKQGSNEGRPPSITDEEPKDAYQMPLLDSDSD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query689 2.2.26 [Sep-21-2011]
Q498R3 793 DnaJ homolog subfamily C yes no 0.251 0.218 0.252 2e-10
Q9DC23 793 DnaJ homolog subfamily C yes no 0.251 0.218 0.252 2e-10
Q8IXB1 793 DnaJ homolog subfamily C yes no 0.246 0.214 0.251 7e-10
Q6NRT6 796 DnaJ homolog subfamily C N/A no 0.216 0.187 0.269 2e-09
Q5R5L3 793 DnaJ homolog subfamily C yes no 0.246 0.214 0.245 2e-09
Q5FVM7 771 DnaJ homolog subfamily C no no 0.518 0.463 0.244 6e-09
Q80TN4 772 DnaJ homolog subfamily C no no 0.518 0.462 0.241 7e-09
Q5RCM7 782 DnaJ homolog subfamily C no no 0.574 0.506 0.244 6e-08
Q5ZKZ4777 DnaJ homolog subfamily C no no 0.229 0.203 0.282 4e-07
Q9Y2G8782 DnaJ homolog subfamily C no no 0.269 0.237 0.272 6e-07
>sp|Q498R3|DJC10_RAT DnaJ homolog subfamily C member 10 OS=Rattus norvegicus GN=Dnajc10 PE=2 SV=2 Back     alignment and function desciption
 Score = 68.2 bits (165), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 84/186 (45%), Gaps = 13/186 (6%)

Query: 40  YDALGIKPYSSVEQVKEAYEKFSSKWNSGEEIPST----ADFLKIQYAYELLTDPLWKRN 95
           Y  LG+   +S  ++++A++K + K +  +  P+      DFLKI  AYE+L D   ++ 
Sbjct: 37  YSLLGVSKTASSREIRQAFKKLALKLHPDKN-PNNPNAHGDFLKINRAYEVLKDEDLRKK 95

Query: 96  YDVYGIDEQLHILEKVREQYGEESYSRIDLPLLDATDHSVHAFNVVTSEDFPSIFHDSKP 155
           YD YG   +  + +    QY   SY R D  + D     +     +   +F +  +  + 
Sbjct: 96  YDKYG---EKGLEDNQGGQYESWSYYRYDFGIYDDDPEII----TLERREFDAAVNSGEL 148

Query: 156 WLIQVYSDGSYLCGQFSGAWKTIAALLEGIANTGMVELGDIRLATHLAERKPIGQIF-FR 214
           W +  YS G   C   +  W+  A  ++G+   G V  GD R+   +        +F FR
Sbjct: 149 WFVNFYSPGCSHCHDLAPTWREFAKEVDGLLRIGAVNCGDDRMLCRMKGVNSYPSLFIFR 208

Query: 215 RGLPSL 220
            G+ ++
Sbjct: 209 SGMAAV 214
This endoplasmic reticulum co-chaperone may play a role in protein folding and translocation across the endoplasmic reticulum membrane. May be involved in disulfide formation. May act as a co-chaperone for Hspa5.
Rattus norvegicus (taxid: 10116)
>sp|Q9DC23|DJC10_MOUSE DnaJ homolog subfamily C member 10 OS=Mus musculus GN=Dnajc10 PE=1 SV=2 Back     alignment and function description
>sp|Q8IXB1|DJC10_HUMAN DnaJ homolog subfamily C member 10 OS=Homo sapiens GN=DNAJC10 PE=1 SV=2 Back     alignment and function description
>sp|Q6NRT6|DJC10_XENLA DnaJ homolog subfamily C member 10 OS=Xenopus laevis GN=dnajc10 PE=2 SV=1 Back     alignment and function description
>sp|Q5R5L3|DJC10_PONAB DnaJ homolog subfamily C member 10 OS=Pongo abelii GN=DNAJC10 PE=2 SV=1 Back     alignment and function description
>sp|Q5FVM7|DJC16_RAT DnaJ homolog subfamily C member 16 OS=Rattus norvegicus GN=Dnajc16 PE=2 SV=1 Back     alignment and function description
>sp|Q80TN4|DJC16_MOUSE DnaJ homolog subfamily C member 16 OS=Mus musculus GN=Dnajc16 PE=1 SV=2 Back     alignment and function description
>sp|Q5RCM7|DJC16_PONAB DnaJ homolog subfamily C member 16 OS=Pongo abelii GN=DNAJC16 PE=2 SV=1 Back     alignment and function description
>sp|Q5ZKZ4|DJC16_CHICK DnaJ homolog subfamily C member 16 OS=Gallus gallus GN=DNAJC16 PE=2 SV=1 Back     alignment and function description
>sp|Q9Y2G8|DJC16_HUMAN DnaJ homolog subfamily C member 16 OS=Homo sapiens GN=DNAJC16 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query689
359491697685 PREDICTED: uncharacterized protein LOC10 0.991 0.997 0.660 0.0
297733956698 unnamed protein product [Vitis vinifera] 0.985 0.972 0.661 0.0
255547351682 heat shock protein binding protein, puta 0.984 0.994 0.660 0.0
224127416695 predicted protein [Populus trichocarpa] 0.995 0.987 0.658 0.0
449440808704 PREDICTED: uncharacterized protein LOC10 0.991 0.970 0.594 0.0
22329659700 DNAJ heat shock N-terminal domain-contai 0.989 0.974 0.555 0.0
79318136705 DNAJ heat shock N-terminal domain-contai 0.978 0.956 0.556 0.0
334182674715 DNAJ heat shock N-terminal domain-contai 0.989 0.953 0.544 0.0
297844826703 DNAJ heat shock N-terminal domain-contai 0.976 0.957 0.560 0.0
356519070683 PREDICTED: uncharacterized protein LOC10 0.969 0.978 0.545 0.0
>gi|359491697|ref|XP_002281830.2| PREDICTED: uncharacterized protein LOC100244920 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  956 bits (2470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/686 (66%), Positives = 547/686 (79%), Gaps = 3/686 (0%)

Query: 6   MISKVKAYWAPLILFGLGLFYQLVVLPRSFPPSHYDALGIKPYSSVEQVKEAYEKFSSKW 65
           M S +KAY  PL+L    +F QL V+P SFP +HYD LGIK YS+VE+V EAYEKFSSKW
Sbjct: 1   MASTLKAYSIPLVLLAAAIFLQLFVIPNSFPLNHYDVLGIKRYSTVEEVAEAYEKFSSKW 60

Query: 66  NSGEEIPSTADFLKIQYAYELLTDPLWKRNYDVYGIDEQLHILEKVREQYGEESYSRIDL 125
           NSG E+P T DFLKI+YA+ELLTDPLWKR+YD++GIDEQ+ + E V++Q+   S+S I+L
Sbjct: 61  NSGTEVPETIDFLKIRYAFELLTDPLWKRDYDIFGIDEQIDVFENVKKQFSGVSFSGINL 120

Query: 126 PLLDA--TDHSVHAFNVVTSEDFPSIFHDSKPWLIQVYSDGSYLCGQFSGAWKTIAALLE 183
           PLL A  +D   H FNV+TS DF S+   ++P LIQ+YS GS  C QFS  WK IA  LE
Sbjct: 121 PLLSAASSDPGDHVFNVITSNDFHSVLEKTEPLLIQIYSLGSNSCRQFSNDWKRIATFLE 180

Query: 184 GIANTGMVELGDIRLATHLAERKPIGQIFFRRGLPSLVAFPPGCKSSDCMTRFEGELSVD 243
           G+ANTGMVELGD RLA +LAE+KP GQ FFR GLPSLVAFP GC++SDC+ R+EGELSVD
Sbjct: 181 GVANTGMVELGDARLAAYLAEKKPTGQPFFRNGLPSLVAFPSGCRTSDCLVRYEGELSVD 240

Query: 244 AVTDWFATAILKLPRIFYYTKESMGKNFLAKTGPHKVKVIFFSKTGERASPFVRQISRNY 303
           AVTDWFATAIL LPRI YY+KES+G+ FLAK+ P KVKVI FS+TG+RA+PF+RQ ++NY
Sbjct: 241 AVTDWFATAILTLPRISYYSKESLGQAFLAKSSPWKVKVIVFSRTGQRATPFLRQAAKNY 300

Query: 304 WAYASFAFVLWREEESSIWWNTFEVESAPAIVFLKDPGVKPVVYYGSFNNSRLSEVMEQN 363
           WA+ASFAFVLW+EE+SS+WWNTFEVESAPAIVFLKDPGVKPVV++G FNNS    +MEQN
Sbjct: 301 WAHASFAFVLWQEEDSSVWWNTFEVESAPAIVFLKDPGVKPVVHHGFFNNSWFVNIMEQN 360

Query: 364 KLQELPQLRSVTSMELGCDARGYSRAGSDTTIWYCVILAGRLSPELNKMRETIRRVQETL 423
           K QELPQLRS+TSMELGCDARGYSRAG DT  WYCVILAGRLS ELNKMRET+RRVQ+ L
Sbjct: 361 KQQELPQLRSITSMELGCDARGYSRAGYDTMTWYCVILAGRLSLELNKMRETMRRVQQIL 420

Query: 424 LSDDESNAADTDQSLAPAAVAFRNKRLTFAWLDGEAQDRYCSFYLFSETSFETCGARRDM 483
            S  E N AD  Q   P+A+A ++KRLTF WLDGEAQ +YC FY+ SE S++TCG RRD+
Sbjct: 421 SSAAELNGADKQQPSEPSAIALKDKRLTFTWLDGEAQKQYCFFYIHSEDSYDTCGPRRDV 480

Query: 484 SDVPRLFIVRYKRNTTEDEAKIERKPRNIWDAMQEQEVDPASQLVVRYNGSDEIPQIAKW 543
           +DVP+LFIVRYKRN T D+ K+ER+P+ IW+  QE++VDPASQLV RYNGS EIP+I KW
Sbjct: 481 ADVPQLFIVRYKRNATVDDLKVERRPKGIWNPFQEEDVDPASQLVARYNGSGEIPEIIKW 540

Query: 544 VSEIIQDGDSKDLPFYRAKTPELVPEDSEPLLTRSAQSLFSKSIGMKQRIRNIMGQCYDY 603
           +S+II+DGDS+DLP +R KTP+LVPED +P+ ++ AQS+ S S G+K RI++I+    D 
Sbjct: 541 ISQIIKDGDSRDLPLFRTKTPQLVPEDGDPIWSKGAQSILSTSKGLKYRIKSIISGMNDR 600

Query: 604 LGDPRIGPALLLAALMSFGTIWLMRGQQRAHPSQSGQPGPSANEDENRPARRKRAKQGSN 663
           LGDPRIGP LLL +LMSF +IWL R Q   H S+  QP   +N DE+R  RR R    S+
Sbjct: 601 LGDPRIGPMLLLGSLMSFASIWLKRSQA-THQSRLDQPSQPSNMDEDRKTRRNRKTTVSS 659

Query: 664 EGRPPSITDEEPKDAYQMPLLDSDSD 689
           + RP SITD EPKDAYQ PL DSDSD
Sbjct: 660 QDRPTSITDMEPKDAYQAPLSDSDSD 685

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297733956|emb|CBI15203.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255547351|ref|XP_002514733.1| heat shock protein binding protein, putative [Ricinus communis] gi|223546337|gb|EEF47839.1| heat shock protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224127416|ref|XP_002329272.1| predicted protein [Populus trichocarpa] gi|222870726|gb|EEF07857.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449440808|ref|XP_004138176.1| PREDICTED: uncharacterized protein LOC101203381 [Cucumis sativus] gi|449477213|ref|XP_004154962.1| PREDICTED: uncharacterized protein LOC101225277 [Cucumis sativus] Back     alignment and taxonomy information
>gi|22329659|ref|NP_173305.2| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis thaliana] gi|17979007|gb|AAL47463.1| At1g18700/F6A14_19 [Arabidopsis thaliana] gi|23506111|gb|AAN28915.1| At1g18700/F6A14_19 [Arabidopsis thaliana] gi|332191626|gb|AEE29747.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|79318136|ref|NP_001031065.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis thaliana] gi|332191627|gb|AEE29748.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|334182674|ref|NP_001185029.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis thaliana] gi|332191629|gb|AEE29750.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297844826|ref|XP_002890294.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297336136|gb|EFH66553.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356519070|ref|XP_003528197.1| PREDICTED: uncharacterized protein LOC100820244 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00016310001
SubName- Full=Chromosome chr17 scaffold_12, whole genome shotgun sequence; (698 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query689
pfam0022663 pfam00226, DnaJ, DnaJ domain 2e-08
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 1e-06
COG0484371 COG0484, DnaJ, DnaJ-class molecular chaperone with 2e-06
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 5e-06
PRK14284391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 3e-05
cd02961101 cd02961, PDI_a_family, Protein Disulfide Isomerase 3e-05
PRK14287371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 4e-05
PRK14282369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 1e-04
PRK14280376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 2e-04
PRK14276380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 2e-04
PRK14290365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 4e-04
PRK14277386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 4e-04
PRK14286372 PRK14286, PRK14286, chaperone protein DnaJ; Provis 7e-04
cd02963111 cd02963, TRX_DnaJ, TRX domain, DnaJ domain contain 0.001
cd03003101 cd03003, PDI_a_ERdj5_N, PDIa family, N-terminal ER 0.001
TIGR02349354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 0.001
PRK14291382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 0.001
PRK14298377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 0.002
TIGR03835 871 TIGR03835, termin_org_DnaJ, terminal organelle ass 0.002
PRK14299291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 0.003
PRK14297380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 0.003
PRK14278378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 0.003
PRK14292371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 0.003
COG5407610 COG5407, SEC63, Preprotein translocase subunit Sec 0.004
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information 
 Score = 50.6 bits (122), Expect = 2e-08
 Identities = 22/63 (34%), Positives = 37/63 (58%), Gaps = 5/63 (7%)

Query: 39 HYDALGIKPYSSVEQVKEAYEKFSSKW----NSGEEIPSTADFLKIQYAYELLTDPLWKR 94
          +Y+ LG+   +S E++K+AY K + K+    N G+   +   F +I  AYE+L+DP  + 
Sbjct: 2  YYEILGVPRDASDEEIKKAYRKLALKYHPDKNPGDPA-AEEKFKEINEAYEVLSDPEKRA 60

Query: 95 NYD 97
           YD
Sbjct: 61 IYD 63

DnaJ domains (J-domains) are associated with hsp70 heat-shock system and it is thought that this domain mediates the interaction. DnaJ-domain is therefore part of a chaperone (protein folding) system. The T-antigens, although not in Prosite are confirmed as DnaJ containing domains from literature. Length = 63
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|239259 cd02961, PDI_a_family, Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|239261 cd02963, TRX_DnaJ, TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain Back     alignment and domain information
>gnl|CDD|239301 cd03003, PDI_a_ERdj5_N, PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 689
KOG0190493 consensus Protein disulfide isomerase (prolyl 4-hy 100.0
KOG4277468 consensus Uncharacterized conserved protein, conta 99.98
TIGR01130462 ER_PDI_fam protein disulfide isomerases, eukaryoti 99.95
PTZ00102477 disulphide isomerase; Provisional 99.93
KOG0713336 consensus Molecular chaperone (DnaJ superfamily) [ 99.89
cd03006113 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamil 99.82
KOG0912375 consensus Thiol-disulfide isomerase and thioredoxi 99.81
COG0484371 DnaJ DnaJ-class molecular chaperone with C-termina 99.81
cd03003101 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam 99.78
PF01216383 Calsequestrin: Calsequestrin; InterPro: IPR001393 99.78
cd03007116 PDI_a_ERp29_N PDIa family, endoplasmic reticulum p 99.77
KOG0191383 consensus Thioredoxin/protein disulfide isomerase 99.76
KOG0712337 consensus Molecular chaperone (DnaJ superfamily) [ 99.76
cd03004104 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam 99.75
cd02996108 PDI_a_ERp44 PDIa family, endoplasmic reticulum pro 99.75
PF00085103 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio 99.7
cd03002109 PDI_a_MPD1_like PDI family, MPD1-like subfamily; c 99.69
cd02994101 PDI_a_TMX PDIa family, TMX subfamily; composed of 99.68
PRK14288369 chaperone protein DnaJ; Provisional 99.67
cd02993109 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfat 99.67
cd03001103 PDI_a_P5 PDIa family, P5 subfamily; composed of eu 99.66
cd03065120 PDI_b_Calsequestrin_N PDIb family, Calsequestrin s 99.66
PRK14296372 chaperone protein DnaJ; Provisional 99.65
KOG0190493 consensus Protein disulfide isomerase (prolyl 4-hy 99.64
cd02995104 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain 99.64
cd03005102 PDI_a_ERp46 PDIa family, endoplasmic reticulum pro 99.63
KOG1731606 consensus FAD-dependent sulfhydryl oxidase/quiesci 99.63
cd02963111 TRX_DnaJ TRX domain, DnaJ domain containing protei 99.62
PTZ00443224 Thioredoxin domain-containing protein; Provisional 99.62
PTZ00037421 DnaJ_C chaperone protein; Provisional 99.62
PRK14279392 chaperone protein DnaJ; Provisional 99.61
PRK14286372 chaperone protein DnaJ; Provisional 99.6
PRK14287371 chaperone protein DnaJ; Provisional 99.6
PRK14298377 chaperone protein DnaJ; Provisional 99.58
PRK14276380 chaperone protein DnaJ; Provisional 99.58
KOG0721230 consensus Molecular chaperone (DnaJ superfamily) [ 99.58
TIGR01126102 pdi_dom protein disulfide-isomerase domain. This m 99.58
PRK14282369 chaperone protein DnaJ; Provisional 99.58
cd02999100 PDI_a_ERp44_like PDIa family, endoplasmic reticulu 99.58
PRK14283378 chaperone protein DnaJ; Provisional 99.58
cd02998105 PDI_a_ERp38 PDIa family, endoplasmic reticulum pro 99.57
PRK14285365 chaperone protein DnaJ; Provisional 99.57
cd0295696 ybbN ybbN protein family; ybbN is a hypothetical p 99.57
cd02997104 PDI_a_PDIR PDIa family, PDIR subfamily; composed o 99.57
PRK14278378 chaperone protein DnaJ; Provisional 99.57
PRK14299291 chaperone protein DnaJ; Provisional 99.57
PRK14280376 chaperone protein DnaJ; Provisional 99.56
PRK14291382 chaperone protein DnaJ; Provisional 99.56
PRK14277386 chaperone protein DnaJ; Provisional 99.56
PRK14294366 chaperone protein DnaJ; Provisional 99.56
KOG0910150 consensus Thioredoxin-like protein [Posttranslatio 99.56
KOG0716279 consensus Molecular chaperone (DnaJ superfamily) [ 99.56
KOG0717508 consensus Molecular chaperone (DnaJ superfamily) [ 99.55
PRK14297380 chaperone protein DnaJ; Provisional 99.55
PRK14301373 chaperone protein DnaJ; Provisional 99.55
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.55
PRK14284391 chaperone protein DnaJ; Provisional 99.55
TIGR00424463 APS_reduc 5'-adenylylsulfate reductase, thioredoxi 99.55
cd02992114 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidas 99.54
PRK14295389 chaperone protein DnaJ; Provisional 99.54
PRK14281397 chaperone protein DnaJ; Provisional 99.53
PRK09381109 trxA thioredoxin; Provisional 99.53
PRK10767371 chaperone protein DnaJ; Provisional 99.52
COG3118304 Thioredoxin domain-containing protein [Posttransla 99.52
cd02961101 PDI_a_family Protein Disulfide Isomerase (PDIa) fa 99.52
cd03000104 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed o 99.52
PLN02309457 5'-adenylylsulfate reductase 99.51
KOG0718546 consensus Molecular chaperone (DnaJ superfamily) [ 99.51
TIGR02187215 GlrX_arch Glutaredoxin-like domain protein. This f 99.5
PRK14300372 chaperone protein DnaJ; Provisional 99.5
PTZ003411136 Ring-infected erythrocyte surface antigen; Provisi 99.5
PRK14290365 chaperone protein DnaJ; Provisional 99.5
TIGR02349354 DnaJ_bact chaperone protein DnaJ. This model repre 99.49
KOG0715288 consensus Molecular chaperone (DnaJ superfamily) [ 99.49
PRK14293374 chaperone protein DnaJ; Provisional 99.49
PRK14292371 chaperone protein DnaJ; Provisional 99.49
KOG0691296 consensus Molecular chaperone (DnaJ superfamily) [ 99.48
PRK14289386 chaperone protein DnaJ; Provisional 99.48
PHA02278103 thioredoxin-like protein 99.47
PRK10266306 curved DNA-binding protein CbpA; Provisional 99.46
KOG0719264 consensus Molecular chaperone (DnaJ superfamily) [ 99.46
KOG0722329 consensus Molecular chaperone (DnaJ superfamily) [ 99.46
PRK10996139 thioredoxin 2; Provisional 99.45
cd02985103 TRX_CDSP32 TRX family, chloroplastic drought-induc 99.44
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.43
PF13848184 Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_ 99.42
cd02962152 TMX2 TMX2 family; composed of proteins similar to 99.42
TIGR01068101 thioredoxin thioredoxin. Several proteins, such as 99.41
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.4
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.39
PTZ00102477 disulphide isomerase; Provisional 99.39
PHA03102153 Small T antigen; Reviewed 99.39
cd02948102 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fus 99.38
cd02954114 DIM1 Dim1 family; Dim1 is also referred to as U5 s 99.37
cd02965111 HyaE HyaE family; HyaE is also called HupG and Hox 99.37
KOG0191383 consensus Thioredoxin/protein disulfide isomerase 99.37
cd02957113 Phd_like Phosducin (Phd)-like family; composed of 99.36
cd02953104 DsbDgamma DsbD gamma family; DsbD gamma is the C-t 99.34
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 99.32
cd02989113 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior 99.29
TIGR01130462 ER_PDI_fam protein disulfide isomerases, eukaryoti 99.28
cd02950142 TxlA TRX-like protein A (TxlA) family; TxlA was or 99.28
cd0294793 TRX_family TRX family; composed of two groups: Gro 99.25
COG2214237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.24
cd0298497 TRX_PICOT TRX domain, PICOT (for PKC-interacting c 99.24
PTZ0005198 thioredoxin; Provisional 99.21
cd0294997 TRX_NTR TRX domain, novel NADPH thioredoxin reduct 99.2
PLN00410142 U5 snRNP protein, DIM1 family; Provisional 99.16
KOG0907106 consensus Thioredoxin [Posttranslational modificat 99.14
cd02975113 PfPDO_like_N Pyrococcus furiosus protein disulfide 99.13
COG5407610 SEC63 Preprotein translocase subunit Sec63 [Intrac 99.12
PRK01356166 hscB co-chaperone HscB; Provisional 99.12
cd02982103 PDI_b'_family Protein Disulfide Isomerase (PDIb') 99.1
cd02987175 Phd_like_Phd Phosducin (Phd)-like family, Phd subf 99.1
TIGR01295122 PedC_BrcD bacteriocin transport accessory protein, 99.1
PRK05014171 hscB co-chaperone HscB; Provisional 99.09
PRK03578176 hscB co-chaperone HscB; Provisional 99.03
KOG0720490 consensus Molecular chaperone (DnaJ superfamily) [ 99.03
PTZ00100116 DnaJ chaperone protein; Provisional 99.02
cd02986114 DLP Dim1 family, Dim1-like protein (DLP) subfamily 99.01
PRK00294173 hscB co-chaperone HscB; Provisional 99.01
TIGR0041182 redox_disulf_1 small redox-active disulfide protei 98.99
cd02988192 Phd_like_VIAF Phosducin (Phd)-like family, Viral i 98.98
KOG0714306 consensus Molecular chaperone (DnaJ superfamily) [ 98.97
cd02951125 SoxW SoxW family; SoxW is a bacterial periplasmic 98.94
cd02983130 P5_C P5 family, C-terminal redox inactive TRX-like 98.92
PHA02624647 large T antigen; Provisional 98.87
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 98.86
KOG0908288 consensus Thioredoxin-like protein [Posttranslatio 98.84
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 98.84
PTZ00062204 glutaredoxin; Provisional 98.82
cd02952119 TRP14_like Human TRX-related protein 14 (TRP14)-li 98.8
PF13848184 Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_ 98.73
TIGR02187215 GlrX_arch Glutaredoxin-like domain protein. This f 98.64
KOG0913248 consensus Thiol-disulfide isomerase and thioredoxi 98.64
PHA0212575 thioredoxin-like protein 98.63
cd02959117 ERp19 Endoplasmic reticulum protein 19 (ERp19) fam 98.61
TIGR0041276 redox_disulf_2 small redox-active disulfide protei 98.58
PRK00293571 dipZ thiol:disulfide interchange protein precursor 98.58
KOG1150250 consensus Predicted molecular chaperone (DnaJ supe 98.57
PF13098112 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_ 98.53
PRK01773173 hscB co-chaperone HscB; Provisional 98.51
PRK03147173 thiol-disulfide oxidoreductase; Provisional 98.42
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 98.38
TIGR02740271 TraF-like TraF-like protein. This protein is relat 98.35
KOG0914265 consensus Thioredoxin-like protein [Posttranslatio 98.33
cd0297367 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- 98.33
cd02955124 SSP411 TRX domain, SSP411 protein family; members 98.29
COG5269379 ZUO1 Ribosome-associated chaperone zuotin [Transla 98.25
cd02967114 mauD Methylamine utilization (mau) D family; mauD 98.25
cd03011123 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppresso 98.23
TIGR02738153 TrbB type-F conjugative transfer system pilin asse 98.2
cd03009131 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family 98.18
PRK14018521 trifunctional thioredoxin/methionine sulfoxide red 98.14
cd02966116 TlpA_like_family TlpA-like family; composed of Tlp 98.11
cd02964132 TryX_like_family Tryparedoxin (TryX)-like family; 98.11
cd03010127 TlpA_like_DsbE TlpA-like family, DsbE (also known 98.08
cd0302689 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid 98.07
PRK11509132 hydrogenase-1 operon protein HyaE; Provisional 98.0
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 97.97
TIGR00385173 dsbE periplasmic protein thiol:disulfide oxidoredu 97.9
cd02958114 UAS UAS family; UAS is a domain of unknown functio 97.88
cd03007116 PDI_a_ERp29_N PDIa family, endoplasmic reticulum p 97.87
KOG0568342 consensus Molecular chaperone (DnaJ superfamily) [ 97.86
PRK15412185 thiol:disulfide interchange protein DsbE; Provisio 97.85
cd03008146 TryX_like_RdCVF Tryparedoxin (TryX)-like family, R 97.82
PF1390595 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_ 97.78
cd03065120 PDI_b_Calsequestrin_N PDIb family, Calsequestrin s 97.75
PRK13728181 conjugal transfer protein TrbB; Provisional 97.74
PF00085103 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio 97.72
PF1389982 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_ 97.69
cd0165969 TRX_superfamily Thioredoxin (TRX) superfamily; a l 97.68
PLN029191057 haloacid dehalogenase-like hydrolase family protei 97.66
COG4232569 Thiol:disulfide interchange protein [Posttranslati 97.64
cd03004104 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam 97.61
cd03002109 PDI_a_MPD1_like PDI family, MPD1-like subfamily; c 97.53
cd03012126 TlpA_like_DipZ_like TlpA-like family, DipZ-like su 97.52
cd0298197 PDI_b_family Protein Disulfide Isomerase (PDIb) fa 97.51
PLN02399236 phospholipid hydroperoxide glutathione peroxidase 97.48
cd03003101 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam 97.47
cd03006113 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamil 97.47
smart00594122 UAS UAS domain. 97.46
TIGR0219674 GlrX_YruB Glutaredoxin-like protein, YruB-family. 97.43
TIGR02661189 MauD methylamine dehydrogenase accessory protein M 97.4
cd03066102 PDI_b_Calsequestrin_middle PDIb family, Calsequest 97.4
cd02996108 PDI_a_ERp44 PDIa family, endoplasmic reticulum pro 97.35
cd03069104 PDI_b_ERp57 PDIb family, ERp57 subfamily, first re 97.3
cd03001103 PDI_a_P5 PDIa family, P5 subfamily; composed of eu 97.28
KOG0723112 consensus Molecular chaperone (DnaJ superfamily) [ 97.25
cd02993109 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfat 97.23
COG0526127 TrxA Thiol-disulfide isomerase and thioredoxins [P 97.16
PTZ00056199 glutathione peroxidase; Provisional 97.16
cd00340152 GSH_Peroxidase Glutathione (GSH) peroxidase family 97.15
PLN02412167 probable glutathione peroxidase 97.14
cd02960130 AGR Anterior Gradient (AGR) family; members of thi 97.12
TIGR02540153 gpx7 putative glutathione peroxidase Gpx7. This mo 97.1
TIGR00424463 APS_reduc 5'-adenylylsulfate reductase, thioredoxi 97.06
cd0298197 PDI_b_family Protein Disulfide Isomerase (PDIb) fa 97.06
PRK11509132 hydrogenase-1 operon protein HyaE; Provisional 97.02
PF07912126 ERp29_N: ERp29, N-terminal domain; InterPro: IPR01 97.02
TIGR01126102 pdi_dom protein disulfide-isomerase domain. This m 97.01
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 96.97
PF1319276 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZY 96.92
TIGR0220077 GlrX_actino Glutaredoxin-like protein. This family 96.88
cd02965111 HyaE HyaE family; HyaE is also called HupG and Hox 96.87
PF08534146 Redoxin: Redoxin; InterPro: IPR013740 This redoxin 96.82
cd02999100 PDI_a_ERp44_like PDIa family, endoplasmic reticulu 96.8
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.79
cd0295696 ybbN ybbN protein family; ybbN is a hypothetical p 96.78
cd02995104 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain 96.71
cd03073111 PDI_b'_ERp72_ERp57 PDIb' family, ERp72 and ERp57 s 96.71
cd02969171 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypot 96.71
cd02998105 PDI_a_ERp38 PDIa family, endoplasmic reticulum pro 96.65
PF02114265 Phosducin: Phosducin; InterPro: IPR024253 The oute 96.65
PLN02309457 5'-adenylylsulfate reductase 96.64
cd02961101 PDI_a_family Protein Disulfide Isomerase (PDIa) fa 96.61
KOG4277468 consensus Uncharacterized conserved protein, conta 96.58
KOG0910150 consensus Thioredoxin-like protein [Posttranslatio 96.57
cd02963111 TRX_DnaJ TRX domain, DnaJ domain containing protei 96.46
cd02953104 DsbDgamma DsbD gamma family; DsbD gamma is the C-t 96.45
PF13728215 TraF: F plasmid transfer operon protein 96.45
cd03005102 PDI_a_ERp46 PDIa family, endoplasmic reticulum pro 96.44
TIGR01068101 thioredoxin thioredoxin. Several proteins, such as 96.43
cd02982103 PDI_b'_family Protein Disulfide Isomerase (PDIb') 96.41
cd03067112 PDI_b_PDIR_N PDIb family, PDIR subfamily, N-termin 96.4
cd02997104 PDI_a_PDIR PDIa family, PDIR subfamily; composed o 96.39
cd03068107 PDI_b_ERp72 PDIb family, ERp72 subfamily, first re 96.39
cd02950142 TxlA TRX-like protein A (TxlA) family; TxlA was or 96.29
cd02994101 PDI_a_TMX PDIa family, TMX subfamily; composed of 96.29
TIGR0218084 GRX_euk Glutaredoxin. This model represents eukary 96.28
PRK09381109 trxA thioredoxin; Provisional 96.27
cd03072111 PDI_b'_ERp44 PDIb' family, ERp44 subfamily, second 96.14
PF00578124 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Per 96.1
PRK10996139 thioredoxin 2; Provisional 96.07
cd03072111 PDI_b'_ERp44 PDIb' family, ERp44 subfamily, second 96.0
cd02983130 P5_C P5 family, C-terminal redox inactive TRX-like 95.95
cd03017140 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferrit 95.92
KOG2603331 consensus Oligosaccharyltransferase, gamma subunit 95.91
PHA02278103 thioredoxin-like protein 95.91
PTZ00443224 Thioredoxin domain-containing protein; Provisional 95.85
cd02991116 UAS_ETEA UAS family, ETEA subfamily; composed of p 95.8
TIGR02739256 TraF type-F conjugative transfer system pilin asse 95.69
cd03000104 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed o 95.67
cd02989113 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior 95.58
KOG3192168 consensus Mitochondrial J-type chaperone [Posttran 95.55
PF06110119 DUF953: Eukaryotic protein of unknown function (DU 95.53
PTZ00256183 glutathione peroxidase; Provisional 95.52
TIGR01626184 ytfJ_HI0045 conserved hypothetical protein YtfJ-fa 95.48
cd0294997 TRX_NTR TRX domain, novel NADPH thioredoxin reduct 95.45
PRK09437154 bcp thioredoxin-dependent thiol peroxidase; Review 95.43
PRK13703248 conjugal pilus assembly protein TraF; Provisional 95.39
KOG2501157 consensus Thioredoxin, nucleoredoxin and related p 95.35
cd03015173 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2- 95.31
cd02975113 PfPDO_like_N Pyrococcus furiosus protein disulfide 95.25
cd02948102 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fus 95.22
cd02954114 DIM1 Dim1 family; Dim1 is also referred to as U5 s 95.2
PRK10606183 btuE putative glutathione peroxidase; Provisional 95.16
KOG0912375 consensus Thiol-disulfide isomerase and thioredoxi 95.13
PRK00522167 tpx lipid hydroperoxide peroxidase; Provisional 95.08
cd02985103 TRX_CDSP32 TRX family, chloroplastic drought-induc 95.04
cd02987175 Phd_like_Phd Phosducin (Phd)-like family, Phd subf 95.03
cd02970149 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypot 94.96
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 94.88
KOG0907106 consensus Thioredoxin [Posttranslational modificat 94.84
KOG3425128 consensus Uncharacterized conserved protein [Funct 94.83
cd02957113 Phd_like Phosducin (Phd)-like family; composed of 94.8
TIGR03137187 AhpC peroxiredoxin. This gene contains two invaria 94.74
PRK1120085 grxA glutaredoxin 1; Provisional 94.7
PF07912126 ERp29_N: ERp29, N-terminal domain; InterPro: IPR01 94.62
cd03014143 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 94.62
cd0298497 TRX_PICOT TRX domain, PICOT (for PKC-interacting c 94.55
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 94.53
cd02986114 DLP Dim1 family, Dim1-like protein (DLP) subfamily 94.41
cd0294793 TRX_family TRX family; composed of two groups: Gro 94.32
cd02968142 SCO SCO (an acronym for Synthesis of Cytochrome c 94.29
cd03018149 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-lik 94.23
cd0297673 NrdH NrdH-redoxin (NrdH) family; NrdH is a small m 93.96
cd02971140 PRX_family Peroxiredoxin (PRX) family; composed of 93.88
PRK10382187 alkyl hydroperoxide reductase subunit C; Provision 93.73
PLN00410142 U5 snRNP protein, DIM1 family; Provisional 93.57
cd02951125 SoxW SoxW family; SoxW is a bacterial periplasmic 93.56
cd03020197 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamil 93.36
KOG0911227 consensus Glutaredoxin-related protein [Posttransl 93.35
cd0206672 GRX_family Glutaredoxin (GRX) family; composed of 93.06
cd03073111 PDI_b'_ERp72_ERp57 PDIb' family, ERp72 and ERp57 s 93.02
KOG1672211 consensus ATP binding protein [Posttranslational m 93.01
PRK10877232 protein disulfide isomerase II DsbC; Provisional 92.87
cd0341982 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h 92.83
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 92.73
cd0297298 DsbA_family DsbA family; consists of DsbA and DsbA 92.55
PF0046260 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl 92.17
cd03074120 PDI_b'_Calsequestrin_C Protein Disulfide Isomerase 92.06
PF07449107 HyaE: Hydrogenase-1 expression protein HyaE; Inter 92.03
TIGR0041182 redox_disulf_1 small redox-active disulfide protei 91.95
cd02988192 Phd_like_VIAF Phosducin (Phd)-like family, Viral i 91.81
PRK15000200 peroxidase; Provisional 91.81
PF14595129 Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A. 91.79
KOG2640319 consensus Thioredoxin [Function unknown] 91.62
cd02962152 TMX2 TMX2 family; composed of proteins similar to 91.46
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 91.43
COG2143182 Thioredoxin-related protein [Posttranslational mod 91.43
PF03190163 Thioredox_DsbH: Protein of unknown function, DUF25 91.18
cd02992114 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidas 90.96
KOG0431453 consensus Auxilin-like protein and related protein 90.73
PRK13190202 putative peroxiredoxin; Provisional 90.65
cd03023154 DsbA_Com1_like DsbA family, Com1-like subfamily; c 90.58
cd03071116 PDI_b'_NRX PDIb' family, NRX subgroup, redox inact 90.54
PTZ00253199 tryparedoxin peroxidase; Provisional 90.23
PF01216383 Calsequestrin: Calsequestrin; InterPro: IPR001393 90.1
TIGR0218386 GRXA Glutaredoxin, GrxA family. This model include 90.02
PTZ0005198 thioredoxin; Provisional 89.97
TIGR0219079 GlrX-dom Glutaredoxin-family domain. This C-termin 89.8
TIGR01295122 PedC_BrcD bacteriocin transport accessory protein, 89.71
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 89.04
PTZ00062204 glutaredoxin; Provisional 88.91
cd03019178 DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a m 88.78
PF02114265 Phosducin: Phosducin; InterPro: IPR024253 The oute 88.32
cd03066102 PDI_b_Calsequestrin_middle PDIb family, Calsequest 88.14
PRK1032981 glutaredoxin-like protein; Provisional 87.86
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 87.6
PRK13599215 putative peroxiredoxin; Provisional 87.52
KOG3414142 consensus Component of the U4/U6.U5 snRNP/mitosis 87.46
cd03016203 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX sub 87.41
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 87.35
cd02952119 TRP14_like Human TRX-related protein 14 (TRP14)-li 86.87
cd03069104 PDI_b_ERp57 PDIb family, ERp57 subfamily, first re 86.34
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 86.25
cd03067112 PDI_b_PDIR_N PDIb family, PDIR subfamily, N-termin 85.4
cd02958114 UAS UAS family; UAS is a domain of unknown functio 84.79
TIGR0219472 GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red 84.45
PF07449107 HyaE: Hydrogenase-1 expression protein HyaE; Inter 83.86
PF11009105 DUF2847: Protein of unknown function (DUF2847); In 83.52
TIGR0218179 GRX_bact Glutaredoxin, GrxC family. This family of 83.44
cd0341875 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b 83.24
cd0302773 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg 83.17
cd0302972 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb 83.05
KOG3171273 consensus Conserved phosducin-like protein [Signal 82.9
KOG3170240 consensus Conserved phosducin-like protein [Signal 81.63
PTZ00137261 2-Cys peroxiredoxin; Provisional 81.57
TIGR02740271 TraF-like TraF-like protein. This protein is relat 81.14
>KOG0190 consensus Protein disulfide isomerase (prolyl 4-hydroxylase beta subunit) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=1.4e-34  Score=316.60  Aligned_cols=334  Identities=19%  Similarity=0.274  Sum_probs=253.2

Q ss_pred             cceeEEecCCCCccccCCCCCEEEEEEcCCCcCCcCchHHHHHHHHHHhcc---cceeeeecchhhhhhHHHhhCCCCcc
Q 005592          135 VHAFNVVTSEDFPSIFHDSKPWLIQVYSDGSYLCGQFSGAWKTIAALLEGI---ANTGMVELGDIRLATHLAERKPIGQI  211 (689)
Q Consensus       135 ~~~V~~Lt~~nF~~~I~~~~~~LV~FYapwC~~Ck~l~p~w~~~A~~L~~~---~~vg~Vdc~~~~~~~~L~~k~~~~~~  211 (689)
                      ...|++||.+||+..|..+..+||+|||||||||++++|+|+++|+.|+..   +.+|+|||+++   ..+|.+++    
T Consensus        24 ~~~Vl~Lt~dnf~~~i~~~~~vlVeFYAPWCghck~LaPey~kAA~~Lke~~s~i~LakVDat~~---~~~~~~y~----   96 (493)
T KOG0190|consen   24 EEDVLVLTKDNFKETINGHEFVLVEFYAPWCGHCKALAPEYEKAATELKEEGSPVKLAKVDATEE---SDLASKYE----   96 (493)
T ss_pred             ccceEEEecccHHHHhccCceEEEEEEchhhhhhhhhCcHHHHHHHHhhccCCCceeEEeecchh---hhhHhhhc----
Confidence            346899999999999999999999999999999999999999999999874   58999999966   45999998    


Q ss_pred             cccccccEEEEcCCCCCCCCCccccccccCHHHHHHHHHHHhccCCcceecccchhhhhhhhhcCCCcEEEEEEeCCCCC
Q 005592          212 FFRRGLPSLVAFPPGCKSSDCMTRFEGELSVDAVTDWFATAILKLPRIFYYTKESMGKNFLAKTGPHKVKVIFFSKTGER  291 (689)
Q Consensus       212 f~V~gyPTL~~f~~g~~~~~~~~~Y~G~rs~~~Iv~fv~k~v~~lP~~~~it~~~~~~~Fl~~~~~~k~~Vl~f~~~~~~  291 (689)
                        |+|||||++|++|..    ...|+|+|++++|+.|++++  .+|+...+.+.+.+..|+.+.  +.+.+.+|.+... 
T Consensus        97 --v~gyPTlkiFrnG~~----~~~Y~G~r~adgIv~wl~kq--~gPa~~~l~~~~~a~~~l~~~--~~~vig~F~d~~~-  165 (493)
T KOG0190|consen   97 --VRGYPTLKIFRNGRS----AQDYNGPREADGIVKWLKKQ--SGPASKTLKTVDEAEEFLSKK--DVVVIGFFKDLES-  165 (493)
T ss_pred             --CCCCCeEEEEecCCc----ceeccCcccHHHHHHHHHhc--cCCCceecccHHHHHhhccCC--ceEEEEEeccccc-
Confidence              889999999999963    57999999999999999998  688887777666688888763  2333445543221 


Q ss_pred             CcHHHHHHHHhcccCceEEEEEecccccHHHHhhcCCCC--CCEEEEEeCCCCCceeecCCCChHHHHHHHHhcCCCCCc
Q 005592          292 ASPFVRQISRNYWAYASFAFVLWREEESSIWWNTFEVES--APAIVFLKDPGVKPVVYYGSFNNSRLSEVMEQNKLQELP  369 (689)
Q Consensus       292 ~~~~~~~~A~~~~~~~~f~~V~~~~~~s~~l~~~f~V~~--~PtIvvfk~~~~~p~~y~g~~~~~~L~~fI~~~k~~~lp  369 (689)
                      ........|...++.+.|++..     ..++.+++++..  .+.+++++..+...+.|.|.++.+.|.+||..+++|++.
T Consensus       166 ~~~~~~~~a~~l~~d~~F~~ts-----~~~~~~~~~~~~~~~~~i~l~kk~d~~~~~~~~~~~~~~l~~Fi~~~~~plv~  240 (493)
T KOG0190|consen  166 LAESFFDAASKLRDDYKFAHTS-----DSDVAKKLELNTEGTFPIVLFKKFDELLVKYDGSFTPELLKKFIQENSLPLVT  240 (493)
T ss_pred             chHHHHHHHHhccccceeeccC-----cHhHHhhccCCCCCcceEEeccccccchhhcccccCHHHHHHHHHHhcccccc
Confidence            2222333444556677777321     356888888853  566999999888877788999999999999999999999


Q ss_pred             cccccchhhhccCccCccCCCCCCcccEEEEEecC-CchhHHHHHHHHHHHHHhhccccccccccccccchHHHHHcCCC
Q 005592          370 QLRSVTSMELGCDARGYSRAGSDTTIWYCVILAGR-LSPELNKMRETIRRVQETLLSDDESNAADTDQSLAPAAVAFRNK  448 (689)
Q Consensus       370 ~lts~~~~~~~c~~~~~~~~~k~~~~~lCVIl~~~-~~~~~~~~~~~lr~~a~~~~~~~~~~~~~~~~~~~~~A~~~k~~  448 (689)
                      .+|..+.....-      ..-     .+-++++.. .....+.+++.++++|+                      +|++ 
T Consensus       241 ~ft~~~~~~~~~------~~~-----~~~~~~~~~~~~~~~e~~~~~~~~vAk----------------------~f~~-  286 (493)
T KOG0190|consen  241 EFTVANNAKIYS------SFV-----KLGLDFFVFFKCNRFEELRKKFEEVAK----------------------KFKG-  286 (493)
T ss_pred             eecccccceeec------ccc-----ccceeEEeccccccHHHHHHHHHHHHH----------------------hccc-
Confidence            999987654221      111     244555554 23367888888888877                      7887 


Q ss_pred             cEEEEEEeCcchHHHHHHhcccCCcccccCCcCCCCCCC-eEEEEEeecCCCcccceeecccCccccccccccCCccccc
Q 005592          449 RLTFAWLDGEAQDRYCSFYLFSETSFETCGARRDMSDVP-RLFIVRYKRNTTEDEAKIERKPRNIWDAMQEQEVDPASQL  527 (689)
Q Consensus       449 ~l~F~wvd~~~q~~f~~~f~~~~~~~~~c~~~~~~~~~P-~lvI~~~rrn~~~~~~k~~~~~w~~l~~~~~~~~~~~~~~  527 (689)
                      .++|+++|.+..+..++.|-+.+.            ..| .++++    +..+  -||.      +   ++++.      
T Consensus       287 ~l~Fi~~d~e~~~~~~~~~Gl~~~------------~~~~~~v~~----~~~~--~Ky~------~---~~e~~------  333 (493)
T KOG0190|consen  287 KLRFILIDPESFARVLEFFGLEEE------------QLPIRAVIL----NEDG--SKYP------L---EEEEL------  333 (493)
T ss_pred             ceEEEEEChHHhhHHHHhcCcccc------------cCCeeEEee----cccc--cccc------C---ccccc------
Confidence            599999999888888888844322            124 55555    5555  4665      3   44322      


Q ss_pred             hhccCCCCchHHHHHHHHHHhcCCCCCCCCcccCCCCCCCC
Q 005592          528 VVRYNGSDEIPQIAKWVSEIIQDGDSKDLPFYRAKTPELVP  568 (689)
Q Consensus       528 ~~~~~~~~~~~~i~~~l~~~~~~g~~~~~~~~~~~~p~l~~  568 (689)
                              +...|+.|+.+++.  ++..+.++++++|+=++
T Consensus       334 --------~~~~ie~f~~~~l~--Gk~~p~~kSqpiPe~~~  364 (493)
T KOG0190|consen  334 --------DQENIESFVKDFLD--GKVKPHLKSQPIPEDND  364 (493)
T ss_pred             --------cHHHHHHHHHHHhc--CccccccccCCCCcccc
Confidence                    22469999999999  67777779999999776

>KOG4277 consensus Uncharacterized conserved protein, contains thioredoxin domain [General function prediction only] Back     alignment and domain information
>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox Back     alignment and domain information
>KOG0912 consensus Thiol-disulfide isomerase and thioredoxin [Posttranslational modification, protein turnover, chaperones; Energy production and conversion] Back     alignment and domain information
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>PF01216 Calsequestrin: Calsequestrin; InterPro: IPR001393 Calsequestrin is the principal calcium-binding protein present in the sarcoplasmic reticulum of cardiac and skeletal muscle [] Back     alignment and domain information
>cd03007 PDI_a_ERp29_N PDIa family, endoplasmic reticulum protein 29 (ERp29) subfamily; ERp29 is a ubiquitous ER-resident protein expressed in high levels in secretory cells Back     alignment and domain information
>KOG0191 consensus Thioredoxin/protein disulfide isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms Back     alignment and domain information
>cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein Back     alignment and domain information
>cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases Back     alignment and domain information
>cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0190 consensus Protein disulfide isomerase (prolyl 4-hydroxylase beta subunit) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 Back     alignment and domain information
>cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains Back     alignment and domain information
>KOG1731 consensus FAD-dependent sulfhydryl oxidase/quiescin and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain Back     alignment and domain information
>PTZ00443 Thioredoxin domain-containing protein; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01126 pdi_dom protein disulfide-isomerase domain Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain Back     alignment and domain information
>cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0910 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR00424 APS_reduc 5'-adenylylsulfate reductase, thioredoxin-independent Back     alignment and domain information
>cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK09381 trxA thioredoxin; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus Back     alignment and domain information
>PLN02309 5'-adenylylsulfate reductase Back     alignment and domain information
>KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PHA02278 thioredoxin-like protein Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10996 thioredoxin 2; Provisional Back     alignment and domain information
>cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PF13848 Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_B 3BOA_A 2B5E_A 1BJX_A 2K18_A 3UEM_A 3BJ5_A 2BJX_A 2R2J_A 2L4C_A Back     alignment and domain information
>cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library Back     alignment and domain information
>TIGR01068 thioredoxin thioredoxin Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein Back     alignment and domain information
>cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein Back     alignment and domain information
>cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO Back     alignment and domain information
>KOG0191 consensus Thioredoxin/protein disulfide isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions Back     alignment and domain information
>cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif Back     alignment and domain information
>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic Back     alignment and domain information
>cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus Back     alignment and domain information
>cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes Back     alignment and domain information
>PTZ00051 thioredoxin; Provisional Back     alignment and domain information
>cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains Back     alignment and domain information
>PLN00410 U5 snRNP protein, DIM1 family; Provisional Back     alignment and domain information
>KOG0907 consensus Thioredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions Back     alignment and domain information
>TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>cd02986 DLP Dim1 family, Dim1-like protein (DLP) subfamily; DLP is a novel protein which shares 38% sequence identity to Dim1 Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 Back     alignment and domain information
>cd02988 Phd_like_VIAF Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis Back     alignment and domain information
>KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation Back     alignment and domain information
>cd02983 P5_C P5 family, C-terminal redox inactive TRX-like domain; P5 is a protein disulfide isomerase (PDI)-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0908 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>PTZ00062 glutaredoxin; Provisional Back     alignment and domain information
>cd02952 TRP14_like Human TRX-related protein 14 (TRP14)-like family; composed of proteins similar to TRP14, a 14kD cytosolic protein that shows disulfide reductase activity in vitro with a different substrate specificity compared with another human cytosolic protein, TRX1 Back     alignment and domain information
>PF13848 Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_B 3BOA_A 2B5E_A 1BJX_A 2K18_A 3UEM_A 3BJ5_A 2BJX_A 2R2J_A 2L4C_A Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein Back     alignment and domain information
>KOG0913 consensus Thiol-disulfide isomerase and thioredoxin [Posttranslational modification, protein turnover, chaperones; Energy production and conversion] Back     alignment and domain information
>PHA02125 thioredoxin-like protein Back     alignment and domain information
>cd02959 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; ERp19 is also known as ERp18, a protein located in the ER containing one redox active TRX domain Back     alignment and domain information
>TIGR00412 redox_disulf_2 small redox-active disulfide protein 2 Back     alignment and domain information
>PRK00293 dipZ thiol:disulfide interchange protein precursor; Provisional Back     alignment and domain information
>KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK03147 thiol-disulfide oxidoreductase; Provisional Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>TIGR02740 TraF-like TraF-like protein Back     alignment and domain information
>KOG0914 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) Back     alignment and domain information
>cd02955 SSP411 TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02967 mauD Methylamine utilization (mau) D family; mauD protein is the translation product of the mauD gene found in methylotrophic bacteria, which are able to use methylamine as a sole carbon source and a nitrogen source Back     alignment and domain information
>cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif Back     alignment and domain information
>TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB Back     alignment and domain information
>cd03009 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, TryX and nucleoredoxin (NRX) subfamily; TryX and NRX are thioredoxin (TRX)-like protein disulfide oxidoreductases that alter the redox state of target proteins via the reversible oxidation of an active center CXXC motif Back     alignment and domain information
>PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional Back     alignment and domain information
>cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins Back     alignment and domain information
>cd02964 TryX_like_family Tryparedoxin (TryX)-like family; composed of TryX and related proteins including nucleoredoxin (NRX), rod-derived cone viability factor (RdCVF) and the nematode homolog described as a 16-kD class of TRX Back     alignment and domain information
>cd03010 TlpA_like_DsbE TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif Back     alignment and domain information
>cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides Back     alignment and domain information
>PRK11509 hydrogenase-1 operon protein HyaE; Provisional Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily Back     alignment and domain information
>cd02958 UAS UAS family; UAS is a domain of unknown function Back     alignment and domain information
>cd03007 PDI_a_ERp29_N PDIa family, endoplasmic reticulum protein 29 (ERp29) subfamily; ERp29 is a ubiquitous ER-resident protein expressed in high levels in secretory cells Back     alignment and domain information
>KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15412 thiol:disulfide interchange protein DsbE; Provisional Back     alignment and domain information
>cd03008 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors Back     alignment and domain information
>PF13905 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_A 1OC8_B 1O6J_A 1OC9_B 1O81_A 3FKF_A 1O85_A 1O7U_A 1O8W_A Back     alignment and domain information
>cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle Back     alignment and domain information
>PRK13728 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms Back     alignment and domain information
>PF13899 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_A 1UC7_A 2JU5_A 1VRS_D 2FWG_A 2FWF_A 2FWH_A 2FWE_A 3FK8_A Back     alignment and domain information
>cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>COG4232 Thiol:disulfide interchange protein [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Back     alignment and domain information
>cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein Back     alignment and domain information
>cd03012 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain Back     alignment and domain information
>cd02981 PDI_b_family Protein Disulfide Isomerase (PDIb) family, redox inactive TRX-like domain b; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>PLN02399 phospholipid hydroperoxide glutathione peroxidase Back     alignment and domain information
>cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox Back     alignment and domain information
>smart00594 UAS UAS domain Back     alignment and domain information
>TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family Back     alignment and domain information
>TIGR02661 MauD methylamine dehydrogenase accessory protein MauD Back     alignment and domain information
>cd03066 PDI_b_Calsequestrin_middle PDIb family, Calsequestrin subfamily, Middle TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle Back     alignment and domain information
>cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>cd03069 PDI_b_ERp57 PDIb family, ERp57 subfamily, first redox inactive TRX-like domain b; ERp57 (or ERp60) exhibits both disulfide oxidase and reductase functions like PDI, by catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER and acting as isomerases to correct any non-native disulfide bonds Back     alignment and domain information
>cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases Back     alignment and domain information
>COG0526 TrxA Thiol-disulfide isomerase and thioredoxins [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Back     alignment and domain information
>PTZ00056 glutathione peroxidase; Provisional Back     alignment and domain information
>cd00340 GSH_Peroxidase Glutathione (GSH) peroxidase family; tetrameric selenoenzymes that catalyze the reduction of a variety of hydroperoxides including lipid peroxidases, using GSH as a specific electron donor substrate Back     alignment and domain information
>PLN02412 probable glutathione peroxidase Back     alignment and domain information
>cd02960 AGR Anterior Gradient (AGR) family; members of this family are similar to secreted proteins encoded by the cement gland-specific genes XAG-1 and XAG-2, expressed in the anterior region of dorsal ectoderm of Xenopus Back     alignment and domain information
>TIGR02540 gpx7 putative glutathione peroxidase Gpx7 Back     alignment and domain information
>TIGR00424 APS_reduc 5'-adenylylsulfate reductase, thioredoxin-independent Back     alignment and domain information
>cd02981 PDI_b_family Protein Disulfide Isomerase (PDIb) family, redox inactive TRX-like domain b; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>PRK11509 hydrogenase-1 operon protein HyaE; Provisional Back     alignment and domain information
>PF07912 ERp29_N: ERp29, N-terminal domain; InterPro: IPR012883 ERp29 (P52555 from SWISSPROT) is a ubiquitously expressed endoplasmic reticulum protein, and is involved in the processes of protein maturation and protein secretion in this organelle [, ] Back     alignment and domain information
>TIGR01126 pdi_dom protein disulfide-isomerase domain Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PF13192 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZYN_A 1HYU_A 1ILO_A 1J08_F 2YWM_B 2AYT_B 2HLS_B 1A8L_A 2K8S_B Back     alignment and domain information
>TIGR02200 GlrX_actino Glutaredoxin-like protein Back     alignment and domain information
>cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO Back     alignment and domain information
>PF08534 Redoxin: Redoxin; InterPro: IPR013740 This redoxin domain is found in peroxiredoxin, thioredoxin and glutaredoxin proteins Back     alignment and domain information
>cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain Back     alignment and domain information
>cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 Back     alignment and domain information
>cd03073 PDI_b'_ERp72_ERp57 PDIb' family, ERp72 and ERp57 subfamily, second redox inactive TRX-like domain b'; ERp72 and ER57 are involved in oxidative protein folding in the ER, like PDI Back     alignment and domain information
>cd02969 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 Back     alignment and domain information
>PF02114 Phosducin: Phosducin; InterPro: IPR024253 The outer and inner segments of vertebrate rod photoreceptor cells contain phosducin, a soluble phosphoprotein that complexes with the beta/gamma-subunits of the GTP-binding protein, transducin Back     alignment and domain information
>PLN02309 5'-adenylylsulfate reductase Back     alignment and domain information
>cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>KOG4277 consensus Uncharacterized conserved protein, contains thioredoxin domain [General function prediction only] Back     alignment and domain information
>KOG0910 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain Back     alignment and domain information
>cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD Back     alignment and domain information
>PF13728 TraF: F plasmid transfer operon protein Back     alignment and domain information
>cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains Back     alignment and domain information
>TIGR01068 thioredoxin thioredoxin Back     alignment and domain information
>cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>cd03067 PDI_b_PDIR_N PDIb family, PDIR subfamily, N-terminal TRX-like b domain; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>cd03068 PDI_b_ERp72 PDIb family, ERp72 subfamily, first redox inactive TRX-like domain b; ERp72 exhibits both disulfide oxidase and reductase functions like PDI, by catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER and acting as isomerases to correct any non-native disulfide bonds Back     alignment and domain information
>cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus Back     alignment and domain information
>cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX Back     alignment and domain information
>TIGR02180 GRX_euk Glutaredoxin Back     alignment and domain information
>PRK09381 trxA thioredoxin; Provisional Back     alignment and domain information
>cd03072 PDI_b'_ERp44 PDIb' family, ERp44 subfamily, second redox inactive TRX-like domain b'; ERp44 is an endoplasmic reticulum (ER)-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>PF00578 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Peroxiredoxins (Prxs) are a ubiquitous family of antioxidant enzymes that also control cytokine-induced peroxide levels which mediate signal transduction in mammalian cells Back     alignment and domain information
>PRK10996 thioredoxin 2; Provisional Back     alignment and domain information
>cd03072 PDI_b'_ERp44 PDIb' family, ERp44 subfamily, second redox inactive TRX-like domain b'; ERp44 is an endoplasmic reticulum (ER)-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>cd02983 P5_C P5 family, C-terminal redox inactive TRX-like domain; P5 is a protein disulfide isomerase (PDI)-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>cd03017 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides Back     alignment and domain information
>KOG2603 consensus Oligosaccharyltransferase, gamma subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02278 thioredoxin-like protein Back     alignment and domain information
>PTZ00443 Thioredoxin domain-containing protein; Provisional Back     alignment and domain information
>cd02991 UAS_ETEA UAS family, ETEA subfamily; composed of proteins similar to human ETEA protein, the translation product of a highly expressed gene in the T-cells and eosinophils of atopic dermatitis patients compared with those of normal individuals Back     alignment and domain information
>TIGR02739 TraF type-F conjugative transfer system pilin assembly protein TraF Back     alignment and domain information
>cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus Back     alignment and domain information
>cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif Back     alignment and domain information
>KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06110 DUF953: Eukaryotic protein of unknown function (DUF953); InterPro: IPR010357 This family consists of several hypothetical eukaryotic proteins of unknown function that are thioredoxin-like Back     alignment and domain information
>PTZ00256 glutathione peroxidase; Provisional Back     alignment and domain information
>TIGR01626 ytfJ_HI0045 conserved hypothetical protein YtfJ-family, TIGR01626 Back     alignment and domain information
>cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains Back     alignment and domain information
>PRK09437 bcp thioredoxin-dependent thiol peroxidase; Reviewed Back     alignment and domain information
>PRK13703 conjugal pilus assembly protein TraF; Provisional Back     alignment and domain information
>KOG2501 consensus Thioredoxin, nucleoredoxin and related proteins [General function prediction only] Back     alignment and domain information
>cd03015 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides Back     alignment and domain information
>cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding Back     alignment and domain information
>cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein Back     alignment and domain information
>cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein Back     alignment and domain information
>PRK10606 btuE putative glutathione peroxidase; Provisional Back     alignment and domain information
>KOG0912 consensus Thiol-disulfide isomerase and thioredoxin [Posttranslational modification, protein turnover, chaperones; Energy production and conversion] Back     alignment and domain information
>PRK00522 tpx lipid hydroperoxide peroxidase; Provisional Back     alignment and domain information
>cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif Back     alignment and domain information
>cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions Back     alignment and domain information
>cd02970 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>KOG0907 consensus Thioredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3425 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions Back     alignment and domain information
>TIGR03137 AhpC peroxiredoxin Back     alignment and domain information
>PRK11200 grxA glutaredoxin 1; Provisional Back     alignment and domain information
>PF07912 ERp29_N: ERp29, N-terminal domain; InterPro: IPR012883 ERp29 (P52555 from SWISSPROT) is a ubiquitously expressed endoplasmic reticulum protein, and is involved in the processes of protein maturation and protein secretion in this organelle [, ] Back     alignment and domain information
>cd03014 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 2-cys PRX subfamily; composed of PRXs containing peroxidatic and resolving cysteines, similar to the homodimeric thiol specific antioxidant (TSA) protein also known as TRX-dependent thiol peroxidase (Tpx) Back     alignment and domain information
>cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>cd02986 DLP Dim1 family, Dim1-like protein (DLP) subfamily; DLP is a novel protein which shares 38% sequence identity to Dim1 Back     alignment and domain information
>cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains Back     alignment and domain information
>cd02968 SCO SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold Back     alignment and domain information
>cd03018 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-like subfamily; composed of proteins similar to Mycobacterium tuberculosis AhpE Back     alignment and domain information
>cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile Back     alignment and domain information
>cd02971 PRX_family Peroxiredoxin (PRX) family; composed of the different classes of PRXs including many proteins originally known as bacterioferritin comigratory proteins (BCP), based on their electrophoretic mobility before their function was identified Back     alignment and domain information
>PRK10382 alkyl hydroperoxide reductase subunit C; Provisional Back     alignment and domain information
>PLN00410 U5 snRNP protein, DIM1 family; Provisional Back     alignment and domain information
>cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation Back     alignment and domain information
>cd03020 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold Back     alignment and domain information
>KOG0911 consensus Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>cd03073 PDI_b'_ERp72_ERp57 PDIb' family, ERp72 and ERp57 subfamily, second redox inactive TRX-like domain b'; ERp72 and ER57 are involved in oxidative protein folding in the ER, like PDI Back     alignment and domain information
>KOG1672 consensus ATP binding protein [Posttranslational modification, protein turnover, chaperones; Energy production and conversion] Back     alignment and domain information
>PRK10877 protein disulfide isomerase II DsbC; Provisional Back     alignment and domain information
>cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02972 DsbA_family DsbA family; consists of DsbA and DsbA-like proteins, including DsbC, DsbG, glutathione (GSH) S-transferase kappa (GSTK), 2-hydroxychromene-2-carboxylate (HCCA) isomerase, an oxidoreductase (FrnE) presumed to be involved in frenolicin biosynthesis, a 27-kDa outer membrane protein, and similar proteins Back     alignment and domain information
>PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>cd03074 PDI_b'_Calsequestrin_C Protein Disulfide Isomerase (PDIb') family, Calsequestrin subfamily, C-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle Back     alignment and domain information
>PF07449 HyaE: Hydrogenase-1 expression protein HyaE; InterPro: IPR010893 This family contains bacterial hydrogenase-1 expression proteins approximately 120 residues long Back     alignment and domain information
>TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 Back     alignment and domain information
>cd02988 Phd_like_VIAF Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis Back     alignment and domain information
>PRK15000 peroxidase; Provisional Back     alignment and domain information
>PF14595 Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A Back     alignment and domain information
>KOG2640 consensus Thioredoxin [Function unknown] Back     alignment and domain information
>cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>COG2143 Thioredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03190 Thioredox_DsbH: Protein of unknown function, DUF255; InterPro: IPR004879 This is a group of uncharacterised proteins Back     alignment and domain information
>cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein Back     alignment and domain information
>KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] Back     alignment and domain information
>PRK13190 putative peroxiredoxin; Provisional Back     alignment and domain information
>cd03023 DsbA_Com1_like DsbA family, Com1-like subfamily; composed of proteins similar to Com1, a 27-kDa outer membrane-associated immunoreactive protein originally found in both acute and chronic disease strains of the pathogenic bacteria Coxiella burnetti Back     alignment and domain information
>cd03071 PDI_b'_NRX PDIb' family, NRX subgroup, redox inactive TRX-like domain b'; composed of vertebrate nucleoredoxins (NRX) Back     alignment and domain information
>PTZ00253 tryparedoxin peroxidase; Provisional Back     alignment and domain information
>PF01216 Calsequestrin: Calsequestrin; InterPro: IPR001393 Calsequestrin is the principal calcium-binding protein present in the sarcoplasmic reticulum of cardiac and skeletal muscle [] Back     alignment and domain information
>TIGR02183 GRXA Glutaredoxin, GrxA family Back     alignment and domain information
>PTZ00051 thioredoxin; Provisional Back     alignment and domain information
>TIGR02190 GlrX-dom Glutaredoxin-family domain Back     alignment and domain information
>TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PTZ00062 glutaredoxin; Provisional Back     alignment and domain information
>cd03019 DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a monomeric thiol disulfide oxidoreductase protein containing a redox active CXXC motif imbedded in a TRX fold Back     alignment and domain information
>PF02114 Phosducin: Phosducin; InterPro: IPR024253 The outer and inner segments of vertebrate rod photoreceptor cells contain phosducin, a soluble phosphoprotein that complexes with the beta/gamma-subunits of the GTP-binding protein, transducin Back     alignment and domain information
>cd03066 PDI_b_Calsequestrin_middle PDIb family, Calsequestrin subfamily, Middle TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle Back     alignment and domain information
>PRK10329 glutaredoxin-like protein; Provisional Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13599 putative peroxiredoxin; Provisional Back     alignment and domain information
>KOG3414 consensus Component of the U4/U6 Back     alignment and domain information
>cd03016 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>cd02952 TRP14_like Human TRX-related protein 14 (TRP14)-like family; composed of proteins similar to TRP14, a 14kD cytosolic protein that shows disulfide reductase activity in vitro with a different substrate specificity compared with another human cytosolic protein, TRX1 Back     alignment and domain information
>cd03069 PDI_b_ERp57 PDIb family, ERp57 subfamily, first redox inactive TRX-like domain b; ERp57 (or ERp60) exhibits both disulfide oxidase and reductase functions like PDI, by catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER and acting as isomerases to correct any non-native disulfide bonds Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information
>cd03067 PDI_b_PDIR_N PDIb family, PDIR subfamily, N-terminal TRX-like b domain; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>cd02958 UAS UAS family; UAS is a domain of unknown function Back     alignment and domain information
>TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH Back     alignment and domain information
>PF07449 HyaE: Hydrogenase-1 expression protein HyaE; InterPro: IPR010893 This family contains bacterial hydrogenase-1 expression proteins approximately 120 residues long Back     alignment and domain information
>PF11009 DUF2847: Protein of unknown function (DUF2847); InterPro: IPR022551 Members of this protein family, including YtxJ from Bacillus subtilis, occur in species that encode proteins for synthesizing bacillithiol Back     alignment and domain information
>TIGR02181 GRX_bact Glutaredoxin, GrxC family Back     alignment and domain information
>cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions Back     alignment and domain information
>cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria Back     alignment and domain information
>KOG3171 consensus Conserved phosducin-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG3170 consensus Conserved phosducin-like protein [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00137 2-Cys peroxiredoxin; Provisional Back     alignment and domain information
>TIGR02740 TraF-like TraF-like protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query689
3apq_A210 Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt 1e-11
3apo_A780 Crystal Structure Of Full-Length Erdj5 Length = 780 1e-10
2o37_A92 J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S 8e-05
2lo1_A71 Nmr Structure Of The Protein Bc008182, A Dnaj-Like 2e-04
2och_A73 J-domain Of Dnj-12 From Caenorhabditis Elegans Leng 8e-04
>pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 Back     alignment and structure 
Iteration: 1

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 85/186 (45%), Gaps = 13/186 (6%)
Query: 40  YDALGIKPYSSVEQVKEAYEKFSSKWNSGEEIPST----ADFLKIQYAYELLTDPLWKRN 95
           Y  LG+   +S  ++++A++K + K +  ++ P+      DFLKI  AYE+L D   ++ 
Sbjct: 5   YSLLGVSKTASSREIRQAFKKLALKLHP-DKNPNNPNAHGDFLKINRAYEVLKDEDLRKK 63
Query: 96  YDVYGIDEQLHILEKVREQYGEESYSRIDLPLLDATDHSVHAFNVVTSEDFPSIFHDSKP 155
           YD YG   +  + +    QY   SY R D  + D     +     +   +F +  +  + 
Sbjct: 64  YDKYG---EKGLEDNQGGQYESWSYYRYDFGIYDDDPEII----TLERREFDAAVNSGEL 116
Query: 156 WLIQVYSDGSYLCGQFSGAWKTIAALLEGIANTGMVELGDIRLATHLAERKPIGQIF-FR 214
           W +  YS G   C   +  W+  A  ++G+   G V  GD R+   +        +F FR
Sbjct: 117 WFVNFYSPGCSHCHDLAPTWREFAKEVDGLLRIGAVNCGDDRMLCRMKGVNSYPSLFIFR 176
Query: 215 RGLPSL 220
            G+ ++
Sbjct: 177 SGMAAV 182
>pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 Back     alignment and structure
>pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 Back     alignment and structure
>pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query689
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 1e-19
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 4e-15
3apo_A780 DNAJ homolog subfamily C member 10; PDI family, th 4e-11
3apo_A780 DNAJ homolog subfamily C member 10; PDI family, th 4e-04
3us3_A367 Calsequestrin-1; calcium-binding protein; 1.74A {O 1e-08
3t58_A519 Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 6e-08
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 8e-08
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 7e-07
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 7e-07
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 1e-06
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 1e-06
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 1e-06
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 1e-06
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 2e-06
2r2j_A382 Thioredoxin domain-containing protein 4; CRFS moti 4e-06
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 4e-06
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 6e-06
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 7e-06
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 2e-05
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 3e-05
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 3e-05
2b5e_A504 Protein disulfide-isomerase; 2.40A {Saccharomyces 4e-05
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 5e-05
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 5e-05
3idv_A241 Protein disulfide-isomerase A4; thioredoxin-like f 6e-05
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 8e-05
3q6o_A244 Sulfhydryl oxidase 1; protein disulfide isomerase, 1e-04
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 1e-04
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 4e-04
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
 Score = 87.2 bits (216), Expect = 1e-19
 Identities = 47/213 (22%), Positives = 84/213 (39%), Gaps = 25/213 (11%)

Query: 40  YDALGIKPYSSVEQVKEAYEKFSSKW----NSGEEIPSTADFLKIQYAYELLTDPLWKRN 95
           Y  LG+   +S  ++++A++K + K     N      +  DFLKI  AYE+L D   ++ 
Sbjct: 5   YSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNP-NAHGDFLKINRAYEVLKDEDLRKK 63

Query: 96  YDVYGIDEQLHILEKVREQYGEESYSRIDLPLLDATDHSVHAFNVVTSEDFPSIFHDSKP 155
           YD YG        + + +  G +  S                   +   +F +  +  + 
Sbjct: 64  YDKYG-----E--KGLEDNQGGQYESWSYYRYDFGIYDDDPEIITLERREFDAAVNSGEL 116

Query: 156 WLIQVYSDGSYLCGQFSGAWKTIAALLEGIANTGMVELGDIRLATHLAERKPIGQIFFRR 215
           W +  YS G   C   +  W+  A  ++G+   G V  GD R    L   K +       
Sbjct: 117 WFVNFYSPGCSHCHDLAPTWREFAKEVDGLLRIGAVNCGDDR---MLCRMKGV------N 167

Query: 216 GLPSLVAFPPGCKSSDCMTRFEGELSVDAVTDW 248
             PSL  F  G  +     ++ G+ S +++  +
Sbjct: 168 SYPSLFIFRSGMAA----VKYNGDRSKESLVAF 196
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3trq_A* 3trp_A* 3uom_A Length = 367 Back     alignment and structure
>3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* Length = 519 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
>2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} Length = 382 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Length = 504 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Length = 241 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} Length = 244 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 689
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 8e-08
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing prote 1e-07
d1hdja_77 a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 3e-07
d1xbla_75 a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain 5e-07
d2djja1116 c.47.1.2 (A:6-121) Protein disulfide isomerase, PD 3e-04
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 4e-04
d1gh6a_114 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 7e-04
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 0.001
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: Large T antigen, the N-terminal J domain
species: Murine polyomavirus [TaxId: 10634]

 Score = 47.7 bits (113), Expect = 8e-08
 Identities = 11/77 (14%), Positives = 30/77 (38%), Gaps = 3/77 (3%)

Query: 30  VLPRSFPPSHYDALGIKPY--SSVEQVKEAYEKFSSKWNSGEEIPSTADFLKIQYAYELL 87
           VL R+      + L +         ++++AY++ S   +  ++  S A   ++   +   
Sbjct: 4   VLSRADKERLLELLKLPRQLWGDFGRMQQAYKQQSLLLHP-DKGGSHALMQELNSLWGTF 62

Query: 88  TDPLWKRNYDVYGIDEQ 104
              ++    ++ G   Q
Sbjct: 63  KTEVYNLRMNLGGTGFQ 79
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure
>d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Length = 116 Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query689
d2b5ea4119 Protein disulfide isomerase, PDI {Baker's yeast (S 99.9
d1a8ya1124 Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax 99.89
d2b5ea1140 Protein disulfide isomerase, PDI {Baker's yeast (S 99.88
d2djja1116 Protein disulfide isomerase, PDI {Fungi (Humicola 99.87
d2c0ga2122 Windbeutel, N-terminal domain {Fruit fly (Drosophi 99.87
d1meka_120 Protein disulfide isomerase, PDI {Human (Homo sapi 99.87
d1g7ea_122 Endoplasmic reticulum protein ERP29, N-terminal do 99.86
d1thxa_108 Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} 99.85
d1fb6a_104 Thioredoxin {Spinach (Spinacia oleracea), thioredo 99.84
d2trxa_108 Thioredoxin {Escherichia coli [TaxId: 562]} 99.84
d1dbya_107 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 99.83
d1nw2a_105 Thioredoxin {Alicyclobacillus acidocaldarius, form 99.83
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.76
d1ep7a_112 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 99.73
d1f9ma_112 Thioredoxin {Spinach (Spinacia oleracea), thioredo 99.73
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.72
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.71
d1xwaa_111 Thioredoxin {Fruit fly (Drosophila melanogaster) [ 99.69
d2hfda1132 Hydrogenase-1 operon protein HyaE {Escherichia col 99.69
d2es7a1119 Hydrogenase-1 operon protein HyaE {Salmonella typh 99.68
d1xfla_114 Thioredoxin {Thale cress (Arabidopsis thaliana) [T 99.68
d1ti3a_113 Thioredoxin {European aspen (Populus tremula), thi 99.68
d1qgva_137 spliceosomal protein U5-15Kd {Human (Homo sapiens) 99.67
d1gh2a_107 Thioredoxin-like protein, N-terminal domain {Human 99.66
d1syra_103 Thioredoxin {Malarial parasite (Plasmodium falcipa 99.66
d1r26a_113 Thioredoxin {Trypanosoma brucei [TaxId: 5691]} 99.66
d2ifqa1105 Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} 99.66
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.65
d1a8la2107 Protein disulfide isomerase, PDI {Archaeon Pyrococ 99.64
d1fo5a_85 MJ0307, thioredoxin/glutaredoxin-like protein {Arc 99.64
d1zmaa1115 Bacterocin transport accessory protein Bta {Strept 99.62
d1nhoa_85 MTH807, thioredoxin/glutaredoxin-like protein {Arc 99.61
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.53
d1woua_119 Putative 42-9-9 protein (thioredoxin containing pr 99.51
d1hyua496 Alkyl hydroperoxide reductase subunit F (AhpF), N- 99.47
d2fwha1117 Thiol:disulfide interchange protein DsbD, C-termin 99.46
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.4
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.36
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.35
d2trcp_217 Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.27
d1sena_135 Thioredoxin-like protein p19, TLP19 {Human (Homo s 98.88
d1zzoa1134 Lipoprotein DsbF {Mycobacterium tuberculosis [TaxI 98.88
d2djka1133 Protein disulfide isomerase, PDI {Fungi (Humicola 98.87
d2fy6a1143 Peptide methionine sulfoxide reductase MsrA/MsrB, 98.83
d1bjxa_110 Protein disulfide isomerase, PDI {Human (Homo sapi 98.8
d2dlxa1147 UBX domain-containing protein 7 {Human (Homo sapie 98.74
d1lu4a_134 Soluble secreted antigen MPT53 {Mycobacterium tube 98.69
d2b5xa1143 thiol:disulfide oxidoreductase YkuV {Bacillus subt 98.65
d1knga_144 Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyr 98.6
d1z5ye1136 Thioredoxin-like protein CcmG (CycY, DsbE) {Escher 98.59
d1st9a_137 Thiol-disulfide oxidoreductase ResA {Bacillus subt 98.56
d1a8ya2102 Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax 98.49
d1i5ga_144 Tryparedoxin II {Crithidia fasciculata [TaxId: 565 98.49
d2b5ea4119 Protein disulfide isomerase, PDI {Baker's yeast (S 98.36
d2cvba1187 Probable thiol-disulfide isomerase/thioredoxin TTH 98.31
d1wjka_100 Thioredoxin-like structure containing protein C330 98.31
d1o73a_144 Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 98.27
d1jfua_176 Membrane-anchored thioredoxin-like protein TlpA, s 98.23
d1a8ya1124 Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax 98.2
d1thxa_108 Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} 98.18
d1meka_120 Protein disulfide isomerase, PDI {Human (Homo sapi 98.15
d1o8xa_144 Tryparedoxin I {Crithidia fasciculata [TaxId: 5656 98.11
d2b5ea1140 Protein disulfide isomerase, PDI {Baker's yeast (S 98.0
d1nw2a_105 Thioredoxin {Alicyclobacillus acidocaldarius, form 98.0
d2b5ea3125 Protein disulfide isomerase, PDI {Baker's yeast (S 97.97
d2djja1116 Protein disulfide isomerase, PDI {Fungi (Humicola 97.94
d1g7ea_122 Endoplasmic reticulum protein ERP29, N-terminal do 97.94
d2c0ga2122 Windbeutel, N-terminal domain {Fruit fly (Drosophi 97.94
d1fb6a_104 Thioredoxin {Spinach (Spinacia oleracea), thioredo 97.92
d1dbya_107 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 97.91
d1ep7a_112 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 97.9
d2trxa_108 Thioredoxin {Escherichia coli [TaxId: 562]} 97.85
d1xwaa_111 Thioredoxin {Fruit fly (Drosophila melanogaster) [ 97.77
d1z6na1166 Hypothetical protein PA1234 {Pseudomonas aeruginos 97.68
d1syra_103 Thioredoxin {Malarial parasite (Plasmodium falcipa 97.67
d2hfda1132 Hydrogenase-1 operon protein HyaE {Escherichia col 97.58
d2es7a1119 Hydrogenase-1 operon protein HyaE {Salmonella typh 97.55
d1qgva_137 spliceosomal protein U5-15Kd {Human (Homo sapiens) 97.52
d1gh2a_107 Thioredoxin-like protein, N-terminal domain {Human 97.48
d1ti3a_113 Thioredoxin {European aspen (Populus tremula), thi 97.47
d1r26a_113 Thioredoxin {Trypanosoma brucei [TaxId: 5691]} 97.42
d2djka1133 Protein disulfide isomerase, PDI {Fungi (Humicola 97.39
d1xfla_114 Thioredoxin {Thale cress (Arabidopsis thaliana) [T 97.38
d1f9ma_112 Thioredoxin {Spinach (Spinacia oleracea), thioredo 97.35
d1fo5a_85 MJ0307, thioredoxin/glutaredoxin-like protein {Arc 97.3
d2ifqa1105 Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} 97.24
d1eeja1156 Disulfide bond isomerase, DsbC, C-terminal domain 97.22
d1zmaa1115 Bacterocin transport accessory protein Bta {Strept 97.11
d1a8la2107 Protein disulfide isomerase, PDI {Archaeon Pyrococ 97.02
d1nhoa_85 MTH807, thioredoxin/glutaredoxin-like protein {Arc 97.02
d1woua_119 Putative 42-9-9 protein (thioredoxin containing pr 96.85
d2trcp_217 Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} 96.65
d1z6ma1172 Hypothetical protein EF0770 {Enterococcus faecalis 96.64
d2cx4a1160 Bacterioferritin comigratory protein {Archaeon Aer 96.61
d1bjxa_110 Protein disulfide isomerase, PDI {Human (Homo sapi 96.54
d2b5ea3125 Protein disulfide isomerase, PDI {Baker's yeast (S 96.41
d2bmxa1169 Alkyl hydroperoxide reductase AhpC {Mycobacterium 96.37
d1t3ba1150 Disulfide bond isomerase, DsbC, C-terminal domain 96.35
d1e2ya_167 Tryparedoxin peroxidase (thioredoxin peroxidase ho 96.24
d2a4va1156 Peroxiredoxin dot5 {Baker's yeast (Saccharomyces c 96.24
d2fwha1117 Thiol:disulfide interchange protein DsbD, C-termin 95.94
d1hyua496 Alkyl hydroperoxide reductase subunit F (AhpF), N- 95.7
d1zofa1170 Thioredoxin reductase TsaA {Helicobacter pylori [T 95.64
d1a8ya2102 Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax 95.61
d2h01a1170 Thioredoxin peroxidase 2 (thioredoxin peroxidase B 95.55
d1we0a1166 Alkyl hydroperoxide reductase AhpC {Amphibacillus 95.43
d2zcta1237 Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} 95.2
d1v58a1169 Thiol:disulfide interchange protein DsbG, C-termin 94.94
d1zyea1158 Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [ 94.82
d2dlxa1147 UBX domain-containing protein 7 {Human (Homo sapie 94.75
d1a8la1119 Protein disulfide isomerase, PDI {Archaeon Pyrococ 94.6
d1a8ya3119 Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax 94.42
d1uula_194 Tryparedoxin peroxidase (thioredoxin peroxidase ho 94.02
d1qxha_164 Thiol peroxidase Tpx {Escherichia coli [TaxId: 562 93.94
d2f8aa1184 Glutathione peroxidase {Human (Homo sapiens) [TaxI 93.86
d1r7ha_74 Glutaredoxin-like NRDH-redoxin {Corynebacterium am 93.38
d1q98a_164 Thiol peroxidase Tpx {Haemophilus influenzae [TaxI 93.16
d1n8ja_186 Alkyl hydroperoxide reductase AhpC {Salmonella typ 92.98
d1iloa_77 MTH985, a thioredoxin {Archaeon Methanobacterium t 92.6
d1h75a_76 Glutaredoxin-like NRDH-redoxin {Escherichia coli [ 92.46
d1xvwa1153 Putative peroxiredoxin Rv2238c/MT2298 {Mycobacteri 91.88
d1beda_181 Disulfide-bond formation facilitator (DsbA) {Vibri 91.7
d1xzoa1172 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 90.98
d1qmva_197 Thioredoxin peroxidase 2 (thioredoxin peroxidase B 90.74
d1egoa_85 Glutaredoxin (Grx, thioltransferase) {Escherichia 89.79
d1fvka_188 Disulfide-bond formation facilitator (DsbA) {Esche 87.74
d1psqa_163 Probable thiol peroxidase PsaD {Streptococcus pneu 87.55
d1un2a_195 Disulfide-bond formation facilitator (DsbA) {Esche 87.33
d1wp0a1160 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 87.22
d1nm3a174 C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus 85.68
d1xvqa_166 Thiol peroxidase Tpx {Mycobacterium tuberculosis [ 84.55
d1prxa_220 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 83.4
d1fova_82 Glutaredoxin (Grx, thioltransferase) {Escherichia 81.18
d1ktea_105 Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr 80.51
>d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: PDI-like
domain: Protein disulfide isomerase, PDI
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.90  E-value=1.6e-24  Score=158.32  Aligned_cols=109  Identities=14%  Similarity=0.207  Sum_probs=96.4

Q ss_pred             CCCCEEEEECCCCCCCCCCCCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHC-CCCEEEEECCHHHHHHHHHHHCCCCCC
Q ss_conf             8752069925789766347999779999739996776843999999999722-342100012202455587762898733
Q 005592          133 HSVHAFNVVTSEDFPSIFHDSKPWLIQVYSDGSYLCGQFSGAWKTIAALLEG-IANTGMVELGDIRLATHLAERKPIGQI  211 (689)
Q Consensus       133 ~~~~~V~~Lt~~nF~~~I~~~~~~LV~FYapwCghCk~laP~w~evA~~L~g-~~~va~VDc~e~~~~~~La~k~~i~~~  211 (689)
                      |..+.|+.||.++|++.|.+++.|||+||+|||++|+++.|+|+++|..+.+ .+.+|.|||++++   .+|++++    
T Consensus         7 ~~~s~v~~lt~~~f~~~i~~~~~~lV~fya~wC~~C~~~~~~~~~la~~~~~~~v~~~~vd~~~~~---~l~~~~~----   79 (119)
T d2b5ea4           7 PEDSAVVKLATDSFNEYIQSHDLVLAEFFAPWCGHCKNMAPEYVKAAETLVEKNITLAQIDCTENQ---DLCMEHN----   79 (119)
T ss_dssp             CTTSSCEECCTTTHHHHHTTCSEEEEEEECTTCHHHHHHHHHHHHHHHHTTTTTCEEEEEETTTCH---HHHHHTT----
T ss_pred             CCCCCCEECCHHHHHHHHHCCCEEEEEEECCCCCCCCCCCHHHHHHHHHHCCCCEEEEEEECCCHH---HHHHHHC----
T ss_conf             999951892788899998569949999977866764322134433222221211046653022448---8888753----


Q ss_pred             CCCCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             42023018997499997999822124665888999999997
Q 005592          212 FFRRGLPSLVAFPPGCKSSDCMTRFEGELSVDAVTDWFATA  252 (689)
Q Consensus       212 F~V~gyPTI~lf~~g~~~~~~~~~Y~G~rs~~~Iv~fi~k~  252 (689)
                        |.++|||++|++|...  ....|.|.++.+.|++|+.++
T Consensus        80 --v~~~Pti~~f~~g~~~--~~~~y~g~~~~~~l~~fi~k~  116 (119)
T d2b5ea4          80 --IPGFPSLKIFKNSDVN--NSIDYEGPRTAEAIVQFMIKQ  116 (119)
T ss_dssp             --CCSSSEEEEEETTCTT--CEEECCSCCSHHHHHHHHHHH
T ss_pred             --CCCCCEEEEEECCEEE--EEEEECCCCCHHHHHHHHHHH
T ss_conf             --4569869999999881--007745989999999999986
>d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Back     information, alignment and structure
>d2c0ga2 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g7ea_ c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} Back     information, alignment and structure
>d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} Back     information, alignment and structure
>d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2trcp_ c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sena_ c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zzoa1 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2djka1 c.47.1.2 (A:1-133) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Back     information, alignment and structure
>d2fy6a1 c.47.1.10 (A:33-175) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]} Back     information, alignment and structure
>d1bjxa_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lu4a_ c.47.1.10 (A:) Soluble secreted antigen MPT53 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2b5xa1 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase YkuV {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1knga_ c.47.1.10 (A:) Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1z5ye1 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG (CycY, DsbE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1st9a_ c.47.1.10 (A:) Thiol-disulfide oxidoreductase ResA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1a8ya2 c.47.1.3 (A:127-228) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1i5ga_ c.47.1.10 (A:) Tryparedoxin II {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cvba1 c.47.1.10 (A:2-188) Probable thiol-disulfide isomerase/thioredoxin TTHA0593 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o73a_ c.47.1.10 (A:) Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 5702]} Back     information, alignment and structure
>d1jfua_ c.47.1.10 (A:) Membrane-anchored thioredoxin-like protein TlpA, soluble domain {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o8xa_ c.47.1.10 (A:) Tryparedoxin I {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d2b5ea3 c.47.1.2 (A:240-364) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Back     information, alignment and structure
>d1g7ea_ c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2c0ga2 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} Back     information, alignment and structure
>d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1z6na1 c.47.1.1 (A:1-166) Hypothetical protein PA1234 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} Back     information, alignment and structure
>d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2djka1 c.47.1.2 (A:1-133) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Back     information, alignment and structure
>d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} Back     information, alignment and structure
>d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eeja1 c.47.1.9 (A:61-216) Disulfide bond isomerase, DsbC, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2trcp_ c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1z6ma1 c.47.1.13 (A:1-172) Hypothetical protein EF0770 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2cx4a1 c.47.1.10 (A:4-163) Bacterioferritin comigratory protein {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1bjxa_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ea3 c.47.1.2 (A:240-364) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bmxa1 c.47.1.10 (A:2-170) Alkyl hydroperoxide reductase AhpC {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1t3ba1 c.47.1.9 (A:61-210) Disulfide bond isomerase, DsbC, C-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e2ya_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2a4va1 c.47.1.10 (A:59-214) Peroxiredoxin dot5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1zofa1 c.47.1.10 (A:1-170) Thioredoxin reductase TsaA {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1a8ya2 c.47.1.3 (A:127-228) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2h01a1 c.47.1.10 (A:2-171) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d1we0a1 c.47.1.10 (A:1-166) Alkyl hydroperoxide reductase AhpC {Amphibacillus xylanus [TaxId: 1449]} Back     information, alignment and structure
>d2zcta1 c.47.1.10 (A:6-242) Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1v58a1 c.47.1.9 (A:62-230) Thiol:disulfide interchange protein DsbG, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zyea1 c.47.1.10 (A:6-163) Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a8la1 c.47.1.2 (A:1-119) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1a8ya3 c.47.1.3 (A:229-347) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1uula_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1qxha_ c.47.1.10 (A:) Thiol peroxidase Tpx {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f8aa1 c.47.1.10 (A:12-195) Glutathione peroxidase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} Back     information, alignment and structure
>d1q98a_ c.47.1.10 (A:) Thiol peroxidase Tpx {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1n8ja_ c.47.1.10 (A:) Alkyl hydroperoxide reductase AhpC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1iloa_ c.47.1.1 (A:) MTH985, a thioredoxin {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xvwa1 c.47.1.10 (A:1-153) Putative peroxiredoxin Rv2238c/MT2298 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1beda_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1xzoa1 c.47.1.10 (A:3-174) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qmva_ c.47.1.10 (A:) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fvka_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1psqa_ c.47.1.10 (A:) Probable thiol peroxidase PsaD {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1un2a_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wp0a1 c.47.1.10 (A:138-297) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1xvqa_ c.47.1.10 (A:) Thiol peroxidase Tpx {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1prxa_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} Back     information, alignment and structure
>d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure