Citrus Sinensis ID: 005607
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 688 | 2.2.26 [Sep-21-2011] | |||||||
| Q9CAE3 | 789 | Lysine-specific histone d | no | no | 0.922 | 0.804 | 0.780 | 0.0 | |
| Q01H90 | 811 | Lysine-specific histone d | N/A | no | 0.938 | 0.796 | 0.724 | 0.0 | |
| Q7XUR2 | 811 | Lysine-specific histone d | yes | no | 0.938 | 0.796 | 0.723 | 0.0 | |
| Q8VXV7 | 844 | Lysine-specific histone d | no | no | 0.886 | 0.722 | 0.560 | 0.0 | |
| Q9LID0 | 746 | Lysine-specific histone d | no | no | 0.893 | 0.824 | 0.527 | 1e-180 | |
| Q6Z690 | 849 | Lysine-specific histone d | no | no | 0.879 | 0.712 | 0.540 | 1e-179 | |
| Q6YYZ1 | 763 | Lysine-specific histone d | no | no | 0.909 | 0.820 | 0.516 | 1e-172 | |
| Q8NB78 | 822 | Lysine-specific histone d | yes | no | 0.678 | 0.568 | 0.349 | 2e-73 | |
| Q8CIG3 | 826 | Lysine-specific histone d | yes | no | 0.675 | 0.562 | 0.347 | 3e-70 | |
| Q6ZQ88 | 853 | Lysine-specific histone d | no | no | 0.406 | 0.328 | 0.455 | 1e-68 |
| >sp|Q9CAE3|LDL3_ARATH Lysine-specific histone demethylase 1 homolog 3 OS=Arabidopsis thaliana GN=FLD PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 1046 bits (2706), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 504/646 (78%), Positives = 569/646 (88%), Gaps = 11/646 (1%)
Query: 1 MFTESVPKHCHSLLDSAYNYLVSNGYINFGVAPEIKEKIPVEPSSNKLRVLVIGAGLAGL 60
MF S+PKHC SLLDSAYNYLV++GYINFG+A IK+K P + S+K V+++GAGL+GL
Sbjct: 140 MFLNSIPKHCSSLLDSAYNYLVTHGYINFGIAQAIKDKFPAQ--SSKSSVIIVGAGLSGL 197
Query: 61 AAARQLMRLGFRVTVLEGRKRAGGRVYTKKMEGGAGNRISASADLGGSVLTGTLGNPLGI 120
AAARQLMR GF+VTVLEGRKR GGRVYTKKME NR+ A+ADLGGSVLTGTLGNPLGI
Sbjct: 198 AAARQLMRFGFKVTVLEGRKRPGGRVYTKKMEA---NRVGAAADLGGSVLTGTLGNPLGI 254
Query: 121 LAKQLGSLLHKVRDKCPLYRLDGNSVDPEIDMKVEADFNRLLDKASRLRQLMGEVAMDVS 180
+A+QLGS L+KVRDKCPLYR+DG VDP++D+KVE FN+LLDKAS+LRQLMG+V+MDVS
Sbjct: 255 IARQLGSSLYKVRDKCPLYRVDGKPVDPDVDIKVEVAFNQLLDKASKLRQLMGDVSMDVS 314
Query: 181 LGSALETFWRVYWDSGNAEAMNLFNWHLANLEYANASLLSKLSLAFWDQDDPYDMGGDHC 240
LG+ALETF +V + E M LFNWHLANLEYANA L+SKLSLAFWDQDDPYDMGGDHC
Sbjct: 315 LGAALETFRQVSGNDVATEEMGLFNWHLANLEYANAGLVSKLSLAFWDQDDPYDMGGDHC 374
Query: 241 FLPGGNGRLVQALVENVPILYEKTVHTIRYGSDGVQVLAGSQVFEGDMVLCTVPLGVLKS 300
FLPGGNGRLVQAL ENVPILYEKTV TIRYGS+GV+V AG+QV+EGDMVLCTVPLGVLK+
Sbjct: 375 FLPGGNGRLVQALAENVPILYEKTVQTIRYGSNGVKVTAGNQVYEGDMVLCTVPLGVLKN 434
Query: 301 GSIKFIPELPQRKLDAIKRLGYGLLNKVAMLFPYVFWETDLDTFGHLTDDSSSRGEFFLF 360
GSIKF+PELPQRKLD IKRLG+GLLNKVAMLFPYVFW TDLDTFGHLT+D + RGEFFLF
Sbjct: 435 GSIKFVPELPQRKLDCIKRLGFGLLNKVAMLFPYVFWSTDLDTFGHLTEDPNYRGEFFLF 494
Query: 361 YSYATVAGGPLLIALVAGEAAHKFESMPPTDAVTKVLQILKGIYEPKGINVPEPIQTVCT 420
YSYA VAGG LLIALVAGEAAHKFE+MPPTDAVT+VL IL+GIYEP+GINVP+P+QTVCT
Sbjct: 495 YSYAPVAGGALLIALVAGEAAHKFETMPPTDAVTRVLHILRGIYEPQGINVPDPLQTVCT 554
Query: 421 RWGGDPFSLGSYSNVAVGASGDDYDIMAESVGDGRLFFAGEATIRRYPATMHGAFLSGLR 480
RWGGDPFSLGSYSNVAVGASGDDYDI+AESVGDGRLFFAGEAT RRYPATMHGAF++GLR
Sbjct: 555 RWGGDPFSLGSYSNVAVGASGDDYDILAESVGDGRLFFAGEATTRRYPATMHGAFVTGLR 614
Query: 481 ETAKMAHCANARALRMKVKVGKIPSKNAYSCASALTDLFREPDLEFGSFSVIFSWKNPDP 540
E A MA A AR +R ++ + PS+NA+SCA L DLFR+PDLEFGSF +IFS +NPDP
Sbjct: 615 EAANMAQSAKARGIRKRID--RNPSRNAHSCAILLADLFRDPDLEFGSFCIIFSRRNPDP 672
Query: 541 KSPSILRVTFNDPRKKNH---GDQPHSNKRLFEQLQSHFNQQQQLHVYTLLTRQQVLDLR 597
KSP+ILRVT ++PRK+N DQ HSNK LF+QLQSHFNQQQQ+ VYTLLTRQQ LDLR
Sbjct: 673 KSPAILRVTLSEPRKRNEDPKADQ-HSNKILFQQLQSHFNQQQQIQVYTLLTRQQALDLR 731
Query: 598 EVRGGDEMRLNFLCEKLGVKLIGRKGLGSTADSVISSIKAERGIRK 643
EVRGGDE RL +LCE LGVKL+GRKGLG ADSVI+SIKAER RK
Sbjct: 732 EVRGGDEKRLYYLCETLGVKLVGRKGLGVGADSVIASIKAERTGRK 777
|
Probable histone demethylase that promotes flowering independently of the photoperiod and vernalization pathways by repressing FLOWERING LOCUS C (FLC), a floral repressor that blocks the transition from vegetative to reproductive development. Probably mediates histone H3 'Lys-4' demethylation at FLC locus. Seems to act in partial redundancy with LDL1 and LDL2 to repress FLC expression. Required for histone H4 deacetylation of FLC locus. May be a component of the histone deacetylase complex. Arabidopsis thaliana (taxid: 3702) EC: 1EC: .EC: -EC: .EC: -EC: .EC: - |
| >sp|Q01H90|LDL3_ORYSI Lysine-specific histone demethylase 1 homolog 3 OS=Oryza sativa subsp. indica GN=B0103C08-B0602B01.13 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q7XUR2|LDL3_ORYSJ Lysine-specific histone demethylase 1 homolog 3 OS=Oryza sativa subsp. japonica GN=Os04g0560300 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q8VXV7|LDL1_ARATH Lysine-specific histone demethylase 1 homolog 1 OS=Arabidopsis thaliana GN=LDL1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9LID0|LDL2_ARATH Lysine-specific histone demethylase 1 homolog 2 OS=Arabidopsis thaliana GN=LDL2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q6Z690|LDL1_ORYSJ Lysine-specific histone demethylase 1 homolog 1 OS=Oryza sativa subsp. japonica GN=Os02g0755200 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q6YYZ1|LDL2_ORYSJ Lysine-specific histone demethylase 1 homolog 2 OS=Oryza sativa subsp. japonica GN=Os08g0143400 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q8NB78|KDM1B_HUMAN Lysine-specific histone demethylase 1B OS=Homo sapiens GN=KDM1B PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q8CIG3|KDM1B_MOUSE Lysine-specific histone demethylase 1B OS=Mus musculus GN=Kdm1b PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q6ZQ88|KDM1A_MOUSE Lysine-specific histone demethylase 1A OS=Mus musculus GN=Kdm1a PE=1 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 688 | ||||||
| 224100737 | 811 | hypothetical protein POPTRDRAFT_353344 [ | 0.979 | 0.831 | 0.793 | 0.0 | |
| 225448966 | 992 | PREDICTED: lysine-specific histone demet | 0.937 | 0.650 | 0.820 | 0.0 | |
| 255577434 | 961 | amine oxidase, putative [Ricinus communi | 0.943 | 0.675 | 0.808 | 0.0 | |
| 356502918 | 865 | PREDICTED: lysine-specific histone demet | 0.957 | 0.761 | 0.801 | 0.0 | |
| 449444903 | 982 | PREDICTED: lysine-specific histone demet | 0.938 | 0.657 | 0.804 | 0.0 | |
| 449490506 | 982 | PREDICTED: LOW QUALITY PROTEIN: lysine-s | 0.938 | 0.657 | 0.803 | 0.0 | |
| 240255318 | 884 | lysine-specific histone demethylase 1 [A | 0.922 | 0.718 | 0.780 | 0.0 | |
| 297829566 | 789 | predicted protein [Arabidopsis lyrata su | 0.915 | 0.798 | 0.784 | 0.0 | |
| 75169873 | 789 | RecName: Full=Lysine-specific histone de | 0.922 | 0.804 | 0.780 | 0.0 | |
| 61661322 | 789 | flowering locus D [Arabidopsis thaliana] | 0.922 | 0.804 | 0.777 | 0.0 |
| >gi|224100737|ref|XP_002311993.1| hypothetical protein POPTRDRAFT_353344 [Populus trichocarpa] gi|222851813|gb|EEE89360.1| hypothetical protein POPTRDRAFT_353344 [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 1108 bits (2866), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 543/684 (79%), Positives = 598/684 (87%), Gaps = 10/684 (1%)
Query: 1 MFTESVPKHCHSLLDSAYNYLVSNGYINFGVAPEIKEKIPVEPSSNKLRVLVIGAGLAGL 60
MF SVPKHCH LL+SAYNYLVS GYINFGV+ IKE+ P E K V+V+GAGLAGL
Sbjct: 1 MFLNSVPKHCHGLLESAYNYLVSRGYINFGVSQSIKEQFPQE--DTKSNVIVVGAGLAGL 58
Query: 61 AAARQLMRLGFRVTVLEGRKRAGGRVYTKKMEGGAGNRISASADLGGSVLTGTLGNPLGI 120
+AARQLMRLGF+VTVLEGRKRAGGRVYTK+MEGGAGNR+SAS DLGGSVLTGTLGNPLGI
Sbjct: 59 SAARQLMRLGFKVTVLEGRKRAGGRVYTKRMEGGAGNRVSASVDLGGSVLTGTLGNPLGI 118
Query: 121 LAKQLGSLLHKVRDKCPLYRLDGNSVDPEIDMKVEADFNRLLDKASRLRQLMGEVAMDVS 180
LA+QLG +HKVRDKCPLY +DG VD ++DMKVE FNRLLDKASRLRQLMG+V++DVS
Sbjct: 119 LARQLGYSMHKVRDKCPLYSVDGKPVDLDMDMKVETAFNRLLDKASRLRQLMGDVSVDVS 178
Query: 181 LGSALETFWRVYWDSGNAEAMNLFNWHLANLEYANASLLSKLSLAFWDQDDPYDMGGDHC 240
LG+ALETF +VY D+ N E +NLFNWH ANLEYANA LLSKLSLAFWDQDDPYDMGGDHC
Sbjct: 179 LGAALETFRQVYEDAVNKEEINLFNWHCANLEYANAGLLSKLSLAFWDQDDPYDMGGDHC 238
Query: 241 FLPGGNGRLVQALVENVPILYEKTVHTIRYGSDGVQVLAGSQVFEGDMVLCTVPLGVLKS 300
FLPGGNGRLVQAL ENVPILYEKTVHT+RYGSDGV+V+AGSQVFEGDMVLCTVPLGVLKS
Sbjct: 239 FLPGGNGRLVQALAENVPILYEKTVHTVRYGSDGVRVIAGSQVFEGDMVLCTVPLGVLKS 298
Query: 301 GSIKFIPELPQRKLDAIKRLGYGLLNKVAMLFPYVFWETDLDTFGHLTDDSSSRGEFFLF 360
GSIKFIPELPQRKLD IKRLGYGLLNKVAMLFP VFWETDLDTFGHLTD++SSRGEFFLF
Sbjct: 299 GSIKFIPELPQRKLDGIKRLGYGLLNKVAMLFPSVFWETDLDTFGHLTDNTSSRGEFFLF 358
Query: 361 YSYATVAGGPLLIALVAGEAAHKFESMPPTDAVTKVLQILKGIYEPKGINVPEPIQTVCT 420
YSYATVAGGP+LIALVAGEAAH FESMPPTDAVT+V+QILKGIYEP+GI VPEPIQT+CT
Sbjct: 359 YSYATVAGGPVLIALVAGEAAHTFESMPPTDAVTQVIQILKGIYEPQGITVPEPIQTICT 418
Query: 421 RWGGDPFSLGSYSNVAVGASGDDYDIMAESVGDGRLFFAGEATIRRYPATMHGAFLSGLR 480
RWG DPF+LGSYSNVAVGASGDDYDI+AESVGDGRLFFAGEAT+RRYPATMHGAFLSGLR
Sbjct: 419 RWGSDPFTLGSYSNVAVGASGDDYDILAESVGDGRLFFAGEATMRRYPATMHGAFLSGLR 478
Query: 481 ETAKMAHCANARALRMKVKVGKIPSKNAYSCASALTDLFREPDLEFGSFSVIFSWKNPDP 540
E A +AH A ARALR VKV + PS NA++CAS L DLFREPD+EFGSFSVIF NPD
Sbjct: 479 EAANIAHYAGARALR--VKVNQSPSNNAHACASLLADLFREPDIEFGSFSVIFGRNNPDL 536
Query: 541 KSPSILRVTFNDPRKKNHG----DQPHSNKRLFEQLQSHFNQQQQLHVYTLLTRQQVLDL 596
KS +ILRVTFN+PRKK+ DQ HSNK LF+QLQSHFNQQQ LHVYTLL++QQVL+L
Sbjct: 537 KSTAILRVTFNEPRKKSQESSRPDQHHSNKLLFQQLQSHFNQQQPLHVYTLLSKQQVLEL 596
Query: 597 REVRGGDEMRLNFLCEKLGVKLIGRKGLGSTADSVISSIKAERGIRKQTSTFSASKLVYK 656
REVRGGDEMR+N+LCEKLGVKLIGRKGLG TADS+I+SIKAERG RK ++T K
Sbjct: 597 REVRGGDEMRMNYLCEKLGVKLIGRKGLGPTADSLIASIKAERGGRKASATSLGLKSGMS 656
Query: 657 LLMKLCGILKRYFKAKNRNFEAEN 680
L K G LKR + + + N
Sbjct: 657 KLQK--GTLKRKLVRRAKIVRSSN 678
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225448966|ref|XP_002273083.1| PREDICTED: lysine-specific histone demethylase 1 homolog 3-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255577434|ref|XP_002529596.1| amine oxidase, putative [Ricinus communis] gi|223530929|gb|EEF32788.1| amine oxidase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356502918|ref|XP_003520261.1| PREDICTED: lysine-specific histone demethylase 1 homolog 3-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449444903|ref|XP_004140213.1| PREDICTED: lysine-specific histone demethylase 1 homolog 3-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449490506|ref|XP_004158625.1| PREDICTED: LOW QUALITY PROTEIN: lysine-specific histone demethylase 1 homolog 3-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|240255318|ref|NP_187650.4| lysine-specific histone demethylase 1 [Arabidopsis thaliana] gi|332641378|gb|AEE74899.1| lysine-specific histone demethylase 1 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297829566|ref|XP_002882665.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297328505|gb|EFH58924.1| predicted protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|75169873|sp|Q9CAE3.1|LDL3_ARATH RecName: Full=Lysine-specific histone demethylase 1 homolog 3; AltName: Full=Flavin-containing amine oxidase domain-containing protein 3; AltName: Full=Protein FLOWERING LOCUS D; AltName: Full=Protein LSD1-LIKE 3; AltName: Full=Protein SUPPRESSOR OF OVEREXPRESSED FCA 1 gi|12322798|gb|AAG51395.1|AC011560_27 hypothetical protein; 118064-115538 [Arabidopsis thaliana] gi|61661320|gb|AAX51266.1| flowering locus D [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|61661322|gb|AAX51267.1| flowering locus D [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 688 | ||||||
| TAIR|locus:2075870 | 789 | FLD "FLOWERING LOCUS D" [Arabi | 0.936 | 0.816 | 0.716 | 8.1e-250 | |
| TAIR|locus:2026187 | 844 | LDL1 "LSD1-like 1" [Arabidopsi | 0.789 | 0.643 | 0.561 | 5.5e-169 | |
| TAIR|locus:2091501 | 746 | LDL2 "LSD1-like2" [Arabidopsis | 0.783 | 0.722 | 0.535 | 2.3e-157 | |
| FB|FBgn0260397 | 890 | Su(var)3-3 "Suppressor of vari | 0.295 | 0.228 | 0.464 | 2.2e-82 | |
| TAIR|locus:2130454 | 1628 | LDL3 "LSD1-like 3" [Arabidopsi | 0.405 | 0.171 | 0.4 | 1.4e-71 | |
| UNIPROTKB|G4MR69 | 1200 | MGG_09915 "Lysine-specific his | 0.465 | 0.266 | 0.373 | 1.2e-65 | |
| UNIPROTKB|E1BPZ5 | 820 | KDM1B "Uncharacterized protein | 0.588 | 0.493 | 0.346 | 1.6e-63 | |
| UNIPROTKB|E1BRG3 | 617 | KDM1B "Uncharacterized protein | 0.678 | 0.756 | 0.304 | 2e-63 | |
| UNIPROTKB|J9P5J9 | 820 | KDM1B "Uncharacterized protein | 0.588 | 0.493 | 0.344 | 2e-63 | |
| UNIPROTKB|Q8NB78 | 822 | KDM1B "Lysine-specific histone | 0.588 | 0.492 | 0.339 | 2.6e-63 |
| TAIR|locus:2075870 FLD "FLOWERING LOCUS D" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 2406 (852.0 bits), Expect = 8.1e-250, P = 8.1e-250
Identities = 470/656 (71%), Positives = 532/656 (81%)
Query: 1 MFTESVPKHCHSLLDSAYNYLVSNGYINFGVAPEIKEKIPVEPSSNKXXXXXXXXXXXXX 60
MF S+PKHC SLLDSAYNYLV++GYINFG+A IK+K P + S+K
Sbjct: 140 MFLNSIPKHCSSLLDSAYNYLVTHGYINFGIAQAIKDKFPAQ--SSKSSVIIVGAGLSGL 197
Query: 61 XXXXXXXXXXFRVTVLEGRKRAGGRVYTKKMEGGAGNRISASADLGGSVLTGTLGNPLGI 120
F+VTVLEGRKR GGRVYTKKME NR+ A+ADLGGSVLTGTLGNPLGI
Sbjct: 198 AAARQLMRFGFKVTVLEGRKRPGGRVYTKKMEA---NRVGAAADLGGSVLTGTLGNPLGI 254
Query: 121 LAKQLGSLLHKVRDKCPLYRLDGNSVDPEIDMKVEADFNRLLDKASRLRQLMGEVAMDVS 180
+A+QLGS L+KVRDKCPLYR+DG VDP++D+KVE FN+LLDKAS+LRQLMG+V+MDVS
Sbjct: 255 IARQLGSSLYKVRDKCPLYRVDGKPVDPDVDIKVEVAFNQLLDKASKLRQLMGDVSMDVS 314
Query: 181 LGSALETFWRVYWDSGNAEAMNLFNWHLANLEYXXXXXXXXXXXXFWDQDDPYDMGGDHC 240
LG+ALETF +V + E M LFNWHLANLEY FWDQDDPYDMGGDHC
Sbjct: 315 LGAALETFRQVSGNDVATEEMGLFNWHLANLEYANAGLVSKLSLAFWDQDDPYDMGGDHC 374
Query: 241 FLPGGNGRLVQALVENVPILYEKTVHTIRYGSDGVQVLAGSQVFEGDMVLCTVPLGVLKS 300
FLPGGNGRLVQAL ENVPILYEKTV TIRYGS+GV+V AG+QV+EGDMVLCTVPLGVLK+
Sbjct: 375 FLPGGNGRLVQALAENVPILYEKTVQTIRYGSNGVKVTAGNQVYEGDMVLCTVPLGVLKN 434
Query: 301 GSIKFIPELPQRKLDAIKRLGYGLLNKVAMLFPYVFWETDLDTFGHLTDDSSSRGEFFLF 360
GSIKF+PELPQRKLD IKRLG+GLLNKVAMLFPYVFW TDLDTFGHLT+D + RGEFFLF
Sbjct: 435 GSIKFVPELPQRKLDCIKRLGFGLLNKVAMLFPYVFWSTDLDTFGHLTEDPNYRGEFFLF 494
Query: 361 YSYATVAGGPLLIALVAGEAAHKFESMPPTDAVTKVLQILKGIYEPKGINVPEPIQTVCT 420
YSYA VAGG LLIALVAGEAAHKFE+MPPTDAVT+VL IL+GIYEP+GINVP+P+QTVCT
Sbjct: 495 YSYAPVAGGALLIALVAGEAAHKFETMPPTDAVTRVLHILRGIYEPQGINVPDPLQTVCT 554
Query: 421 RWGGDPFSLGSYSNVAVGASGDDYDIMAESVGDGRLFFAGEATIRRYPATMHGAFLSGLR 480
RWGGDPFSLGSYSNVAVGASGDDYDI+AESVGDGRLFFAGEAT RRYPATMHGAF++GLR
Sbjct: 555 RWGGDPFSLGSYSNVAVGASGDDYDILAESVGDGRLFFAGEATTRRYPATMHGAFVTGLR 614
Query: 481 ETAKMAHCANARALRMKVKVGKIPSKNAYSCASALTDLFREPDLEFGSFSVIFSWKNPDP 540
E A MA A AR +R ++ + PS+NA+SCA L DLFR+PDLEFGSF +IFS +NPDP
Sbjct: 615 EAANMAQSAKARGIRKRID--RNPSRNAHSCAILLADLFRDPDLEFGSFCIIFSRRNPDP 672
Query: 541 KSPSILRVTFNDPRKKNH---GDQPHSNKRLFEXXXXXXXXXXXXXVYTLLTRQQVLDLR 597
KSP+ILRVT ++PRK+N DQ HSNK LF+ VYTLLTRQQ LDLR
Sbjct: 673 KSPAILRVTLSEPRKRNEDPKADQ-HSNKILFQQLQSHFNQQQQIQVYTLLTRQQALDLR 731
Query: 598 EVRGGDEMRLNFLCEKLGVKLIGRKGLGSTADSVISSIKAERGIRK-QTSTFSASK 652
EVRGGDE RL +LCE LGVKL+GRKGLG ADSVI+SIKAER RK +S+ S +K
Sbjct: 732 EVRGGDEKRLYYLCETLGVKLVGRKGLGVGADSVIASIKAERTGRKLPSSSTSGTK 787
|
|
| TAIR|locus:2026187 LDL1 "LSD1-like 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2091501 LDL2 "LSD1-like2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0260397 Su(var)3-3 "Suppressor of variegation 3-3" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2130454 LDL3 "LSD1-like 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G4MR69 MGG_09915 "Lysine-specific histone demethylase 1" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BPZ5 KDM1B "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BRG3 KDM1B "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P5J9 KDM1B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8NB78 KDM1B "Lysine-specific histone demethylase 1B" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q7XUR2 | LDL3_ORYSJ | 1, ., -, ., -, ., - | 0.7234 | 0.9389 | 0.7965 | yes | no |
| Q9CAE3 | LDL3_ARATH | 1, ., -, ., -, ., - | 0.7801 | 0.9229 | 0.8048 | no | no |
| Q01H90 | LDL3_ORYSI | 1, ., -, ., -, ., - | 0.7249 | 0.9389 | 0.7965 | N/A | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 1.4.3.2 | LOW CONFIDENCE prediction! |
| 3rd Layer | 1.5.3.17 | LOW CONFIDENCE prediction! |
| 3rd Layer | 1.4.3.4 | LOW CONFIDENCE prediction! |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
 | GSVIVG00018140001 | SubName- Full=Chromosome chr13 scaffold_17, whole genome shotgun sequence; (869 aa) | ||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 688 | |||
| PLN03000 | 881 | PLN03000, PLN03000, amine oxidase | 0.0 | |
| PLN02328 | 808 | PLN02328, PLN02328, lysine-specific histone demeth | 0.0 | |
| PLN02529 | 738 | PLN02529, PLN02529, lysine-specific histone demeth | 0.0 | |
| PLN02976 | 1713 | PLN02976, PLN02976, amine oxidase | 1e-107 | |
| pfam01593 | 444 | pfam01593, Amino_oxidase, Flavin containing amine | 5e-86 | |
| PLN02268 | 435 | PLN02268, PLN02268, probable polyamine oxidase | 2e-80 | |
| PLN02568 | 539 | PLN02568, PLN02568, polyamine oxidase | 6e-52 | |
| COG1231 | 450 | COG1231, COG1231, Monoamine oxidase [Amino acid tr | 8e-40 | |
| PLN02676 | 487 | PLN02676, PLN02676, polyamine oxidase | 3e-31 | |
| COG1233 | 487 | COG1233, COG1233, Phytoene dehydrogenase and relat | 2e-14 | |
| pfam13450 | 66 | pfam13450, NAD_binding_8, NAD(P)-binding Rossmann- | 3e-11 | |
| COG1232 | 444 | COG1232, HemY, Protoporphyrinogen oxidase [Coenzym | 5e-10 | |
| PRK11749 | 457 | PRK11749, PRK11749, dihydropyrimidine dehydrogenas | 2e-09 | |
| PRK12771 | 564 | PRK12771, PRK12771, putative glutamate synthase (N | 2e-08 | |
| PRK12810 | 471 | PRK12810, gltD, glutamate synthase subunit beta; R | 2e-08 | |
| PRK09853 | 1019 | PRK09853, PRK09853, putative selenate reductase su | 9e-08 | |
| TIGR02734 | 502 | TIGR02734, crtI_fam, phytoene desaturase | 1e-07 | |
| COG3349 | 485 | COG3349, COG3349, Uncharacterized conserved protei | 3e-07 | |
| TIGR03997 | 645 | TIGR03997, mycofact_OYE_2, mycofactocin system Fad | 3e-07 | |
| pfam01266 | 234 | pfam01266, DAO, FAD dependent oxidoreductase | 6e-07 | |
| PRK07208 | 479 | PRK07208, PRK07208, hypothetical protein; Provisio | 7e-07 | |
| COG0446 | 415 | COG0446, HcaD, Uncharacterized NAD(FAD)-dependent | 1e-06 | |
| smart01002 | 149 | smart01002, AlaDh_PNT_C, Alanine dehydrogenase/PNT | 1e-06 | |
| PRK07233 | 434 | PRK07233, PRK07233, hypothetical protein; Provisio | 2e-06 | |
| PRK12814 | 652 | PRK12814, PRK12814, putative NADPH-dependent gluta | 3e-06 | |
| COG0665 | 387 | COG0665, DadA, Glycine/D-amino acid oxidases (deam | 4e-06 | |
| PLN02172 | 461 | PLN02172, PLN02172, flavin-containing monooxygenas | 4e-06 | |
| COG0644 | 396 | COG0644, FixC, Dehydrogenases (flavoproteins) [Ene | 5e-06 | |
| COG3380 | 331 | COG3380, COG3380, Predicted NAD/FAD-dependent oxid | 5e-06 | |
| PLN02487 | 569 | PLN02487, PLN02487, zeta-carotene desaturase | 6e-06 | |
| PRK11883 | 451 | PRK11883, PRK11883, protoporphyrinogen oxidase; Re | 6e-06 | |
| TIGR03315 | 1012 | TIGR03315, Se_ygfK, putative selenate reductase, Y | 1e-05 | |
| PRK01747 | 662 | PRK01747, mnmC, bifunctional tRNA (mnm(5)s(2)U34)- | 2e-05 | |
| COG0493 | 457 | COG0493, GltD, NADPH-dependent glutamate synthase | 2e-05 | |
| PLN02576 | 496 | PLN02576, PLN02576, protoporphyrinogen oxidase | 3e-05 | |
| COG2072 | 443 | COG2072, TrkA, Predicted flavoprotein involved in | 3e-05 | |
| PRK08163 | 396 | PRK08163, PRK08163, salicylate hydroxylase; Provis | 3e-05 | |
| COG1148 | 622 | COG1148, HdrA, Heterodisulfide reductase, subunit | 4e-05 | |
| COG0654 | 387 | COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydrox | 5e-05 | |
| pfam07992 | 283 | pfam07992, Pyr_redox_2, Pyridine nucleotide-disulp | 6e-05 | |
| PRK12778 | 752 | PRK12778, PRK12778, putative bifunctional 2-polypr | 6e-05 | |
| TIGR01372 | 985 | TIGR01372, soxA, sarcosine oxidase, alpha subunit | 7e-05 | |
| TIGR01317 | 485 | TIGR01317, GOGAT_sm_gam, glutamate synthases, NADH | 7e-05 | |
| TIGR01316 | 449 | TIGR01316, gltA, glutamate synthase (NADPH), homot | 7e-05 | |
| PLN02676 | 487 | PLN02676, PLN02676, polyamine oxidase | 8e-05 | |
| PRK13984 | 604 | PRK13984, PRK13984, putative oxidoreductase; Provi | 8e-05 | |
| pfam00890 | 401 | pfam00890, FAD_binding_2, FAD binding domain | 1e-04 | |
| TIGR02733 | 492 | TIGR02733, desat_CrtD, C-3',4' desaturase CrtD | 1e-04 | |
| PRK06847 | 375 | PRK06847, PRK06847, hypothetical protein; Provisio | 1e-04 | |
| COG1249 | 454 | COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenas | 2e-04 | |
| pfam01262 | 150 | pfam01262, AlaDh_PNT_C, Alanine dehydrogenase/PNT, | 2e-04 | |
| PRK12834 | 549 | PRK12834, PRK12834, putative FAD-binding dehydroge | 2e-04 | |
| PLN02612 | 567 | PLN02612, PLN02612, phytoene desaturase | 2e-04 | |
| PRK12831 | 464 | PRK12831, PRK12831, putative oxidoreductase; Provi | 2e-04 | |
| COG2081 | 408 | COG2081, COG2081, Predicted flavoproteins [General | 5e-04 | |
| COG0562 | 374 | COG0562, Glf, UDP-galactopyranose mutase [Cell env | 7e-04 | |
| TIGR02732 | 474 | TIGR02732, zeta_caro_desat, 9,9'-di-cis-zeta-carot | 9e-04 | |
| PRK07233 | 434 | PRK07233, PRK07233, hypothetical protein; Provisio | 0.001 | |
| pfam03486 | 405 | pfam03486, HI0933_like, HI0933-like protein | 0.001 | |
| COG1053 | 562 | COG1053, SdhA, Succinate dehydrogenase/fumarate re | 0.001 | |
| TIGR00031 | 377 | TIGR00031, UDP-GALP_mutase, UDP-galactopyranose mu | 0.002 | |
| TIGR00562 | 462 | TIGR00562, proto_IX_ox, protoporphyrinogen oxidase | 0.002 | |
| TIGR01790 | 388 | TIGR01790, carotene-cycl, lycopene cyclase family | 0.002 | |
| PRK01438 | 480 | PRK01438, murD, UDP-N-acetylmuramoyl-L-alanyl-D-gl | 0.002 | |
| COG3573 | 552 | COG3573, COG3573, Predicted oxidoreductase [Genera | 0.003 | |
| cd05305 | 359 | cd05305, L-AlaDH, Alanine dehydrogenase NAD-bindin | 0.003 | |
| TIGR02731 | 453 | TIGR02731, phytoene_desat, phytoene desaturase | 0.003 | |
| PRK05329 | 422 | PRK05329, PRK05329, anaerobic glycerol-3-phosphate | 0.003 | |
| PRK09126 | 392 | PRK09126, PRK09126, hypothetical protein; Provisio | 0.003 | |
| PRK05335 | 436 | PRK05335, PRK05335, tRNA (uracil-5-)-methyltransfe | 0.003 | |
| PRK12409 | 410 | PRK12409, PRK12409, D-amino acid dehydrogenase sma | 0.003 | |
| pfam01494 | 349 | pfam01494, FAD_binding_3, FAD binding domain | 0.004 | |
| PRK04176 | 257 | PRK04176, PRK04176, ribulose-1,5-biphosphate synth | 0.004 | |
| PRK07538 | 413 | PRK07538, PRK07538, hypothetical protein; Provisio | 0.004 |
| >gnl|CDD|178578 PLN03000, PLN03000, amine oxidase | Back alignment and domain information |
|---|
Score = 1156 bits (2992), Expect = 0.0
Identities = 509/670 (75%), Positives = 581/670 (86%), Gaps = 12/670 (1%)
Query: 1 MFTESVPKHCHSLLDSAYNYLVSNGYINFGVAPEIKEKIPVEPSSNKLRVLVIGAGLAGL 60
MF S+PKHC SLLDSAYNYLV++GYINFG+A IK+K P + S K V+++GAGL+GL
Sbjct: 140 MFLGSIPKHCSSLLDSAYNYLVTHGYINFGIAQAIKDKFPAQSS--KSSVVIVGAGLSGL 197
Query: 61 AAARQLMRLGFRVTVLEGRKRAGGRVYTKKMEGGAGNRISASADLGGSVLTGTLGNPLGI 120
AAARQLMR GF+VTVLEGRKR GGRVYTKKME NR+ A+ADLGGSVLTGTLGNPLGI
Sbjct: 198 AAARQLMRFGFKVTVLEGRKRPGGRVYTKKMEA---NRVGAAADLGGSVLTGTLGNPLGI 254
Query: 121 LAKQLGSLLHKVRDKCPLYRLDGNSVDPEIDMKVEADFNRLLDKASRLRQLMGEVAMDVS 180
+A+QLGS L+KVRDKCPLYR+DG VDP++D+KVE FN+LLDKAS+LRQLMG+V+MDVS
Sbjct: 255 IARQLGSSLYKVRDKCPLYRVDGKPVDPDVDLKVEVAFNQLLDKASKLRQLMGDVSMDVS 314
Query: 181 LGSALETFWRVYWDSGNAEAMNLFNWHLANLEYANASLLSKLSLAFWDQDDPYDMGGDHC 240
LG+ALETF +V + E M LFNWHLANLEYANA L+SKLSLAFWDQDDPYDMGGDHC
Sbjct: 315 LGAALETFRQVSGNDVATEEMGLFNWHLANLEYANAGLVSKLSLAFWDQDDPYDMGGDHC 374
Query: 241 FLPGGNGRLVQALVENVPILYEKTVHTIRYGSDGVQVLAGSQVFEGDMVLCTVPLGVLKS 300
FLPGGNGRLVQAL ENVPILYEKTV TIRYGS+GV+V+AG+QV+EGDMVLCTVPLGVLK+
Sbjct: 375 FLPGGNGRLVQALAENVPILYEKTVQTIRYGSNGVKVIAGNQVYEGDMVLCTVPLGVLKN 434
Query: 301 GSIKFIPELPQRKLDAIKRLGYGLLNKVAMLFPYVFWETDLDTFGHLTDDSSSRGEFFLF 360
GSIKF+PELPQRKLD IKRLG+GLLNKVAMLFPYVFW TDLDTFGHLT+D + RGEFFLF
Sbjct: 435 GSIKFVPELPQRKLDCIKRLGFGLLNKVAMLFPYVFWSTDLDTFGHLTEDPNYRGEFFLF 494
Query: 361 YSYATVAGGPLLIALVAGEAAHKFESMPPTDAVTKVLQILKGIYEPKGINVPEPIQTVCT 420
YSYA VAGGPLLIALVAGEAAHKFE+MPPTDAVT+VL IL+GIYEP+GINVP+P+QTVCT
Sbjct: 495 YSYAPVAGGPLLIALVAGEAAHKFETMPPTDAVTRVLHILRGIYEPQGINVPDPLQTVCT 554
Query: 421 RWGGDPFSLGSYSNVAVGASGDDYDIMAESVGDGRLFFAGEATIRRYPATMHGAFLSGLR 480
RWGGDPFSLGSYSNVAVGASGDDYDI+AESVGDGRLFFAGEAT RRYPATMHGAF++GLR
Sbjct: 555 RWGGDPFSLGSYSNVAVGASGDDYDILAESVGDGRLFFAGEATTRRYPATMHGAFVTGLR 614
Query: 481 ETAKMAHCANARALRMKVKVGKIPSKNAYSCASALTDLFREPDLEFGSFSVIFSWKNPDP 540
E A MA A AR +R ++ + PSKNA+SCA L DLFR+PDLEFGSF++IFS +NPDP
Sbjct: 615 EAANMAQSAKARGIRKRID--RNPSKNAHSCAILLADLFRDPDLEFGSFAIIFSRRNPDP 672
Query: 541 KSPSILRVTFNDPRKKNHG--DQPHSNKRLFEQLQSHFNQQQQLHVYTLLTRQQVLDLRE 598
KSP+ILRVT ++PRK+N HSNK LF+QLQSHFNQQQQ+ VYTLLTRQQ LDLRE
Sbjct: 673 KSPAILRVTLSEPRKRNEDPKADQHSNKILFQQLQSHFNQQQQIQVYTLLTRQQALDLRE 732
Query: 599 VRGGDEMRLNFLCEKLGVKLIGRKGLGSTADSVISSIKAER-GIRKQTSTFSASKLVYKL 657
VRGGDE RLN+LCE LGVKL+GRKGLG ADSVI+SIKAER G + +S+ S +K +
Sbjct: 733 VRGGDEKRLNYLCETLGVKLVGRKGLGPGADSVIASIKAERTGNKLPSSSTSGTK--SGM 790
Query: 658 LMKLCGILKR 667
K G ++
Sbjct: 791 KPKAAGSKRK 800
|
Length = 881 |
| >gnl|CDD|215187 PLN02328, PLN02328, lysine-specific histone demethylase 1 homolog | Back alignment and domain information |
|---|
| >gnl|CDD|178144 PLN02529, PLN02529, lysine-specific histone demethylase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|215527 PLN02976, PLN02976, amine oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|216593 pfam01593, Amino_oxidase, Flavin containing amine oxidoreductase | Back alignment and domain information |
|---|
| >gnl|CDD|177909 PLN02268, PLN02268, probable polyamine oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|215308 PLN02568, PLN02568, polyamine oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|224152 COG1231, COG1231, Monoamine oxidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|215362 PLN02676, PLN02676, polyamine oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|224154 COG1233, COG1233, Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|205628 pfam13450, NAD_binding_8, NAD(P)-binding Rossmann-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|224153 COG1232, HemY, Protoporphyrinogen oxidase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|236967 PRK11749, PRK11749, dihydropyrimidine dehydrogenase subunit A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237198 PRK12771, PRK12771, putative glutamate synthase (NADPH) small subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237213 PRK12810, gltD, glutamate synthase subunit beta; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236630 PRK09853, PRK09853, putative selenate reductase subunit YgfK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233988 TIGR02734, crtI_fam, phytoene desaturase | Back alignment and domain information |
|---|
| >gnl|CDD|225885 COG3349, COG3349, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|234436 TIGR03997, mycofact_OYE_2, mycofactocin system FadH/OYE family oxidoreductase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|216400 pfam01266, DAO, FAD dependent oxidoreductase | Back alignment and domain information |
|---|
| >gnl|CDD|235967 PRK07208, PRK07208, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223523 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|214966 smart01002, AlaDh_PNT_C, Alanine dehydrogenase/PNT, C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|235977 PRK07233, PRK07233, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|139246 PRK12814, PRK12814, putative NADPH-dependent glutamate synthase small subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223737 COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|215116 PLN02172, PLN02172, flavin-containing monooxygenase FMO GS-OX | Back alignment and domain information |
|---|
| >gnl|CDD|223717 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|225915 COG3380, COG3380, Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|215268 PLN02487, PLN02487, zeta-carotene desaturase | Back alignment and domain information |
|---|
| >gnl|CDD|237009 PRK11883, PRK11883, protoporphyrinogen oxidase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|132358 TIGR03315, Se_ygfK, putative selenate reductase, YgfK subunit | Back alignment and domain information |
|---|
| >gnl|CDD|234978 PRK01747, mnmC, bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223567 COG0493, GltD, NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|215314 PLN02576, PLN02576, protoporphyrinogen oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|224983 COG2072, TrkA, Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|181262 PRK08163, PRK08163, salicylate hydroxylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224070 COG1148, HdrA, Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|223727 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|219686 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase | Back alignment and domain information |
|---|
| >gnl|CDD|237200 PRK12778, PRK12778, putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233382 TIGR01372, soxA, sarcosine oxidase, alpha subunit family, heterotetrameric form | Back alignment and domain information |
|---|
| >gnl|CDD|162300 TIGR01317, GOGAT_sm_gam, glutamate synthases, NADH/NADPH, small subunit | Back alignment and domain information |
|---|
| >gnl|CDD|130383 TIGR01316, gltA, glutamate synthase (NADPH), homotetrameric | Back alignment and domain information |
|---|
| >gnl|CDD|215362 PLN02676, PLN02676, polyamine oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|172486 PRK13984, PRK13984, putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216176 pfam00890, FAD_binding_2, FAD binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|233987 TIGR02733, desat_CrtD, C-3',4' desaturase CrtD | Back alignment and domain information |
|---|
| >gnl|CDD|235874 PRK06847, PRK06847, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224169 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|216396 pfam01262, AlaDh_PNT_C, Alanine dehydrogenase/PNT, C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|183782 PRK12834, PRK12834, putative FAD-binding dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|215330 PLN02612, PLN02612, phytoene desaturase | Back alignment and domain information |
|---|
| >gnl|CDD|183780 PRK12831, PRK12831, putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224992 COG2081, COG2081, Predicted flavoproteins [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|223636 COG0562, Glf, UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|131779 TIGR02732, zeta_caro_desat, 9,9'-di-cis-zeta-carotene desaturase | Back alignment and domain information |
|---|
| >gnl|CDD|235977 PRK07233, PRK07233, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217590 pfam03486, HI0933_like, HI0933-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|223981 COG1053, SdhA, Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|232791 TIGR00031, UDP-GALP_mutase, UDP-galactopyranose mutase | Back alignment and domain information |
|---|
| >gnl|CDD|213540 TIGR00562, proto_IX_ox, protoporphyrinogen oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|130850 TIGR01790, carotene-cycl, lycopene cyclase family protein | Back alignment and domain information |
|---|
| >gnl|CDD|179297 PRK01438, murD, UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226103 COG3573, COG3573, Predicted oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|240630 cd05305, L-AlaDH, Alanine dehydrogenase NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|131778 TIGR02731, phytoene_desat, phytoene desaturase | Back alignment and domain information |
|---|
| >gnl|CDD|235412 PRK05329, PRK05329, anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236385 PRK09126, PRK09126, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235416 PRK05335, PRK05335, tRNA (uracil-5-)-methyltransferase Gid; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237093 PRK12409, PRK12409, D-amino acid dehydrogenase small subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216530 pfam01494, FAD_binding_3, FAD binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|235241 PRK04176, PRK04176, ribulose-1,5-biphosphate synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236046 PRK07538, PRK07538, hypothetical protein; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 688 | |||
| PLN03000 | 881 | amine oxidase | 100.0 | |
| PLN02328 | 808 | lysine-specific histone demethylase 1 homolog | 100.0 | |
| PLN02529 | 738 | lysine-specific histone demethylase 1 | 100.0 | |
| KOG0029 | 501 | consensus Amine oxidase [Secondary metabolites bio | 100.0 | |
| PLN02976 | 1713 | amine oxidase | 100.0 | |
| PLN02268 | 435 | probable polyamine oxidase | 100.0 | |
| PLN02568 | 539 | polyamine oxidase | 100.0 | |
| PLN02676 | 487 | polyamine oxidase | 100.0 | |
| KOG0685 | 498 | consensus Flavin-containing amine oxidase [Coenzym | 100.0 | |
| COG1231 | 450 | Monoamine oxidase [Amino acid transport and metabo | 100.0 | |
| TIGR00562 | 462 | proto_IX_ox protoporphyrinogen oxidase. This prote | 100.0 | |
| PRK12416 | 463 | protoporphyrinogen oxidase; Provisional | 100.0 | |
| PF01593 | 450 | Amino_oxidase: Flavin containing amine oxidoreduct | 100.0 | |
| PLN02576 | 496 | protoporphyrinogen oxidase | 100.0 | |
| PRK11883 | 451 | protoporphyrinogen oxidase; Reviewed | 100.0 | |
| PRK07233 | 434 | hypothetical protein; Provisional | 100.0 | |
| TIGR02731 | 453 | phytoene_desat phytoene desaturase. Plants and cya | 100.0 | |
| PLN02612 | 567 | phytoene desaturase | 100.0 | |
| COG1232 | 444 | HemY Protoporphyrinogen oxidase [Coenzyme metaboli | 100.0 | |
| PRK07208 | 479 | hypothetical protein; Provisional | 100.0 | |
| PLN02487 | 569 | zeta-carotene desaturase | 100.0 | |
| TIGR02732 | 474 | zeta_caro_desat carotene 7,8-desaturase. Carotene | 99.98 | |
| TIGR03467 | 419 | HpnE squalene-associated FAD-dependent desaturase. | 99.98 | |
| TIGR02733 | 492 | desat_CrtD C-3',4' desaturase CrtD. Members of thi | 99.97 | |
| TIGR02734 | 502 | crtI_fam phytoene desaturase. Phytoene is converte | 99.96 | |
| COG3380 | 331 | Predicted NAD/FAD-dependent oxidoreductase [Genera | 99.96 | |
| TIGR02730 | 493 | carot_isom carotene isomerase. Members of this fam | 99.95 | |
| KOG1276 | 491 | consensus Protoporphyrinogen oxidase [Coenzyme tra | 99.95 | |
| COG1233 | 487 | Phytoene dehydrogenase and related proteins [Secon | 99.9 | |
| COG3349 | 485 | Uncharacterized conserved protein [Function unknow | 99.88 | |
| COG2907 | 447 | Predicted NAD/FAD-binding protein [General functio | 99.87 | |
| KOG4254 | 561 | consensus Phytoene desaturase [Coenzyme transport | 99.74 | |
| TIGR00031 | 377 | UDP-GALP_mutase UDP-galactopyranose mutase. The ge | 99.69 | |
| PTZ00363 | 443 | rab-GDP dissociation inhibitor; Provisional | 99.61 | |
| PF13450 | 68 | NAD_binding_8: NAD(P)-binding Rossmann-like domain | 99.53 | |
| PRK13977 | 576 | myosin-cross-reactive antigen; Provisional | 99.47 | |
| COG2081 | 408 | Predicted flavoproteins [General function predicti | 99.45 | |
| COG0562 | 374 | Glf UDP-galactopyranose mutase [Cell envelope biog | 99.25 | |
| PRK10157 | 428 | putative oxidoreductase FixC; Provisional | 99.24 | |
| PRK10015 | 429 | oxidoreductase; Provisional | 99.18 | |
| PF03486 | 409 | HI0933_like: HI0933-like protein; InterPro: IPR004 | 99.16 | |
| PRK07364 | 415 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate | 99.16 | |
| TIGR02032 | 295 | GG-red-SF geranylgeranyl reductase family. This mo | 99.15 | |
| COG0644 | 396 | FixC Dehydrogenases (flavoproteins) [Energy produc | 99.12 | |
| TIGR01988 | 385 | Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub | 99.1 | |
| PRK12409 | 410 | D-amino acid dehydrogenase small subunit; Provisio | 99.1 | |
| COG0654 | 387 | UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and | 99.07 | |
| PRK11259 | 376 | solA N-methyltryptophan oxidase; Provisional | 99.07 | |
| PF01266 | 358 | DAO: FAD dependent oxidoreductase; InterPro: IPR00 | 99.06 | |
| PRK08773 | 392 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy | 99.04 | |
| PRK09126 | 392 | hypothetical protein; Provisional | 99.02 | |
| PRK07494 | 388 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio | 98.99 | |
| PRK08020 | 391 | ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin | 98.99 | |
| TIGR01984 | 382 | UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T | 98.98 | |
| TIGR03329 | 460 | Phn_aa_oxid putative aminophosphonate oxidoreducta | 98.98 | |
| PRK08013 | 400 | oxidoreductase; Provisional | 98.97 | |
| PRK05714 | 405 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy | 98.97 | |
| PRK11728 | 393 | hydroxyglutarate oxidase; Provisional | 98.97 | |
| COG0579 | 429 | Predicted dehydrogenase [General function predicti | 98.95 | |
| PRK07333 | 403 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio | 98.94 | |
| TIGR01377 | 380 | soxA_mon sarcosine oxidase, monomeric form. Sarcos | 98.94 | |
| COG1635 | 262 | THI4 Ribulose 1,5-bisphosphate synthetase, convert | 98.92 | |
| PRK07608 | 388 | ubiquinone biosynthesis hydroxylase family protein | 98.91 | |
| PRK08850 | 405 | 2-octaprenyl-6-methoxyphenol hydroxylase; Validate | 98.9 | |
| PRK06184 | 502 | hypothetical protein; Provisional | 98.89 | |
| PRK07190 | 487 | hypothetical protein; Provisional | 98.89 | |
| PRK06834 | 488 | hypothetical protein; Provisional | 98.88 | |
| PRK08132 | 547 | FAD-dependent oxidoreductase; Provisional | 98.87 | |
| PRK05868 | 372 | hypothetical protein; Validated | 98.86 | |
| PRK05732 | 395 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate | 98.85 | |
| PRK08849 | 384 | 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy | 98.85 | |
| PRK08244 | 493 | hypothetical protein; Provisional | 98.84 | |
| PLN02172 | 461 | flavin-containing monooxygenase FMO GS-OX | 98.83 | |
| PF13738 | 203 | Pyr_redox_3: Pyridine nucleotide-disulphide oxidor | 98.83 | |
| PRK08243 | 392 | 4-hydroxybenzoate 3-monooxygenase; Validated | 98.82 | |
| PRK07045 | 388 | putative monooxygenase; Reviewed | 98.82 | |
| PRK00711 | 416 | D-amino acid dehydrogenase small subunit; Validate | 98.81 | |
| PRK06185 | 407 | hypothetical protein; Provisional | 98.8 | |
| PF05834 | 374 | Lycopene_cycl: Lycopene cyclase protein; InterPro: | 98.79 | |
| PRK11445 | 351 | putative oxidoreductase; Provisional | 98.79 | |
| PTZ00383 | 497 | malate:quinone oxidoreductase; Provisional | 98.78 | |
| PRK01747 | 662 | mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans | 98.78 | |
| TIGR02023 | 388 | BchP-ChlP geranylgeranyl reductase. This model rep | 98.77 | |
| PRK07236 | 386 | hypothetical protein; Provisional | 98.77 | |
| COG0665 | 387 | DadA Glycine/D-amino acid oxidases (deaminating) [ | 98.75 | |
| PRK06126 | 545 | hypothetical protein; Provisional | 98.75 | |
| PF01946 | 230 | Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. | 98.74 | |
| PLN02463 | 447 | lycopene beta cyclase | 98.72 | |
| PRK06183 | 538 | mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va | 98.72 | |
| PRK06481 | 506 | fumarate reductase flavoprotein subunit; Validated | 98.71 | |
| PRK07588 | 391 | hypothetical protein; Provisional | 98.7 | |
| PRK06847 | 375 | hypothetical protein; Provisional | 98.68 | |
| PRK08274 | 466 | tricarballylate dehydrogenase; Validated | 98.68 | |
| PRK06617 | 374 | 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate | 98.67 | |
| TIGR01989 | 437 | COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T | 98.67 | |
| PRK05257 | 494 | malate:quinone oxidoreductase; Validated | 98.66 | |
| PRK06996 | 398 | hypothetical protein; Provisional | 98.66 | |
| PRK13339 | 497 | malate:quinone oxidoreductase; Reviewed | 98.66 | |
| PRK06753 | 373 | hypothetical protein; Provisional | 98.65 | |
| TIGR03364 | 365 | HpnW_proposed FAD dependent oxidoreductase TIGR033 | 98.64 | |
| PRK07538 | 413 | hypothetical protein; Provisional | 98.64 | |
| PLN02927 | 668 | antheraxanthin epoxidase/zeaxanthin epoxidase | 98.63 | |
| TIGR01320 | 483 | mal_quin_oxido malate:quinone-oxidoreductase. This | 98.62 | |
| TIGR00275 | 400 | flavoprotein, HI0933 family. The model when search | 98.61 | |
| TIGR01813 | 439 | flavo_cyto_c flavocytochrome c. This model describ | 98.61 | |
| PRK12266 | 508 | glpD glycerol-3-phosphate dehydrogenase; Reviewed | 98.6 | |
| PRK07803 | 626 | sdhA succinate dehydrogenase flavoprotein subunit; | 98.59 | |
| TIGR01373 | 407 | soxB sarcosine oxidase, beta subunit family, heter | 98.59 | |
| PF00890 | 417 | FAD_binding_2: FAD binding domain of the Pfam fami | 98.58 | |
| PRK07121 | 492 | hypothetical protein; Validated | 98.58 | |
| PRK08294 | 634 | phenol 2-monooxygenase; Provisional | 98.56 | |
| PRK12845 | 564 | 3-ketosteroid-delta-1-dehydrogenase; Reviewed | 98.56 | |
| KOG1399 | 448 | consensus Flavin-containing monooxygenase [Seconda | 98.56 | |
| PLN02697 | 529 | lycopene epsilon cyclase | 98.55 | |
| PRK08163 | 396 | salicylate hydroxylase; Provisional | 98.54 | |
| PRK11101 | 546 | glpA sn-glycerol-3-phosphate dehydrogenase subunit | 98.52 | |
| TIGR01292 | 300 | TRX_reduct thioredoxin-disulfide reductase. This m | 98.52 | |
| PRK09897 | 534 | hypothetical protein; Provisional | 98.51 | |
| TIGR03219 | 414 | salicylate_mono salicylate 1-monooxygenase. Member | 98.51 | |
| PRK12842 | 574 | putative succinate dehydrogenase; Reviewed | 98.48 | |
| PRK12834 | 549 | putative FAD-binding dehydrogenase; Reviewed | 98.43 | |
| KOG2820 | 399 | consensus FAD-dependent oxidoreductase [General fu | 98.42 | |
| PRK06475 | 400 | salicylate hydroxylase; Provisional | 98.4 | |
| PRK07573 | 640 | sdhA succinate dehydrogenase flavoprotein subunit; | 98.39 | |
| COG0578 | 532 | GlpA Glycerol-3-phosphate dehydrogenase [Energy pr | 98.38 | |
| PRK06134 | 581 | putative FAD-binding dehydrogenase; Reviewed | 98.37 | |
| TIGR00136 | 617 | gidA glucose-inhibited division protein A. GidA, t | 98.36 | |
| PRK15317 | 517 | alkyl hydroperoxide reductase subunit F; Provision | 98.35 | |
| PRK12835 | 584 | 3-ketosteroid-delta-1-dehydrogenase; Reviewed | 98.35 | |
| PF13454 | 156 | NAD_binding_9: FAD-NAD(P)-binding | 98.34 | |
| TIGR00292 | 254 | thiazole biosynthesis enzyme. This enzyme is invol | 98.34 | |
| PF00996 | 438 | GDI: GDP dissociation inhibitor; InterPro: IPR0182 | 98.34 | |
| PRK04176 | 257 | ribulose-1,5-biphosphate synthetase; Provisional | 98.32 | |
| PRK12839 | 572 | hypothetical protein; Provisional | 98.3 | |
| PRK06175 | 433 | L-aspartate oxidase; Provisional | 98.3 | |
| TIGR03140 | 515 | AhpF alkyl hydroperoxide reductase, F subunit. Thi | 98.28 | |
| TIGR00551 | 488 | nadB L-aspartate oxidase. L-aspartate oxidase is t | 98.24 | |
| PF06100 | 500 | Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross | 98.24 | |
| PRK05945 | 575 | sdhA succinate dehydrogenase flavoprotein subunit; | 98.24 | |
| PRK12843 | 578 | putative FAD-binding dehydrogenase; Reviewed | 98.23 | |
| PRK08958 | 588 | sdhA succinate dehydrogenase flavoprotein subunit; | 98.22 | |
| TIGR02485 | 432 | CobZ_N-term precorrin 3B synthase CobZ. CobZ is es | 98.22 | |
| PLN02661 | 357 | Putative thiazole synthesis | 98.19 | |
| PRK07395 | 553 | L-aspartate oxidase; Provisional | 98.18 | |
| PTZ00139 | 617 | Succinate dehydrogenase [ubiquinone] flavoprotein | 98.17 | |
| PRK09078 | 598 | sdhA succinate dehydrogenase flavoprotein subunit; | 98.16 | |
| COG2072 | 443 | TrkA Predicted flavoprotein involved in K+ transpo | 98.16 | |
| PLN02852 | 491 | ferredoxin-NADP+ reductase | 98.15 | |
| COG0493 | 457 | GltD NADPH-dependent glutamate synthase beta chain | 98.14 | |
| TIGR03315 | 1012 | Se_ygfK putative selenate reductase, YgfK subunit. | 98.14 | |
| PRK12779 | 944 | putative bifunctional glutamate synthase subunit b | 98.13 | |
| PRK08071 | 510 | L-aspartate oxidase; Provisional | 98.13 | |
| PRK06854 | 608 | adenylylsulfate reductase subunit alpha; Validated | 98.12 | |
| PRK05249 | 461 | soluble pyridine nucleotide transhydrogenase; Prov | 98.1 | |
| PRK12831 | 464 | putative oxidoreductase; Provisional | 98.09 | |
| PF01494 | 356 | FAD_binding_3: FAD binding domain; InterPro: IPR00 | 98.09 | |
| PRK06069 | 577 | sdhA succinate dehydrogenase flavoprotein subunit; | 98.09 | |
| TIGR01350 | 461 | lipoamide_DH dihydrolipoamide dehydrogenase. The m | 98.06 | |
| PF00743 | 531 | FMO-like: Flavin-binding monooxygenase-like; Inter | 98.05 | |
| PRK06263 | 543 | sdhA succinate dehydrogenase flavoprotein subunit; | 98.05 | |
| COG1148 | 622 | HdrA Heterodisulfide reductase, subunit A and rela | 98.03 | |
| TIGR01424 | 446 | gluta_reduc_2 glutathione-disulfide reductase, pla | 98.01 | |
| PRK06115 | 466 | dihydrolipoamide dehydrogenase; Reviewed | 98.01 | |
| PF12831 | 428 | FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 | 98.0 | |
| PRK09853 | 1019 | putative selenate reductase subunit YgfK; Provisio | 98.0 | |
| PLN00093 | 450 | geranylgeranyl diphosphate reductase; Provisional | 98.0 | |
| TIGR01421 | 450 | gluta_reduc_1 glutathione-disulfide reductase, ani | 98.0 | |
| TIGR01176 | 580 | fum_red_Fp fumarate reductase, flavoprotein subuni | 97.98 | |
| PRK07251 | 438 | pyridine nucleotide-disulfide oxidoreductase; Prov | 97.98 | |
| PRK13369 | 502 | glycerol-3-phosphate dehydrogenase; Provisional | 97.97 | |
| TIGR03143 | 555 | AhpF_homolog putative alkyl hydroperoxide reductas | 97.97 | |
| PRK08010 | 441 | pyridine nucleotide-disulfide oxidoreductase; Prov | 97.95 | |
| TIGR01316 | 449 | gltA glutamate synthase (NADPH), homotetrameric. T | 97.95 | |
| PRK06116 | 450 | glutathione reductase; Validated | 97.94 | |
| PRK06467 | 471 | dihydrolipoamide dehydrogenase; Reviewed | 97.94 | |
| PRK12775 | 1006 | putative trifunctional 2-polyprenylphenol hydroxyl | 97.93 | |
| PRK05976 | 472 | dihydrolipoamide dehydrogenase; Validated | 97.92 | |
| PRK06416 | 462 | dihydrolipoamide dehydrogenase; Reviewed | 97.92 | |
| PLN02985 | 514 | squalene monooxygenase | 97.92 | |
| TIGR02360 | 390 | pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. | 97.9 | |
| KOG2614 | 420 | consensus Kynurenine 3-monooxygenase and related f | 97.9 | |
| TIGR01790 | 388 | carotene-cycl lycopene cyclase family protein. Thi | 97.9 | |
| PRK07512 | 513 | L-aspartate oxidase; Provisional | 97.89 | |
| PTZ00188 | 506 | adrenodoxin reductase; Provisional | 97.89 | |
| PF06039 | 488 | Mqo: Malate:quinone oxidoreductase (Mqo); InterPro | 97.89 | |
| PRK06370 | 463 | mercuric reductase; Validated | 97.88 | |
| PRK06292 | 460 | dihydrolipoamide dehydrogenase; Validated | 97.88 | |
| PRK12778 | 752 | putative bifunctional 2-polyprenylphenol hydroxyla | 97.88 | |
| TIGR02028 | 398 | ChlP geranylgeranyl reductase. This model represen | 97.88 | |
| PRK12769 | 654 | putative oxidoreductase Fe-S binding subunit; Revi | 97.87 | |
| PRK12814 | 652 | putative NADPH-dependent glutamate synthase small | 97.87 | |
| KOG0399 | 2142 | consensus Glutamate synthase [Amino acid transport | 97.87 | |
| PRK07818 | 466 | dihydrolipoamide dehydrogenase; Reviewed | 97.87 | |
| PRK10262 | 321 | thioredoxin reductase; Provisional | 97.86 | |
| PRK11749 | 457 | dihydropyrimidine dehydrogenase subunit A; Provisi | 97.84 | |
| PRK12837 | 513 | 3-ketosteroid-delta-1-dehydrogenase; Provisional | 97.84 | |
| PRK12810 | 471 | gltD glutamate synthase subunit beta; Reviewed | 97.83 | |
| TIGR01372 | 985 | soxA sarcosine oxidase, alpha subunit family, hete | 97.83 | |
| KOG2404 | 477 | consensus Fumarate reductase, flavoprotein subunit | 97.82 | |
| PRK14694 | 468 | putative mercuric reductase; Provisional | 97.81 | |
| PRK14727 | 479 | putative mercuric reductase; Provisional | 97.8 | |
| TIGR02053 | 463 | MerA mercuric reductase. This model represents the | 97.78 | |
| PRK06567 | 1028 | putative bifunctional glutamate synthase subunit b | 97.77 | |
| PRK12809 | 639 | putative oxidoreductase Fe-S binding subunit; Revi | 97.76 | |
| PLN02464 | 627 | glycerol-3-phosphate dehydrogenase | 97.76 | |
| PRK05192 | 618 | tRNA uridine 5-carboxymethylaminomethyl modificati | 97.74 | |
| TIGR01318 | 467 | gltD_gamma_fam glutamate synthase small subunit fa | 97.73 | |
| PRK05335 | 436 | tRNA (uracil-5-)-methyltransferase Gid; Reviewed | 97.73 | |
| PRK12844 | 557 | 3-ketosteroid-delta-1-dehydrogenase; Reviewed | 97.73 | |
| PRK13748 | 561 | putative mercuric reductase; Provisional | 97.72 | |
| TIGR01789 | 370 | lycopene_cycl lycopene cyclase. This model represe | 97.72 | |
| COG0492 | 305 | TrxB Thioredoxin reductase [Posttranslational modi | 97.72 | |
| PRK06327 | 475 | dihydrolipoamide dehydrogenase; Validated | 97.72 | |
| PLN02815 | 594 | L-aspartate oxidase | 97.69 | |
| PTZ00058 | 561 | glutathione reductase; Provisional | 97.69 | |
| KOG2844 | 856 | consensus Dimethylglycine dehydrogenase precursor | 97.68 | |
| PTZ00052 | 499 | thioredoxin reductase; Provisional | 97.67 | |
| TIGR01317 | 485 | GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal | 97.67 | |
| PRK07843 | 557 | 3-ketosteroid-delta-1-dehydrogenase; Reviewed | 97.65 | |
| COG3573 | 552 | Predicted oxidoreductase [General function predict | 97.64 | |
| PTZ00367 | 567 | squalene epoxidase; Provisional | 97.64 | |
| PRK08641 | 589 | sdhA succinate dehydrogenase flavoprotein subunit; | 97.64 | |
| KOG2415 | 621 | consensus Electron transfer flavoprotein ubiquinon | 97.64 | |
| PF04820 | 454 | Trp_halogenase: Tryptophan halogenase; InterPro: I | 97.63 | |
| PRK07804 | 541 | L-aspartate oxidase; Provisional | 97.63 | |
| TIGR00137 | 433 | gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo | 97.62 | |
| PRK12771 | 564 | putative glutamate synthase (NADPH) small subunit; | 97.62 | |
| PLN02507 | 499 | glutathione reductase | 97.61 | |
| TIGR01812 | 566 | sdhA_frdA_Gneg succinate dehydrogenase or fumarate | 97.58 | |
| PRK06452 | 566 | sdhA succinate dehydrogenase flavoprotein subunit; | 97.57 | |
| PLN00128 | 635 | Succinate dehydrogenase [ubiquinone] flavoprotein | 97.56 | |
| PRK07057 | 591 | sdhA succinate dehydrogenase flavoprotein subunit; | 97.54 | |
| PF00732 | 296 | GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 | 97.54 | |
| KOG2960 | 328 | consensus Protein involved in thiamine biosynthesi | 97.53 | |
| PRK12770 | 352 | putative glutamate synthase subunit beta; Provisio | 97.53 | |
| PRK08401 | 466 | L-aspartate oxidase; Provisional | 97.53 | |
| PF07992 | 201 | Pyr_redox_2: Pyridine nucleotide-disulphide oxidor | 97.53 | |
| COG1249 | 454 | Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, | 97.49 | |
| PF01134 | 392 | GIDA: Glucose inhibited division protein A; InterP | 97.48 | |
| PLN02546 | 558 | glutathione reductase | 97.47 | |
| PRK08626 | 657 | fumarate reductase flavoprotein subunit; Provision | 97.47 | |
| PTZ00306 | 1167 | NADH-dependent fumarate reductase; Provisional | 97.46 | |
| PF00070 | 80 | Pyr_redox: Pyridine nucleotide-disulphide oxidored | 97.46 | |
| TIGR01423 | 486 | trypano_reduc trypanothione-disulfide reductase. T | 97.46 | |
| PRK13984 | 604 | putative oxidoreductase; Provisional | 97.45 | |
| TIGR02462 | 544 | pyranose_ox pyranose oxidase. Pyranose oxidase (al | 97.41 | |
| COG2509 | 486 | Uncharacterized FAD-dependent dehydrogenases [Gene | 97.4 | |
| PTZ00153 | 659 | lipoamide dehydrogenase; Provisional | 97.39 | |
| PRK09231 | 582 | fumarate reductase flavoprotein subunit; Validated | 97.37 | |
| PRK08275 | 554 | putative oxidoreductase; Provisional | 97.33 | |
| PRK09077 | 536 | L-aspartate oxidase; Provisional | 97.29 | |
| PRK06912 | 458 | acoL dihydrolipoamide dehydrogenase; Validated | 97.29 | |
| PRK08255 | 765 | salicylyl-CoA 5-hydroxylase; Reviewed | 97.28 | |
| PRK07845 | 466 | flavoprotein disulfide reductase; Reviewed | 97.27 | |
| KOG1298 | 509 | consensus Squalene monooxygenase [Lipid transport | 97.27 | |
| PRK02106 | 560 | choline dehydrogenase; Validated | 97.27 | |
| TIGR01438 | 484 | TGR thioredoxin and glutathione reductase selenopr | 97.26 | |
| PRK08205 | 583 | sdhA succinate dehydrogenase flavoprotein subunit; | 97.23 | |
| PRK05329 | 422 | anaerobic glycerol-3-phosphate dehydrogenase subun | 97.23 | |
| COG3075 | 421 | GlpB Anaerobic glycerol-3-phosphate dehydrogenase | 97.22 | |
| TIGR01811 | 603 | sdhA_Bsu succinate dehydrogenase or fumarate reduc | 97.22 | |
| TIGR02061 | 614 | aprA adenosine phosphosulphate reductase, alpha su | 97.17 | |
| PF07156 | 368 | Prenylcys_lyase: Prenylcysteine lyase; InterPro: I | 97.16 | |
| COG1053 | 562 | SdhA Succinate dehydrogenase/fumarate reductase, f | 97.16 | |
| KOG1800 | 468 | consensus Ferredoxin/adrenodoxin reductase [Nucleo | 97.13 | |
| KOG1439 | 440 | consensus RAB proteins geranylgeranyltransferase c | 97.1 | |
| KOG2665 | 453 | consensus Predicted FAD-dependent oxidoreductase [ | 97.04 | |
| COG5044 | 434 | MRS6 RAB proteins geranylgeranyltransferase compon | 96.96 | |
| PRK13800 | 897 | putative oxidoreductase/HEAT repeat-containing pro | 96.9 | |
| KOG2853 | 509 | consensus Possible oxidoreductase [General functio | 96.9 | |
| PRK04965 | 377 | NADH:flavorubredoxin oxidoreductase; Provisional | 96.9 | |
| TIGR01350 | 461 | lipoamide_DH dihydrolipoamide dehydrogenase. The m | 96.87 | |
| PRK13512 | 438 | coenzyme A disulfide reductase; Provisional | 96.86 | |
| KOG2852 | 380 | consensus Possible oxidoreductase [General functio | 96.8 | |
| TIGR01810 | 532 | betA choline dehydrogenase. This enzyme is a membe | 96.79 | |
| PRK09564 | 444 | coenzyme A disulfide reductase; Reviewed | 96.77 | |
| COG2303 | 542 | BetA Choline dehydrogenase and related flavoprotei | 96.76 | |
| TIGR03378 | 419 | glycerol3P_GlpB glycerol-3-phosphate dehydrogenase | 96.76 | |
| PLN02785 | 587 | Protein HOTHEAD | 96.75 | |
| PRK07846 | 451 | mycothione reductase; Reviewed | 96.74 | |
| COG4716 | 587 | Myosin-crossreactive antigen [Function unknown] | 96.73 | |
| TIGR03452 | 452 | mycothione_red mycothione reductase. Mycothiol, a | 96.73 | |
| TIGR03197 | 381 | MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri | 96.7 | |
| PRK09754 | 396 | phenylpropionate dioxygenase ferredoxin reductase | 96.66 | |
| PRK06416 | 462 | dihydrolipoamide dehydrogenase; Reviewed | 96.66 | |
| PTZ00318 | 424 | NADH dehydrogenase-like protein; Provisional | 96.65 | |
| PRK07846 | 451 | mycothione reductase; Reviewed | 96.64 | |
| PRK05249 | 461 | soluble pyridine nucleotide transhydrogenase; Prov | 96.64 | |
| KOG1335 | 506 | consensus Dihydrolipoamide dehydrogenase [Energy p | 96.63 | |
| TIGR03452 | 452 | mycothione_red mycothione reductase. Mycothiol, a | 96.58 | |
| COG0446 | 415 | HcaD Uncharacterized NAD(FAD)-dependent dehydrogen | 96.47 | |
| PF13434 | 341 | K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi | 96.43 | |
| COG1206 | 439 | Gid NAD(FAD)-utilizing enzyme possibly involved in | 96.25 | |
| PRK06116 | 450 | glutathione reductase; Validated | 96.24 | |
| PLN02507 | 499 | glutathione reductase | 96.23 | |
| COG4529 | 474 | Uncharacterized protein conserved in bacteria [Fun | 95.82 | |
| COG0029 | 518 | NadB Aspartate oxidase [Coenzyme metabolism] | 95.74 | |
| PRK04965 | 377 | NADH:flavorubredoxin oxidoreductase; Provisional | 95.58 | |
| COG1252 | 405 | Ndh NADH dehydrogenase, FAD-containing subunit [En | 95.51 | |
| TIGR03169 | 364 | Nterm_to_SelD pyridine nucleotide-disulfide oxidor | 95.41 | |
| TIGR02352 | 337 | thiamin_ThiO glycine oxidase ThiO. This family con | 95.3 | |
| PRK09754 | 396 | phenylpropionate dioxygenase ferredoxin reductase | 95.12 | |
| KOG4716 | 503 | consensus Thioredoxin reductase [Posttranslational | 95.04 | |
| PRK01438 | 480 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 95.02 | |
| KOG0405 | 478 | consensus Pyridine nucleotide-disulphide oxidoredu | 94.9 | |
| PRK02705 | 459 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 94.72 | |
| PF01210 | 157 | NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate | 94.66 | |
| PRK14989 | 847 | nitrite reductase subunit NirD; Provisional | 94.57 | |
| PRK07251 | 438 | pyridine nucleotide-disulfide oxidoreductase; Prov | 94.56 | |
| COG0445 | 621 | GidA Flavin-dependent tRNA uridine 5-carboxymethyl | 94.55 | |
| KOG0404 | 322 | consensus Thioredoxin reductase [Posttranslational | 94.34 | |
| TIGR02374 | 785 | nitri_red_nirB nitrite reductase [NAD(P)H], large | 94.23 | |
| PRK05976 | 472 | dihydrolipoamide dehydrogenase; Validated | 94.2 | |
| KOG3855 | 481 | consensus Monooxygenase involved in coenzyme Q (ub | 94.12 | |
| PF02737 | 180 | 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind | 93.83 | |
| TIGR02053 | 463 | MerA mercuric reductase. This model represents the | 93.8 | |
| PF03721 | 185 | UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen | 93.76 | |
| KOG1238 | 623 | consensus Glucose dehydrogenase/choline dehydrogen | 93.73 | |
| PRK06912 | 458 | acoL dihydrolipoamide dehydrogenase; Validated | 93.45 | |
| KOG3923 | 342 | consensus D-aspartate oxidase [Amino acid transpor | 93.43 | |
| PRK06370 | 463 | mercuric reductase; Validated | 93.42 | |
| TIGR01421 | 450 | gluta_reduc_1 glutathione-disulfide reductase, ani | 93.41 | |
| PRK06467 | 471 | dihydrolipoamide dehydrogenase; Reviewed | 93.39 | |
| PRK06115 | 466 | dihydrolipoamide dehydrogenase; Reviewed | 93.38 | |
| COG3634 | 520 | AhpF Alkyl hydroperoxide reductase, large subunit | 93.36 | |
| COG1249 | 454 | Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, | 93.25 | |
| PF01262 | 168 | AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal | 93.23 | |
| PRK06292 | 460 | dihydrolipoamide dehydrogenase; Validated | 93.2 | |
| KOG0042 | 680 | consensus Glycerol-3-phosphate dehydrogenase [Ener | 93.19 | |
| TIGR03385 | 427 | CoA_CoA_reduc CoA-disulfide reductase. Members of | 93.18 | |
| PRK13512 | 438 | coenzyme A disulfide reductase; Provisional | 93.13 | |
| KOG3851 | 446 | consensus Sulfide:quinone oxidoreductase/flavo-bin | 93.08 | |
| PRK14106 | 450 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 93.07 | |
| PRK07818 | 466 | dihydrolipoamide dehydrogenase; Reviewed | 93.06 | |
| PF02558 | 151 | ApbA: Ketopantoate reductase PanE/ApbA; InterPro: | 93.04 | |
| PRK06327 | 475 | dihydrolipoamide dehydrogenase; Validated | 92.83 | |
| PF13738 | 203 | Pyr_redox_3: Pyridine nucleotide-disulphide oxidor | 92.79 | |
| PRK06129 | 308 | 3-hydroxyacyl-CoA dehydrogenase; Validated | 92.76 | |
| PF13434 | 341 | K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi | 92.52 | |
| COG0569 | 225 | TrkA K+ transport systems, NAD-binding component [ | 92.5 | |
| PRK09564 | 444 | coenzyme A disulfide reductase; Reviewed | 92.39 | |
| TIGR02374 | 785 | nitri_red_nirB nitrite reductase [NAD(P)H], large | 92.33 | |
| COG0686 | 371 | Ald Alanine dehydrogenase [Amino acid transport an | 92.12 | |
| PRK07845 | 466 | flavoprotein disulfide reductase; Reviewed | 92.01 | |
| KOG2755 | 334 | consensus Oxidoreductase [General function predict | 91.98 | |
| TIGR03140 | 515 | AhpF alkyl hydroperoxide reductase, F subunit. Thi | 91.96 | |
| cd01080 | 168 | NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of | 91.83 | |
| PRK08293 | 287 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 91.83 | |
| TIGR01470 | 205 | cysG_Nterm siroheme synthase, N-terminal domain. T | 91.72 | |
| PRK09260 | 288 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 91.6 | |
| PTZ00058 | 561 | glutathione reductase; Provisional | 91.6 | |
| PRK06249 | 313 | 2-dehydropantoate 2-reductase; Provisional | 91.57 | |
| PTZ00153 | 659 | lipoamide dehydrogenase; Provisional | 91.56 | |
| PRK14989 | 847 | nitrite reductase subunit NirD; Provisional | 91.55 | |
| KOG2311 | 679 | consensus NAD/FAD-utilizing protein possibly invol | 91.5 | |
| PRK07819 | 286 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 91.48 | |
| TIGR01424 | 446 | gluta_reduc_2 glutathione-disulfide reductase, pla | 91.48 | |
| PRK05708 | 305 | 2-dehydropantoate 2-reductase; Provisional | 91.19 | |
| PRK07066 | 321 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 91.18 | |
| TIGR01316 | 449 | gltA glutamate synthase (NADPH), homotetrameric. T | 91.11 | |
| PRK15317 | 517 | alkyl hydroperoxide reductase subunit F; Provision | 91.1 | |
| PRK10262 | 321 | thioredoxin reductase; Provisional | 90.97 | |
| PRK07530 | 292 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 90.95 | |
| PF01488 | 135 | Shikimate_DH: Shikimate / quinate 5-dehydrogenase; | 90.85 | |
| PRK08010 | 441 | pyridine nucleotide-disulfide oxidoreductase; Prov | 90.83 | |
| PRK04690 | 468 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 90.81 | |
| PRK06522 | 304 | 2-dehydropantoate 2-reductase; Reviewed | 90.75 | |
| COG0771 | 448 | MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas | 90.74 | |
| TIGR03143 | 555 | AhpF_homolog putative alkyl hydroperoxide reductas | 90.52 | |
| COG1004 | 414 | Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en | 90.47 | |
| PRK12921 | 305 | 2-dehydropantoate 2-reductase; Provisional | 90.4 | |
| PRK08229 | 341 | 2-dehydropantoate 2-reductase; Provisional | 90.39 | |
| PRK04148 | 134 | hypothetical protein; Provisional | 90.38 | |
| PRK12831 | 464 | putative oxidoreductase; Provisional | 90.25 | |
| PRK12770 | 352 | putative glutamate synthase subunit beta; Provisio | 90.23 | |
| PF13241 | 103 | NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ | 90.17 | |
| PLN02546 | 558 | glutathione reductase | 90.12 | |
| TIGR01763 | 305 | MalateDH_bact malate dehydrogenase, NAD-dependent. | 90.06 | |
| cd05292 | 308 | LDH_2 A subgroup of L-lactate dehydrogenases. L-la | 90.0 | |
| TIGR00518 | 370 | alaDH alanine dehydrogenase. The family of known L | 89.95 | |
| COG1748 | 389 | LYS9 Saccharopine dehydrogenase and related protei | 89.94 | |
| TIGR01292 | 300 | TRX_reduct thioredoxin-disulfide reductase. This m | 89.92 | |
| PRK01710 | 458 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 89.82 | |
| PRK06035 | 291 | 3-hydroxyacyl-CoA dehydrogenase; Validated | 89.8 | |
| PRK06718 | 202 | precorrin-2 dehydrogenase; Reviewed | 89.72 | |
| TIGR01423 | 486 | trypano_reduc trypanothione-disulfide reductase. T | 89.7 | |
| PRK05808 | 282 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 89.69 | |
| PRK11064 | 415 | wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro | 89.41 | |
| PRK04308 | 445 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 89.31 | |
| PRK06719 | 157 | precorrin-2 dehydrogenase; Validated | 89.22 | |
| TIGR02354 | 200 | thiF_fam2 thiamine biosynthesis protein ThiF, fami | 89.21 | |
| PRK13748 | 561 | putative mercuric reductase; Provisional | 89.15 | |
| PRK03369 | 488 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 89.14 | |
| PRK14694 | 468 | putative mercuric reductase; Provisional | 88.93 | |
| PLN02545 | 295 | 3-hydroxybutyryl-CoA dehydrogenase | 88.88 | |
| PRK14619 | 308 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 88.8 | |
| PRK14727 | 479 | putative mercuric reductase; Provisional | 88.75 | |
| PTZ00052 | 499 | thioredoxin reductase; Provisional | 88.65 | |
| TIGR03026 | 411 | NDP-sugDHase nucleotide sugar dehydrogenase. All o | 88.63 | |
| PRK02472 | 447 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 88.48 | |
| PRK06130 | 311 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 88.41 | |
| PRK00094 | 325 | gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr | 88.4 | |
| TIGR01438 | 484 | TGR thioredoxin and glutathione reductase selenopr | 88.2 | |
| PRK01368 | 454 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 87.86 | |
| PTZ00318 | 424 | NADH dehydrogenase-like protein; Provisional | 87.82 | |
| PRK14618 | 328 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 87.77 | |
| PF03446 | 163 | NAD_binding_2: NAD binding domain of 6-phosphogluc | 87.74 | |
| PRK09424 | 509 | pntA NAD(P) transhydrogenase subunit alpha; Provis | 87.7 | |
| PRK00421 | 461 | murC UDP-N-acetylmuramate--L-alanine ligase; Provi | 87.52 | |
| PRK11749 | 457 | dihydropyrimidine dehydrogenase subunit A; Provisi | 87.52 | |
| TIGR03862 | 376 | flavo_PP4765 uncharacterized flavoprotein, PP_4765 | 87.12 | |
| TIGR01318 | 467 | gltD_gamma_fam glutamate synthase small subunit fa | 86.93 | |
| PRK02006 | 498 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 86.84 | |
| COG3634 | 520 | AhpF Alkyl hydroperoxide reductase, large subunit | 86.77 | |
| PRK08306 | 296 | dipicolinate synthase subunit A; Reviewed | 86.77 | |
| cd05311 | 226 | NAD_bind_2_malic_enz NAD(P) binding domain of mali | 86.72 | |
| PRK12778 | 752 | putative bifunctional 2-polyprenylphenol hydroxyla | 86.65 | |
| KOG4405 | 547 | consensus GDP dissociation inhibitor [Signal trans | 86.47 | |
| PRK14620 | 326 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 86.42 | |
| cd01075 | 200 | NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l | 86.35 | |
| TIGR02279 | 503 | PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa | 86.32 | |
| cd05191 | 86 | NAD_bind_amino_acid_DH NAD(P) binding domain of am | 86.26 | |
| PRK00141 | 473 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 86.23 | |
| COG1893 | 307 | ApbA Ketopantoate reductase [Coenzyme metabolism] | 86.0 | |
| cd00401 | 413 | AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado | 85.85 | |
| PRK12549 | 284 | shikimate 5-dehydrogenase; Reviewed | 85.82 | |
| PRK07417 | 279 | arogenate dehydrogenase; Reviewed | 85.74 | |
| PTZ00082 | 321 | L-lactate dehydrogenase; Provisional | 85.67 | |
| PRK06223 | 307 | malate dehydrogenase; Reviewed | 85.65 | |
| PRK08268 | 507 | 3-hydroxy-acyl-CoA dehydrogenase; Validated | 85.64 | |
| PLN02353 | 473 | probable UDP-glucose 6-dehydrogenase | 85.48 | |
| PRK15057 | 388 | UDP-glucose 6-dehydrogenase; Provisional | 85.46 | |
| COG1252 | 405 | Ndh NADH dehydrogenase, FAD-containing subunit [En | 85.2 | |
| PRK07531 | 495 | bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe | 85.05 | |
| PRK11199 | 374 | tyrA bifunctional chorismate mutase/prephenate deh | 85.0 | |
| TIGR02853 | 287 | spore_dpaA dipicolinic acid synthetase, A subunit. | 84.83 | |
| PRK11730 | 715 | fadB multifunctional fatty acid oxidation complex | 84.74 | |
| PF02254 | 116 | TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg | 84.62 | |
| PF00899 | 135 | ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a | 84.27 | |
| PRK00683 | 418 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 84.24 | |
| PF00056 | 141 | Ldh_1_N: lactate/malate dehydrogenase, NAD binding | 84.22 | |
| PRK01390 | 460 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 84.14 | |
| PRK05675 | 570 | sdhA succinate dehydrogenase flavoprotein subunit; | 84.05 | |
| cd05291 | 306 | HicDH_like L-2-hydroxyisocapronate dehydrogenases | 84.01 | |
| TIGR02437 | 714 | FadB fatty oxidation complex, alpha subunit FadB. | 83.94 | |
| TIGR00561 | 511 | pntA NAD(P) transhydrogenase, alpha subunit. In so | 83.86 | |
| PRK03803 | 448 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 83.84 | |
| COG1250 | 307 | FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo | 83.37 | |
| TIGR01915 | 219 | npdG NADPH-dependent F420 reductase. This model re | 83.05 | |
| PRK07688 | 339 | thiamine/molybdopterin biosynthesis ThiF/MoeB-like | 83.05 | |
| PRK15116 | 268 | sulfur acceptor protein CsdL; Provisional | 83.05 | |
| TIGR00507 | 270 | aroE shikimate 5-dehydrogenase. This model finds p | 82.96 | |
| KOG1335 | 506 | consensus Dihydrolipoamide dehydrogenase [Energy p | 82.96 | |
| PRK12475 | 338 | thiamine/molybdopterin biosynthesis MoeB-like prot | 82.8 | |
| PRK12779 | 944 | putative bifunctional glutamate synthase subunit b | 82.71 | |
| TIGR00936 | 406 | ahcY adenosylhomocysteinase. This enzyme hydrolyze | 82.55 | |
| PRK03815 | 401 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 82.49 | |
| TIGR02441 | 737 | fa_ox_alpha_mit fatty acid oxidation complex, alph | 82.46 | |
| KOG2495 | 491 | consensus NADH-dehydrogenase (ubiquinone) [Energy | 82.45 | |
| KOG2304 | 298 | consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid t | 82.43 | |
| cd01078 | 194 | NAD_bind_H4MPT_DH NADP binding domain of methylene | 82.27 | |
| PRK03806 | 438 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 82.1 | |
| PRK12548 | 289 | shikimate 5-dehydrogenase; Provisional | 82.07 | |
| PLN02172 | 461 | flavin-containing monooxygenase FMO GS-OX | 82.05 | |
| PTZ00117 | 319 | malate dehydrogenase; Provisional | 82.01 | |
| TIGR02356 | 202 | adenyl_thiF thiazole biosynthesis adenylyltransfer | 81.67 | |
| PF01494 | 356 | FAD_binding_3: FAD binding domain; InterPro: IPR00 | 81.57 | |
| PRK12814 | 652 | putative NADPH-dependent glutamate synthase small | 81.57 | |
| PRK08644 | 212 | thiamine biosynthesis protein ThiF; Provisional | 81.49 | |
| TIGR02440 | 699 | FadJ fatty oxidation complex, alpha subunit FadJ. | 81.48 | |
| cd01065 | 155 | NAD_bind_Shikimate_DH NAD(P) binding domain of Shi | 81.45 | |
| cd01339 | 300 | LDH-like_MDH L-lactate dehydrogenase-like malate d | 81.38 | |
| TIGR01505 | 291 | tartro_sem_red 2-hydroxy-3-oxopropionate reductase | 81.28 | |
| cd01487 | 174 | E1_ThiF_like E1_ThiF_like. Member of superfamily o | 81.19 | |
| PF13478 | 136 | XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2 | 80.84 | |
| COG4529 | 474 | Uncharacterized protein conserved in bacteria [Fun | 80.74 | |
| PRK11154 | 708 | fadJ multifunctional fatty acid oxidation complex | 80.44 | |
| PRK00066 | 315 | ldh L-lactate dehydrogenase; Reviewed | 80.41 | |
| PRK09496 | 453 | trkA potassium transporter peripheral membrane com | 80.37 | |
| PRK05562 | 223 | precorrin-2 dehydrogenase; Provisional | 80.3 | |
| cd05293 | 312 | LDH_1 A subgroup of L-lactate dehydrogenases. L-la | 80.3 | |
| TIGR01087 | 433 | murD UDP-N-acetylmuramoylalanine--D-glutamate liga | 80.29 | |
| PF00670 | 162 | AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase | 80.28 | |
| PRK12810 | 471 | gltD glutamate synthase subunit beta; Reviewed | 80.09 |
| >PLN03000 amine oxidase | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.7e-113 Score=977.31 Aligned_cols=667 Identities=76% Similarity=1.235 Sum_probs=600.0
Q ss_pred CCcccchhhHHHHHHHHHHHHHhhhhccccccchhccCCCCCCCCCCcEEEECccHHHHHHHHHHHHCCCcEEEEecCCC
Q 005607 2 FTESVPKHCHSLLDSAYNYLVSNGYINFGVAPEIKEKIPVEPSSNKLRVLVIGAGLAGLAAARQLMRLGFRVTVLEGRKR 81 (688)
Q Consensus 2 ~~~~~~~~~~~~~~~~~~~~~~~~~in~g~~~~~~~~~p~~~~~~~~dVvIVGAGiaGLsAA~~L~k~G~~V~VLEa~~r 81 (688)
++..|+.+|.+|+..+|+||++|||||+|.+.......+... ...+|+|||||++||+||+.|.+.|++|+|||++++
T Consensus 141 a~~~~~~~~~~l~~~~~~~L~r~G~in~g~~~~~~~~~~~~~--~~~~VvIIGaG~aGL~aA~~L~~~G~~V~VlE~~~r 218 (881)
T PLN03000 141 FLGSIPKHCSSLLDSAYNYLVTHGYINFGIAQAIKDKFPAQS--SKSSVVIVGAGLSGLAAARQLMRFGFKVTVLEGRKR 218 (881)
T ss_pred HhhhcchhHHHHHHHHHHHHHHcCcccHHHHHHHHhhccccC--CCCCEEEECccHHHHHHHHHHHHCCCcEEEEEccCc
Confidence 457788999999999999999999999999988766554432 248999999999999999999999999999999999
Q ss_pred CcceeeeeecCCCCCCCCceeeeccceeecCCCCcHHHHHHHHhCCceeeecCCccEEecCCcccChhhhHHHHHHHHHH
Q 005607 82 AGGRVYTKKMEGGAGNRISASADLGGSVLTGTLGNPLGILAKQLGSLLHKVRDKCPLYRLDGNSVDPEIDMKVEADFNRL 161 (688)
Q Consensus 82 vGGr~~S~~~~g~~g~~~~~~~D~G~~~~~~~~~~~l~~L~~~LGl~~~~~~~~~~~~~~~G~~~~~~~~~~~~~~~~~l 161 (688)
+|||++|.+..+. ..++.+|+|++|+++.+.|++..|++++|++.+.....+++|..+|+.++...+..+...+..+
T Consensus 219 iGGRi~T~~~~g~---~~~~~~DlGas~i~g~~~npl~~L~~qlgl~l~~~~~~~~ly~~~Gk~v~~~~~~~ve~~fn~l 295 (881)
T PLN03000 219 PGGRVYTKKMEAN---RVGAAADLGGSVLTGTLGNPLGIIARQLGSSLYKVRDKCPLYRVDGKPVDPDVDLKVEVAFNQL 295 (881)
T ss_pred CCCCcceecccCC---CCceEeecCCeEEeCCCccHHHHHHHHcCCceeecCCCCeEEEeCCcCCchhhhhhHHHHHHHH
Confidence 9999999987653 2346899999999999999999999999999888877888899999998776666666777888
Q ss_pred HHHHHHHHHHhhccccCCCHHHHHHHHHHHhccCCCHHHHHHHHHHHHhhhhccccchhhhHHHhhccCCCCCCCCCeee
Q 005607 162 LDKASRLRQLMGEVAMDVSLGSALETFWRVYWDSGNAEAMNLFNWHLANLEYANASLLSKLSLAFWDQDDPYDMGGDHCF 241 (688)
Q Consensus 162 l~~~~~~~~~~~~~~~~~sl~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~~~~~~~~~~~~g~~~~ 241 (688)
++.+.+++...+....+.++.++++.+.++......++.+.++.|++..+++.++..++.++..+|.+...+..++.+++
T Consensus 296 Ld~~~~lr~l~~~~~~D~SLg~aLe~~~~~~g~~~t~e~~~Ll~w~lanLE~~~as~ls~LSl~~wdqd~~~e~~G~~~~ 375 (881)
T PLN03000 296 LDKASKLRQLMGDVSMDVSLGAALETFRQVSGNDVATEEMGLFNWHLANLEYANAGLVSKLSLAFWDQDDPYDMGGDHCF 375 (881)
T ss_pred HHHHHHHHHHhcccCcCCcHHHHHHHHHHHHcccCCHHHHHHHHHHHHHHhcccccCHHHHHHHHhhhcccccCCCceEE
Confidence 88877777777666778899998888888887778888888899999999998888899999988887666667778899
Q ss_pred cCCChHHHHHHHHHcCCcccCceEEEEEecCCeEEEEECCEEEEecEEEEcCCCCcccCCccccCCCCCHHHHHHHHhcC
Q 005607 242 LPGGNGRLVQALVENVPILYEKTVHTIRYGSDGVQVLAGSQVFEGDMVLCTVPLGVLKSGSIKFIPELPQRKLDAIKRLG 321 (688)
Q Consensus 242 ~~gG~~~L~~~L~~~l~I~lnt~V~~I~~~~~~v~V~~~g~~~~ad~VI~AvP~~~l~~~~i~~~p~Lp~~~~~ai~~l~ 321 (688)
++||+++|+++|++.++|++|++|++|.+++++|+|+++++++.||+||+|+|+.+|+...|.|.|+||+.+.++|++++
T Consensus 376 v~GG~~~LieaLa~~L~I~Ln~~Vt~I~~~~dgV~V~~~~~~~~AD~VIvTVPlgVLk~~~I~F~PpLP~~K~~AI~rL~ 455 (881)
T PLN03000 376 LPGGNGRLVQALAENVPILYEKTVQTIRYGSNGVKVIAGNQVYEGDMVLCTVPLGVLKNGSIKFVPELPQRKLDCIKRLG 455 (881)
T ss_pred eCCCHHHHHHHHHhhCCcccCCcEEEEEECCCeEEEEECCcEEEeceEEEcCCHHHHhhCceeeCCCCCHHHHHHHHcCC
Confidence 99999999999999999999999999999999999988667899999999999999997779999999999999999999
Q ss_pred CcceeEEEEEcCCcccccCCCCceeeecCCCCCCceEEEeeccccCCCcEEEEEecchhhHhhcCCChHHHHHHHHHHHH
Q 005607 322 YGLLNKVAMLFPYVFWETDLDTFGHLTDDSSSRGEFFLFYSYATVAGGPLLIALVAGEAAHKFESMPPTDAVTKVLQILK 401 (688)
Q Consensus 322 ~~~~~kV~l~f~~~~w~~~~~~~g~l~~~~~~~~~~~~~~~~~~p~g~~vl~~~~~g~~a~~~~~ls~eel~~~vl~~L~ 401 (688)
|+.+.||++.|+++||+.+...||.+.+++..++.+++++++..+.+.++|++|++|+.+..++.++++++++.++++|+
T Consensus 456 ~G~l~KViL~Fd~~FW~~d~~~FG~l~~~~~~rg~~~~f~s~sp~~G~pVLvafv~Gd~A~~le~lSdeE~ve~vl~~Lr 535 (881)
T PLN03000 456 FGLLNKVAMLFPYVFWSTDLDTFGHLTEDPNYRGEFFLFYSYAPVAGGPLLIALVAGEAAHKFETMPPTDAVTRVLHILR 535 (881)
T ss_pred CcceEEEEEEeCCccccCCCCceeEEecCCCCCceeEEEeCCCCCCCCcEEEEEecCchhHHhhcCCHHHHHHHHHHHHH
Confidence 99999999999999999888889999876655667777887776678889999999999999999999999999999999
Q ss_pred hhcCCCCCCCCCCceEEEecCCCCCCCCcccCCCCCCCCcccHHHHhcccCCCcEEEeecccccccCccchHHHHHHHHH
Q 005607 402 GIYEPKGINVPEPIQTVCTRWGGDPFSLGSYSNVAVGASGDDYDIMAESVGDGRLFFAGEATIRRYPATMHGAFLSGLRE 481 (688)
Q Consensus 402 ~i~~~~~~~i~~p~~~~~~rW~~~p~~~Gay~~~~pG~~~~~~~~l~~pi~~~~L~fAGd~ts~~~~g~~eGAi~SG~~A 481 (688)
++|++.+..+++|+.+.+++|..|||+.|+|+++.||+....++.+++|+.+++||||||+|+..|+||||||+.||+||
T Consensus 536 kifg~~~~~vp~Pv~~ivtrW~~DPysrGSYS~~~pG~~~~~~d~LaePv~~GRIfFAGEaTs~~~~GTVhGAieSGlRA 615 (881)
T PLN03000 536 GIYEPQGINVPDPLQTVCTRWGGDPFSLGSYSNVAVGASGDDYDILAESVGDGRLFFAGEATTRRYPATMHGAFVTGLRE 615 (881)
T ss_pred HHhCccccccCCceEEEEccCCCCCCCCccccCCCCCCchHHHHHHhCcCCCCcEEEeehHHhCCCCeeHHHHHHHHHHH
Confidence 99986545678999999999999999999999999999888899999998668999999999988999999999999999
Q ss_pred HHHHHHHHhhhhhcccccccCCCCCCccccchhhhccCCCCCCCcCceEEeccCCCCCCCCccEEEEEEcCCCCCCCC--
Q 005607 482 TAKMAHCANARALRMKVKVGKIPSKNAYSCASALTDLFREPDLEFGSFSVIFSWKNPDPKSPSILRVTFNDPRKKNHG-- 559 (688)
Q Consensus 482 A~~Il~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-- 559 (688)
|++|+..++.+..++ +++..++++.+.++..|.|||++||+|||+|||||+|.++||+|++||||+|+++++++.+
T Consensus 616 A~eIl~~l~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 693 (881)
T PLN03000 616 AANMAQSAKARGIRK--RIDRNPSKNAHSCAILLADLFRDPDLEFGSFAIIFSRRNPDPKSPAILRVTLSEPRKRNEDPK 693 (881)
T ss_pred HHHHHHHhhhccCCc--ccccCccccccchhHHHHHHhhCcCccccceEEEecCCCCCCCCceeEEEEeccccccccccc
Confidence 999999999998886 8899999999999999999999999999999999999999999999999999999998653
Q ss_pred CCCCchhHHHHhhhhccccCceEEEEEeccHHHHHHHHhhhCCchhHHHHHHHhcCceeeecCCCCCChhHHHHHHHHHh
Q 005607 560 DQPHSNKRLFEQLQSHFNQQQQLHVYTLLTRQQVLDLREVRGGDEMRLNFLCEKLGVKLIGRKGLGSTADSVISSIKAER 639 (688)
Q Consensus 560 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 639 (688)
.|.||||.+|||+|+||++|++|||||+||||||.||+++++|||+||+|||++|||||||||+|+++|++|||+||++|
T Consensus 694 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 773 (881)
T PLN03000 694 ADQHSNKILFQQLQSHFNQQQQIQVYTLLTRQQALDLREVRGGDEKRLNYLCETLGVKLVGRKGLGPGADSVIASIKAER 773 (881)
T ss_pred hhhhhhhhhhccccccccCcceEEEEEEeeHHHHHHHHHhhCCcHHHHHHHHHhcCeeEeecccCCccHHHHHHHHHHHH
Confidence 88999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred -ccccccccccchhhhHHHhhh----------Hhhhhhhhhhhcccc
Q 005607 640 -GIRKQTSTFSASKLVYKLLMK----------LCGILKRYFKAKNRN 675 (688)
Q Consensus 640 -~~~~~~~~~~~~~~~~~~~~~----------~~~~~~~~~~~~~~~ 675 (688)
..|++.+.+.++|+||+.+.. .-|+|+|--..+|-|
T Consensus 774 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 820 (881)
T PLN03000 774 TGNKLPSSSTSGTKSGMKPKAAGSKRKKVVSNVGGLMPRNSNMRNGN 820 (881)
T ss_pred hcCCCCCccccccccCCCccccchhHHHHHHhccCcccCCccccCCC
Confidence 566788899999999965542 235666654444443
|
|
| >PLN02328 lysine-specific histone demethylase 1 homolog | Back alignment and domain information |
|---|
| >PLN02529 lysine-specific histone demethylase 1 | Back alignment and domain information |
|---|
| >KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PLN02976 amine oxidase | Back alignment and domain information |
|---|
| >PLN02268 probable polyamine oxidase | Back alignment and domain information |
|---|
| >PLN02568 polyamine oxidase | Back alignment and domain information |
|---|
| >PLN02676 polyamine oxidase | Back alignment and domain information |
|---|
| >KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >COG1231 Monoamine oxidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00562 proto_IX_ox protoporphyrinogen oxidase | Back alignment and domain information |
|---|
| >PRK12416 protoporphyrinogen oxidase; Provisional | Back alignment and domain information |
|---|
| >PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) | Back alignment and domain information |
|---|
| >PLN02576 protoporphyrinogen oxidase | Back alignment and domain information |
|---|
| >PRK11883 protoporphyrinogen oxidase; Reviewed | Back alignment and domain information |
|---|
| >PRK07233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02731 phytoene_desat phytoene desaturase | Back alignment and domain information |
|---|
| >PLN02612 phytoene desaturase | Back alignment and domain information |
|---|
| >COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK07208 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02487 zeta-carotene desaturase | Back alignment and domain information |
|---|
| >TIGR02732 zeta_caro_desat carotene 7,8-desaturase | Back alignment and domain information |
|---|
| >TIGR03467 HpnE squalene-associated FAD-dependent desaturase | Back alignment and domain information |
|---|
| >TIGR02733 desat_CrtD C-3',4' desaturase CrtD | Back alignment and domain information |
|---|
| >TIGR02734 crtI_fam phytoene desaturase | Back alignment and domain information |
|---|
| >COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02730 carot_isom carotene isomerase | Back alignment and domain information |
|---|
| >KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >COG3349 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG2907 Predicted NAD/FAD-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase | Back alignment and domain information |
|---|
| >PTZ00363 rab-GDP dissociation inhibitor; Provisional | Back alignment and domain information |
|---|
| >PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G | Back alignment and domain information |
|---|
| >PRK13977 myosin-cross-reactive antigen; Provisional | Back alignment and domain information |
|---|
| >COG2081 Predicted flavoproteins [General function prediction only] | Back alignment and domain information |
|---|
| >COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK10157 putative oxidoreductase FixC; Provisional | Back alignment and domain information |
|---|
| >PRK10015 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases | Back alignment and domain information |
|---|
| >PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated | Back alignment and domain information |
|---|
| >TIGR02032 GG-red-SF geranylgeranyl reductase family | Back alignment and domain information |
|---|
| >COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family | Back alignment and domain information |
|---|
| >PRK12409 D-amino acid dehydrogenase small subunit; Provisional | Back alignment and domain information |
|---|
| >COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK11259 solA N-methyltryptophan oxidase; Provisional | Back alignment and domain information |
|---|
| >PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 | Back alignment and domain information |
|---|
| >PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK09126 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase | Back alignment and domain information |
|---|
| >TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase | Back alignment and domain information |
|---|
| >PRK08013 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK11728 hydroxyglutarate oxidase; Provisional | Back alignment and domain information |
|---|
| >COG0579 Predicted dehydrogenase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional | Back alignment and domain information |
|---|
| >TIGR01377 soxA_mon sarcosine oxidase, monomeric form | Back alignment and domain information |
|---|
| >COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional | Back alignment and domain information |
|---|
| >PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK06184 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07190 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06834 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08132 FAD-dependent oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK05868 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK08244 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02172 flavin-containing monooxygenase FMO GS-OX | Back alignment and domain information |
|---|
| >PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A | Back alignment and domain information |
|---|
| >PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated | Back alignment and domain information |
|---|
| >PRK07045 putative monooxygenase; Reviewed | Back alignment and domain information |
|---|
| >PRK00711 D-amino acid dehydrogenase small subunit; Validated | Back alignment and domain information |
|---|
| >PRK06185 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins | Back alignment and domain information |
|---|
| >PRK11445 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PTZ00383 malate:quinone oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02023 BchP-ChlP geranylgeranyl reductase | Back alignment and domain information |
|---|
| >PRK07236 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06126 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K | Back alignment and domain information |
|---|
| >PLN02463 lycopene beta cyclase | Back alignment and domain information |
|---|
| >PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK06481 fumarate reductase flavoprotein subunit; Validated | Back alignment and domain information |
|---|
| >PRK07588 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06847 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08274 tricarballylate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated | Back alignment and domain information |
|---|
| >TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 | Back alignment and domain information |
|---|
| >PRK05257 malate:quinone oxidoreductase; Validated | Back alignment and domain information |
|---|
| >PRK06996 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK13339 malate:quinone oxidoreductase; Reviewed | Back alignment and domain information |
|---|
| >PRK06753 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 | Back alignment and domain information |
|---|
| >PRK07538 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase | Back alignment and domain information |
|---|
| >TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase | Back alignment and domain information |
|---|
| >TIGR00275 flavoprotein, HI0933 family | Back alignment and domain information |
|---|
| >TIGR01813 flavo_cyto_c flavocytochrome c | Back alignment and domain information |
|---|
| >PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form | Back alignment and domain information |
|---|
| >PF00890 FAD_binding_2: FAD binding domain of the Pfam family | Back alignment and domain information |
|---|
| >PRK07121 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK08294 phenol 2-monooxygenase; Provisional | Back alignment and domain information |
|---|
| >PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PLN02697 lycopene epsilon cyclase | Back alignment and domain information |
|---|
| >PRK08163 salicylate hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional | Back alignment and domain information |
|---|
| >TIGR01292 TRX_reduct thioredoxin-disulfide reductase | Back alignment and domain information |
|---|
| >PRK09897 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03219 salicylate_mono salicylate 1-monooxygenase | Back alignment and domain information |
|---|
| >PRK12842 putative succinate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK12834 putative FAD-binding dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06475 salicylate hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK06134 putative FAD-binding dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00136 gidA glucose-inhibited division protein A | Back alignment and domain information |
|---|
| >PRK15317 alkyl hydroperoxide reductase subunit F; Provisional | Back alignment and domain information |
|---|
| >PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PF13454 NAD_binding_9: FAD-NAD(P)-binding | Back alignment and domain information |
|---|
| >TIGR00292 thiazole biosynthesis enzyme | Back alignment and domain information |
|---|
| >PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function | Back alignment and domain information |
|---|
| >PRK04176 ribulose-1,5-biphosphate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK12839 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06175 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit | Back alignment and domain information |
|---|
| >TIGR00551 nadB L-aspartate oxidase | Back alignment and domain information |
|---|
| >PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] | Back alignment and domain information |
|---|
| >PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK12843 putative FAD-binding dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR02485 CobZ_N-term precorrin 3B synthase CobZ | Back alignment and domain information |
|---|
| >PLN02661 Putative thiazole synthesis | Back alignment and domain information |
|---|
| >PRK07395 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02852 ferredoxin-NADP+ reductase | Back alignment and domain information |
|---|
| >COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit | Back alignment and domain information |
|---|
| >PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK08071 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK06854 adenylylsulfate reductase subunit alpha; Validated | Back alignment and domain information |
|---|
| >PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12831 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways | Back alignment and domain information |
|---|
| >PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase | Back alignment and domain information |
|---|
| >PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] | Back alignment and domain information |
|---|
| >PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant | Back alignment and domain information |
|---|
| >PRK06115 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A | Back alignment and domain information |
|---|
| >PRK09853 putative selenate reductase subunit YgfK; Provisional | Back alignment and domain information |
|---|
| >PLN00093 geranylgeranyl diphosphate reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial | Back alignment and domain information |
|---|
| >TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit | Back alignment and domain information |
|---|
| >PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK13369 glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit | Back alignment and domain information |
|---|
| >PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01316 gltA glutamate synthase (NADPH), homotetrameric | Back alignment and domain information |
|---|
| >PRK06116 glutathione reductase; Validated | Back alignment and domain information |
|---|
| >PRK06467 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PRK05976 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06416 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PLN02985 squalene monooxygenase | Back alignment and domain information |
|---|
| >TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase | Back alignment and domain information |
|---|
| >KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01790 carotene-cycl lycopene cyclase family protein | Back alignment and domain information |
|---|
| >PRK07512 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PTZ00188 adrenodoxin reductase; Provisional | Back alignment and domain information |
|---|
| >PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle | Back alignment and domain information |
|---|
| >PRK06370 mercuric reductase; Validated | Back alignment and domain information |
|---|
| >PRK06292 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >TIGR02028 ChlP geranylgeranyl reductase | Back alignment and domain information |
|---|
| >PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07818 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK10262 thioredoxin reductase; Provisional | Back alignment and domain information |
|---|
| >PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional | Back alignment and domain information |
|---|
| >PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12810 gltD glutamate synthase subunit beta; Reviewed | Back alignment and domain information |
|---|
| >TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form | Back alignment and domain information |
|---|
| >KOG2404 consensus Fumarate reductase, flavoprotein subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK14694 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >PRK14727 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR02053 MerA mercuric reductase | Back alignment and domain information |
|---|
| >PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated | Back alignment and domain information |
|---|
| >PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >PLN02464 glycerol-3-phosphate dehydrogenase | Back alignment and domain information |
|---|
| >PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated | Back alignment and domain information |
|---|
| >TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial | Back alignment and domain information |
|---|
| >PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed | Back alignment and domain information |
|---|
| >PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK13748 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01789 lycopene_cycl lycopene cyclase | Back alignment and domain information |
|---|
| >COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK06327 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02815 L-aspartate oxidase | Back alignment and domain information |
|---|
| >PTZ00058 glutathione reductase; Provisional | Back alignment and domain information |
|---|
| >KOG2844 consensus Dimethylglycine dehydrogenase precursor [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PTZ00052 thioredoxin reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit | Back alignment and domain information |
|---|
| >PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >COG3573 Predicted oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00367 squalene epoxidase; Provisional | Back alignment and domain information |
|---|
| >PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >KOG2415 consensus Electron transfer flavoprotein ubiquinone oxidoreductase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan | Back alignment and domain information |
|---|
| >PRK07804 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase | Back alignment and domain information |
|---|
| >PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional | Back alignment and domain information |
|---|
| >PLN02507 glutathione reductase | Back alignment and domain information |
|---|
| >TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup | Back alignment and domain information |
|---|
| >PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit | Back alignment and domain information |
|---|
| >PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] | Back alignment and domain information |
|---|
| >KOG2960 consensus Protein involved in thiamine biosynthesis and DNA damage tolerance [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12770 putative glutamate synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PRK08401 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] | Back alignment and domain information |
|---|
| >COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria | Back alignment and domain information |
|---|
| >PLN02546 glutathione reductase | Back alignment and domain information |
|---|
| >PRK08626 fumarate reductase flavoprotein subunit; Provisional | Back alignment and domain information |
|---|
| >PTZ00306 NADH-dependent fumarate reductase; Provisional | Back alignment and domain information |
|---|
| >PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] | Back alignment and domain information |
|---|
| >TIGR01423 trypano_reduc trypanothione-disulfide reductase | Back alignment and domain information |
|---|
| >PRK13984 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR02462 pyranose_ox pyranose oxidase | Back alignment and domain information |
|---|
| >COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00153 lipoamide dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09231 fumarate reductase flavoprotein subunit; Validated | Back alignment and domain information |
|---|
| >PRK08275 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK09077 L-aspartate oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK06912 acoL dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed | Back alignment and domain information |
|---|
| >PRK07845 flavoprotein disulfide reductase; Reviewed | Back alignment and domain information |
|---|
| >KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK02106 choline dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein | Back alignment and domain information |
|---|
| >PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated | Back alignment and domain information |
|---|
| >COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup | Back alignment and domain information |
|---|
| >TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit | Back alignment and domain information |
|---|
| >PF07156 Prenylcys_lyase: Prenylcysteine lyase; InterPro: IPR010795 This entry represents a conserved region found in a group of prenylcysteine lyases (1 | Back alignment and domain information |
|---|
| >COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG1800 consensus Ferredoxin/adrenodoxin reductase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1439 consensus RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2665 consensus Predicted FAD-dependent oxidoreductase [Function unknown] | Back alignment and domain information |
|---|
| >COG5044 MRS6 RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >KOG2853 consensus Possible oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase | Back alignment and domain information |
|---|
| >PRK13512 coenzyme A disulfide reductase; Provisional | Back alignment and domain information |
|---|
| >KOG2852 consensus Possible oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01810 betA choline dehydrogenase | Back alignment and domain information |
|---|
| >PRK09564 coenzyme A disulfide reductase; Reviewed | Back alignment and domain information |
|---|
| >COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit | Back alignment and domain information |
|---|
| >PLN02785 Protein HOTHEAD | Back alignment and domain information |
|---|
| >PRK07846 mycothione reductase; Reviewed | Back alignment and domain information |
|---|
| >COG4716 Myosin-crossreactive antigen [Function unknown] | Back alignment and domain information |
|---|
| >TIGR03452 mycothione_red mycothione reductase | Back alignment and domain information |
|---|
| >TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain | Back alignment and domain information |
|---|
| >PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional | Back alignment and domain information |
|---|
| >PRK06416 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PTZ00318 NADH dehydrogenase-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK07846 mycothione reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR03452 mycothione_red mycothione reductase | Back alignment and domain information |
|---|
| >COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
| >PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B | Back alignment and domain information |
|---|
| >COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK06116 glutathione reductase; Validated | Back alignment and domain information |
|---|
| >PLN02507 glutathione reductase | Back alignment and domain information |
|---|
| >COG4529 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >COG0029 NadB Aspartate oxidase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein | Back alignment and domain information |
|---|
| >TIGR02352 thiamin_ThiO glycine oxidase ThiO | Back alignment and domain information |
|---|
| >PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional | Back alignment and domain information |
|---|
| >KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >KOG0405 consensus Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate | Back alignment and domain information |
|---|
| >PRK14989 nitrite reductase subunit NirD; Provisional | Back alignment and domain information |
|---|
| >PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit | Back alignment and domain information |
|---|
| >PRK05976 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >KOG3855 consensus Monooxygenase involved in coenzyme Q (ubiquinone) biosynthesis [Coenzyme transport and metabolism; Energy production and conversion] | Back alignment and domain information |
|---|
| >PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 | Back alignment and domain information |
|---|
| >TIGR02053 MerA mercuric reductase | Back alignment and domain information |
|---|
| >PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] | Back alignment and domain information |
|---|
| >KOG1238 consensus Glucose dehydrogenase/choline dehydrogenase/mandelonitrile lyase (GMC oxidoreductase family) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06912 acoL dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >KOG3923 consensus D-aspartate oxidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06370 mercuric reductase; Validated | Back alignment and domain information |
|---|
| >TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial | Back alignment and domain information |
|---|
| >PRK06467 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK06115 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 | Back alignment and domain information |
|---|
| >PRK06292 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR03385 CoA_CoA_reduc CoA-disulfide reductase | Back alignment and domain information |
|---|
| >PRK13512 coenzyme A disulfide reductase; Provisional | Back alignment and domain information |
|---|
| >KOG3851 consensus Sulfide:quinone oxidoreductase/flavo-binding protein [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK07818 dihydrolipoamide dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 | Back alignment and domain information |
|---|
| >PRK06327 dihydrolipoamide dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A | Back alignment and domain information |
|---|
| >PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B | Back alignment and domain information |
|---|
| >COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09564 coenzyme A disulfide reductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit | Back alignment and domain information |
|---|
| >COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07845 flavoprotein disulfide reductase; Reviewed | Back alignment and domain information |
|---|
| >KOG2755 consensus Oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit | Back alignment and domain information |
|---|
| >cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain | Back alignment and domain information |
|---|
| >PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PTZ00058 glutathione reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06249 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >PTZ00153 lipoamide dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14989 nitrite reductase subunit NirD; Provisional | Back alignment and domain information |
|---|
| >KOG2311 consensus NAD/FAD-utilizing protein possibly involved in translation [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant | Back alignment and domain information |
|---|
| >PRK05708 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01316 gltA glutamate synthase (NADPH), homotetrameric | Back alignment and domain information |
|---|
| >PRK15317 alkyl hydroperoxide reductase subunit F; Provisional | Back alignment and domain information |
|---|
| >PRK10262 thioredoxin reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases | Back alignment and domain information |
|---|
| >PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK06522 2-dehydropantoate 2-reductase; Reviewed | Back alignment and domain information |
|---|
| >COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit | Back alignment and domain information |
|---|
| >COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK12921 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08229 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >PRK04148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK12831 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK12770 putative glutamate synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B | Back alignment and domain information |
|---|
| >PLN02546 glutathione reductase | Back alignment and domain information |
|---|
| >TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent | Back alignment and domain information |
|---|
| >cd05292 LDH_2 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >TIGR00518 alaDH alanine dehydrogenase | Back alignment and domain information |
|---|
| >COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01292 TRX_reduct thioredoxin-disulfide reductase | Back alignment and domain information |
|---|
| >PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06718 precorrin-2 dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01423 trypano_reduc trypanothione-disulfide reductase | Back alignment and domain information |
|---|
| >PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK06719 precorrin-2 dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 | Back alignment and domain information |
|---|
| >PRK13748 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK14694 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02545 3-hydroxybutyryl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14727 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >PTZ00052 thioredoxin reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase | Back alignment and domain information |
|---|
| >PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein | Back alignment and domain information |
|---|
| >PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PTZ00318 NADH dehydrogenase-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 | Back alignment and domain information |
|---|
| >PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional | Back alignment and domain information |
|---|
| >PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional | Back alignment and domain information |
|---|
| >TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family | Back alignment and domain information |
|---|
| >TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial | Back alignment and domain information |
|---|
| >PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK08306 dipicolinate synthase subunit A; Reviewed | Back alignment and domain information |
|---|
| >cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 | Back alignment and domain information |
|---|
| >PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >KOG4405 consensus GDP dissociation inhibitor [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC | Back alignment and domain information |
|---|
| >cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) | Back alignment and domain information |
|---|
| >PRK12549 shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK07417 arogenate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PTZ00082 L-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06223 malate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02353 probable UDP-glucose 6-dehydrogenase | Back alignment and domain information |
|---|
| >PRK15057 UDP-glucose 6-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated | Back alignment and domain information |
|---|
| >PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit | Back alignment and domain information |
|---|
| >PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus | Back alignment and domain information |
|---|
| >PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP | Back alignment and domain information |
|---|
| >PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] | Back alignment and domain information |
|---|
| >PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed | Back alignment and domain information |
|---|
| >cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >TIGR02437 FadB fatty oxidation complex, alpha subunit FadB | Back alignment and domain information |
|---|
| >TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit | Back alignment and domain information |
|---|
| >PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] | Back alignment and domain information |
|---|
| >TIGR01915 npdG NADPH-dependent F420 reductase | Back alignment and domain information |
|---|
| >PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated | Back alignment and domain information |
|---|
| >PRK15116 sulfur acceptor protein CsdL; Provisional | Back alignment and domain information |
|---|
| >TIGR00507 aroE shikimate 5-dehydrogenase | Back alignment and domain information |
|---|
| >KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >TIGR00936 ahcY adenosylhomocysteinase | Back alignment and domain information |
|---|
| >PRK03815 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial | Back alignment and domain information |
|---|
| >KOG2495 consensus NADH-dehydrogenase (ubiquinone) [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG2304 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase | Back alignment and domain information |
|---|
| >PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK12548 shikimate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02172 flavin-containing monooxygenase FMO GS-OX | Back alignment and domain information |
|---|
| >PTZ00117 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E | Back alignment and domain information |
|---|
| >PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways | Back alignment and domain information |
|---|
| >PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK08644 thiamine biosynthesis protein ThiF; Provisional | Back alignment and domain information |
|---|
| >TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ | Back alignment and domain information |
|---|
| >cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase | Back alignment and domain information |
|---|
| >cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins | Back alignment and domain information |
|---|
| >TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase | Back alignment and domain information |
|---|
| >cd01487 E1_ThiF_like E1_ThiF_like | Back alignment and domain information |
|---|
| >PF13478 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2WE7_A | Back alignment and domain information |
|---|
| >COG4529 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >PRK00066 ldh L-lactate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK09496 trkA potassium transporter peripheral membrane component; Reviewed | Back alignment and domain information |
|---|
| >PRK05562 precorrin-2 dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd05293 LDH_1 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >TIGR01087 murD UDP-N-acetylmuramoylalanine--D-glutamate ligase | Back alignment and domain information |
|---|
| >PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 | Back alignment and domain information |
|---|
| >PRK12810 gltD glutamate synthase subunit beta; Reviewed | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 688 | ||||
| 4gur_A | 776 | Crystal Structure Of Lsd2-npac With H3 In Space Gro | 5e-68 | ||
| 4gu1_A | 784 | Crystal Structure Of Lsd2 Length = 784 | 5e-68 | ||
| 4fwe_A | 796 | Native Structure Of Lsd2 /aof1/kdm1b In Spacegroup | 5e-68 | ||
| 2x0l_A | 734 | Crystal Structure Of A Neuro-Specific Splicing Vari | 6e-65 | ||
| 2v1d_A | 730 | Structural Basis Of Lsd1-Corest Selectivity In Hist | 6e-65 | ||
| 2h94_A | 664 | Crystal Structure And Mechanism Of Human Lysine-Spe | 8e-65 | ||
| 2ejr_A | 662 | Lsd1-Tranylcypromine Complex Length = 662 | 8e-65 | ||
| 2iw5_A | 666 | Structural Basis For Corest-dependent Demethylation | 8e-65 | ||
| 2dw4_A | 660 | Crystal Structure Of Human Lsd1 At 2.3 A Resolution | 8e-65 | ||
| 2xaf_A | 852 | Crystal Structure Of Lsd1-Corest In Complex With Pa | 1e-64 | ||
| 2hko_A | 664 | Crystal Structure Of Lsd1 Length = 664 | 2e-64 | ||
| 1b37_A | 472 | A 30 Angstrom U-Shaped Catalytic Tunnel In The Crys | 2e-24 | ||
| 3kpf_A | 478 | X-Ray Structure Of The Mutant Lys300met Of Polyamin | 1e-23 | ||
| 2xfo_A | 520 | Tranylcypromine-Inhibited Human Monoamine Oxidase B | 5e-10 | ||
| 2xfu_A | 519 | Human Monoamine Oxidase B With Tranylcypromine Leng | 6e-10 | ||
| 2c72_A | 520 | Functional Role Of The Aromatic Cage In Human Monoa | 6e-10 | ||
| 2c75_A | 520 | Functional Role Of The Aromatic Cage In Human Monoa | 6e-10 | ||
| 2bk4_A | 520 | Human Monoamine Oxidase B: I199f Mutant In Complex | 7e-10 | ||
| 1gos_A | 520 | Human Monoamine Oxidase B Length = 520 | 7e-10 | ||
| 2c76_A | 520 | Functional Role Of The Aromatic Cage In Human Monoa | 7e-10 | ||
| 2c73_A | 520 | Functional Role Of The Aromatic Cage In Human Monoa | 8e-10 | ||
| 3zyx_A | 519 | Crystal Structure Of Human Monoamine Oxidase B In C | 1e-09 | ||
| 3kve_A | 486 | Structure Of Native L-Amino Acid Oxidase From Viper | 3e-09 | ||
| 4ech_A | 516 | Yeast Polyamine Oxidase Fms1, H67q Mutant Length = | 3e-09 | ||
| 1yy5_A | 513 | Crystal Structure Of Fms1, A Polyamine Oxidase From | 3e-09 | ||
| 1z6l_A | 516 | Crystal Structure Of Fms1 In Complex With Its Subst | 3e-09 | ||
| 4gdp_A | 516 | Yeast Polyamine Oxidase Fms1, N195a Mutant Length = | 8e-09 | ||
| 4e0v_A | 497 | Structure Of L-Amino Acid Oxidase From The B. Jarar | 1e-08 | ||
| 1rsg_A | 516 | Crystal Structure Of The Polyamine Oxidase Fms1 Fro | 2e-08 | ||
| 1reo_A | 486 | L-Amino Acid Oxidase From Agkistrodon Halys Pallas | 6e-08 | ||
| 1f8r_A | 498 | Crystal Structure Of L-Amino Acid Oxidase From Call | 5e-07 | ||
| 2yg3_A | 453 | Structure-Based Redesign Of Cofactor Binding In Put | 2e-05 | ||
| 2yg7_A | 453 | Structure-Based Redesign Of Cofactor Binding In Put | 3e-05 | ||
| 2yg5_A | 453 | Structure-Based Redesign Of Cofactor Binding In Put | 3e-05 | ||
| 2yg6_A | 453 | Structure-Based Redesign Of Cofactor Binding In Put | 3e-05 | ||
| 2bxr_A | 527 | Human Monoamine Oxidase A In Complex With Clorgylin | 2e-04 | ||
| 2z5x_A | 513 | Crystal Structure Of Human Monoamine Oxidase A With | 2e-04 | ||
| 2z5y_A | 513 | Crystal Structure Of Human Monoamine Oxidase A (G11 | 2e-04 | ||
| 1o5w_A | 534 | The Structure Basis Of Specific Recognitions For Su | 7e-04 |
| >pdb|4GUR|A Chain A, Crystal Structure Of Lsd2-npac With H3 In Space Group P21 Length = 776 | Back alignment and structure |
|
| >pdb|4GU1|A Chain A, Crystal Structure Of Lsd2 Length = 784 | Back alignment and structure |
| >pdb|4FWE|A Chain A, Native Structure Of Lsd2 /aof1/kdm1b In Spacegroup Of C2221 At 2.13a Length = 796 | Back alignment and structure |
| >pdb|2X0L|A Chain A, Crystal Structure Of A Neuro-Specific Splicing Variant Of Human Histone Lysine Demethylase Lsd1 Length = 734 | Back alignment and structure |
| >pdb|2V1D|A Chain A, Structural Basis Of Lsd1-Corest Selectivity In Histone H3 Recognition Length = 730 | Back alignment and structure |
| >pdb|2H94|A Chain A, Crystal Structure And Mechanism Of Human Lysine-Specific Demethylase-1 Length = 664 | Back alignment and structure |
| >pdb|2EJR|A Chain A, Lsd1-Tranylcypromine Complex Length = 662 | Back alignment and structure |
| >pdb|2IW5|A Chain A, Structural Basis For Corest-dependent Demethylation Of Nucleosomes By The Human Lsd1 Histone Demethylase Length = 666 | Back alignment and structure |
| >pdb|2DW4|A Chain A, Crystal Structure Of Human Lsd1 At 2.3 A Resolution Length = 660 | Back alignment and structure |
| >pdb|2XAF|A Chain A, Crystal Structure Of Lsd1-Corest In Complex With Para-Bromo- (+)-Cis-2-Phenylcyclopropyl-1-Amine Length = 852 | Back alignment and structure |
| >pdb|2HKO|A Chain A, Crystal Structure Of Lsd1 Length = 664 | Back alignment and structure |
| >pdb|1B37|A Chain A, A 30 Angstrom U-Shaped Catalytic Tunnel In The Crystal Structure Of Polyamine Oxidase Length = 472 | Back alignment and structure |
| >pdb|3KPF|A Chain A, X-Ray Structure Of The Mutant Lys300met Of Polyamine Oxidase From Zea Mays Length = 478 | Back alignment and structure |
| >pdb|2XFO|A Chain A, Tranylcypromine-Inhibited Human Monoamine Oxidase B Ile199ala Mutant In Complex With 2-(2-Benzofuranyl)-2- Imidazoline Length = 520 | Back alignment and structure |
| >pdb|2XFU|A Chain A, Human Monoamine Oxidase B With Tranylcypromine Length = 519 | Back alignment and structure |
| >pdb|2C72|A Chain A, Functional Role Of The Aromatic Cage In Human Monoamine Oxidase B: Structures And Catalytic Properties Of Tyr435 Mutant Proteins Length = 520 | Back alignment and structure |
| >pdb|2C75|A Chain A, Functional Role Of The Aromatic Cage In Human Monoamine Oxidase B: Structures And Catalytic Properties Of Tyr435 Mutant Proteins Length = 520 | Back alignment and structure |
| >pdb|2BK4|A Chain A, Human Monoamine Oxidase B: I199f Mutant In Complex With Rasagiline Length = 520 | Back alignment and structure |
| >pdb|1GOS|A Chain A, Human Monoamine Oxidase B Length = 520 | Back alignment and structure |
| >pdb|2C76|A Chain A, Functional Role Of The Aromatic Cage In Human Monoamine Oxidase B: Structures And Catalytic Properties Of Tyr435 Mutant Proteins Length = 520 | Back alignment and structure |
| >pdb|2C73|A Chain A, Functional Role Of The Aromatic Cage In Human Monoamine Oxidase B: Structures And Catalytic Properties Of Tyr435 Mutant Proteins Length = 520 | Back alignment and structure |
| >pdb|3ZYX|A Chain A, Crystal Structure Of Human Monoamine Oxidase B In Complex With Methylene Blue And Bearing The Double Mutation I199a- Y326a Length = 519 | Back alignment and structure |
| >pdb|3KVE|A Chain A, Structure Of Native L-Amino Acid Oxidase From Vipera Ammodytes Ammodytes: Stabilization Of The Quaternary Structure By Divalent Ions And Structural Changes In The Dynamic Active Site Length = 486 | Back alignment and structure |
| >pdb|4ECH|A Chain A, Yeast Polyamine Oxidase Fms1, H67q Mutant Length = 516 | Back alignment and structure |
| >pdb|1YY5|A Chain A, Crystal Structure Of Fms1, A Polyamine Oxidase From Yeast Length = 513 | Back alignment and structure |
| >pdb|1Z6L|A Chain A, Crystal Structure Of Fms1 In Complex With Its Substrate Length = 516 | Back alignment and structure |
| >pdb|4GDP|A Chain A, Yeast Polyamine Oxidase Fms1, N195a Mutant Length = 516 | Back alignment and structure |
| >pdb|4E0V|A Chain A, Structure Of L-Amino Acid Oxidase From The B. Jararacussu Venom Length = 497 | Back alignment and structure |
| >pdb|1RSG|A Chain A, Crystal Structure Of The Polyamine Oxidase Fms1 From Yeast Length = 516 | Back alignment and structure |
| >pdb|1REO|A Chain A, L-Amino Acid Oxidase From Agkistrodon Halys Pallas Length = 486 | Back alignment and structure |
| >pdb|1F8R|A Chain A, Crystal Structure Of L-Amino Acid Oxidase From Calloselasma Rhodostoma Complexed With Citrate Length = 498 | Back alignment and structure |
| >pdb|2YG3|A Chain A, Structure-Based Redesign Of Cofactor Binding In Putrescine Oxidase: Wild Type Enzyme Length = 453 | Back alignment and structure |
| >pdb|2YG7|A Chain A, Structure-Based Redesign Of Cofactor Binding In Putrescine Oxidase: A394c-A396t-Q431g Triple Mutant Length = 453 | Back alignment and structure |
| >pdb|2YG5|A Chain A, Structure-Based Redesign Of Cofactor Binding In Putrescine Oxidase: A394c Mutant Length = 453 | Back alignment and structure |
| >pdb|2YG6|A Chain A, Structure-Based Redesign Of Cofactor Binding In Putrescine Oxidase: P15i-A394c Double Mutant Length = 453 | Back alignment and structure |
| >pdb|2BXR|A Chain A, Human Monoamine Oxidase A In Complex With Clorgyline, Crystal Form A Length = 527 | Back alignment and structure |
| >pdb|2Z5X|A Chain A, Crystal Structure Of Human Monoamine Oxidase A With Harmine Length = 513 | Back alignment and structure |
| >pdb|2Z5Y|A Chain A, Crystal Structure Of Human Monoamine Oxidase A (G110a) With Harmine Length = 513 | Back alignment and structure |
| >pdb|1O5W|A Chain A, The Structure Basis Of Specific Recognitions For Substrates And Inhibitors Of Rat Monoamine Oxidase A Length = 534 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Length = 472 | Back alignment and structure |
|---|
Score = 405 bits (1041), Expect = e-135
Identities = 112/482 (23%), Positives = 202/482 (41%), Gaps = 40/482 (8%)
Query: 44 SSNKLRVLVIGAGLAGLAAARQLMRLGFR-VTVLEGRKRAGGRVYTKKMEGGAGNRISAS 102
++ RV+V+GAG++G++AA++L G + +LE GGR++ G +
Sbjct: 1 ATVGPRVIVVGAGMSGISAAKRLSEAGITDLLILEATDHIGGRMHKTNFAGI-------N 53
Query: 103 ADLGGSVLTGTLG---NPLGILAKQLGSLLHKVRD----KCPLYRLDGNSVDPEIDMKVE 155
+LG + + G G NP+ + L + D +Y+ DG D + K
Sbjct: 54 VELGANWVEGVNGGKMNPIWPIVNSTLKLRNFRSDFDYLAQNVYKEDGGVYDEDYVQKRI 113
Query: 156 ADFNRLLDKASRLRQLMGEVAMDVSLGSALETFWRVYWDSGNAEAMNLFNWHLANLEYAN 215
+ + + +L + D A++ + + +++ + E+A
Sbjct: 114 ELADSVEEMGEKLSATLHASGRDDMSILAMQRLNEHQPNGPATPVDMVVDYYKFDYEFAE 173
Query: 216 ASLLSKLSLAFWDQDDPYDMGGDHCFL---PGGNGRLVQALVENVP-------------I 259
++ SL + GD + G +V L +
Sbjct: 174 PPRVT--SLQNTVPLATFSDFGDDVYFVADQRGYEAVVYYLAGQYLKTDDKSGKIVDPRL 231
Query: 260 LYEKTVHTIRYGSDGVQV-LAGSQVFEGDMVLCTVPLGVLKSGSIKFIPELPQRKLDAIK 318
K V I+Y GV V + V+ D V+ + LGVL+S I+F P+LP K+ AI
Sbjct: 232 QLNKVVREIKYSPGGVTVKTEDNSVYSADYVMVSASLGVLQSDLIQFKPKLPTWKVRAIY 291
Query: 319 RLGYGLLNKVAMLFPYVFWETDLDTFGHLTDDSSSRGEFFLFYSYATVAGG-PLLIALVA 377
+ + K+ + FP FW L SS RG + ++ + +L+ V
Sbjct: 292 QFDMAVYTKIFLKFPRKFWPEGKGREFFL-YASSRRGYYGVWQEFEKQYPDANVLLVTVT 350
Query: 378 GEAAHKFESMPPTDAVTKVLQILKGIYEPKGINVPEPIQTVCTRWGGDPFSLGSYSNVAV 437
E + + E +++Q+L+ ++ G +VP+ + RW D F G++SN V
Sbjct: 351 DEESRRIEQQSDEQTKAEIMQVLRKMF--PGKDVPDATDILVPRWWSDRFYKGTFSNWPV 408
Query: 438 GASGDDYDIMAESVGDGRLFFAGEATIRRYPATMHGAFLSGLRETAKMAHCANARALRMK 497
G + +YD + V GR++F GE T Y +HGA+LSG+ + +CA + +
Sbjct: 409 GVNRYEYDQLRAPV--GRVYFTGEHTSEHYNGYVHGAYLSGIDSAEILINCAQKKMCKYH 466
Query: 498 VK 499
V+
Sbjct: 467 VQ 468
|
| >1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Length = 520 | Back alignment and structure |
|---|
| >3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Length = 431 | Back alignment and structure |
|---|
| >1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Length = 516 | Back alignment and structure |
|---|
| >2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Length = 453 | Back alignment and structure |
|---|
| >2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Length = 852 | Back alignment and structure |
|---|
| >2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Length = 852 | Back alignment and structure |
|---|
| >2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Length = 498 | Back alignment and structure |
|---|
| >2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Length = 662 | Back alignment and structure |
|---|
| >2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Length = 662 | Back alignment and structure |
|---|
| >2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Length = 489 | Back alignment and structure |
|---|
| >2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Length = 495 | Back alignment and structure |
|---|
| >2e1m_C L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Length = 181 | Back alignment and structure |
|---|
| >2e1m_B L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Length = 130 | Back alignment and structure |
|---|
| >2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Length = 424 | Back alignment and structure |
|---|
| >2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Length = 478 | Back alignment and structure |
|---|
| >3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Length = 470 | Back alignment and structure |
|---|
| >3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Length = 421 | Back alignment and structure |
|---|
| >1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Length = 504 | Back alignment and structure |
|---|
| >3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Length = 475 | Back alignment and structure |
|---|
| >3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Length = 376 | Back alignment and structure |
|---|
| >4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Length = 484 | Back alignment and structure |
|---|
| >3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Length = 425 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Length = 397 | Back alignment and structure |
|---|
| >1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Length = 367 | Back alignment and structure |
|---|
| >3utf_A UDP-galactopyranose mutase; nucleotide binding, flavin adenine dinucleotide BIND isomerase; HET: FDA; 2.25A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Length = 513 | Back alignment and structure |
|---|
| >2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Length = 384 | Back alignment and structure |
|---|
| >1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Length = 399 | Back alignment and structure |
|---|
| >3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Length = 379 | Back alignment and structure |
|---|
| >1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Length = 729 | Back alignment and structure |
|---|
| >3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Length = 690 | Back alignment and structure |
|---|
| >2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Length = 397 | Back alignment and structure |
|---|
| >1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Length = 671 | Back alignment and structure |
|---|
| >3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Length = 342 | Back alignment and structure |
|---|
| >3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Length = 342 | Back alignment and structure |
|---|
| >3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Length = 407 | Back alignment and structure |
|---|
| >2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Length = 456 | Back alignment and structure |
|---|
| >3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Length = 430 | Back alignment and structure |
|---|
| >2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Length = 398 | Back alignment and structure |
|---|
| >4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Length = 357 | Back alignment and structure |
|---|
| >1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Length = 1025 | Back alignment and structure |
|---|
| >3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Length = 721 | Back alignment and structure |
|---|
| >3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Length = 721 | Back alignment and structure |
|---|
| >1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Length = 542 | Back alignment and structure |
|---|
| >1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Length = 363 | Back alignment and structure |
|---|
| >3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Length = 545 | Back alignment and structure |
|---|
| >2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Length = 447 | Back alignment and structure |
|---|
| >3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Length = 410 | Back alignment and structure |
|---|
| >1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Length = 572 | Back alignment and structure |
|---|
| >3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Length = 421 | Back alignment and structure |
|---|
| >3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Length = 512 | Back alignment and structure |
|---|
| >3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Length = 591 | Back alignment and structure |
|---|
| >1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Length = 382 | Back alignment and structure |
|---|
| >2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Length = 965 | Back alignment and structure |
|---|
| >4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Length = 549 | Back alignment and structure |
|---|
| >2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Length = 397 | Back alignment and structure |
|---|
| >2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Length = 399 | Back alignment and structure |
|---|
| >3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Length = 385 | Back alignment and structure |
|---|
| >2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Length = 372 | Back alignment and structure |
|---|
| >2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Length = 384 | Back alignment and structure |
|---|
| >1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Length = 566 | Back alignment and structure |
|---|
| >3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Length = 369 | Back alignment and structure |
|---|
| >3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Length = 451 | Back alignment and structure |
|---|
| >1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Length = 394 | Back alignment and structure |
|---|
| >1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Length = 571 | Back alignment and structure |
|---|
| >3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Length = 381 | Back alignment and structure |
|---|
| >1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 367 | Back alignment and structure |
|---|
| >3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Length = 453 | Back alignment and structure |
|---|
| >2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Length = 389 | Back alignment and structure |
|---|
| >3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Length = 540 | Back alignment and structure |
|---|
| >2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Length = 439 | Back alignment and structure |
|---|
| >2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Length = 464 | Back alignment and structure |
|---|
| >3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Length = 369 | Back alignment and structure |
|---|
| >4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Length = 304 | Back alignment and structure |
|---|
| >1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Length = 493 | Back alignment and structure |
|---|
| >3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Length = 549 | Back alignment and structure |
|---|
| >1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Length = 284 | Back alignment and structure |
|---|
| >3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Length = 417 | Back alignment and structure |
|---|
| >3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Length = 438 | Back alignment and structure |
|---|
| >2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Length = 401 | Back alignment and structure |
|---|
| >2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} SCOP: c.3.1.6 PDB: 3fpz_A* Length = 326 | Back alignment and structure |
|---|
| >4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Length = 510 | Back alignment and structure |
|---|
| >3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Length = 623 | Back alignment and structure |
|---|
| >1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Length = 493 | Back alignment and structure |
|---|
| >2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Length = 497 | Back alignment and structure |
|---|
| >3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Length = 344 | Back alignment and structure |
|---|
| >3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Length = 448 | Back alignment and structure |
|---|
| >1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Length = 433 | Back alignment and structure |
|---|
| >3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Length = 443 | Back alignment and structure |
|---|
| >1fcd_A Flavocytochrome C sulfide dehydrogenase (flavin- binding subunit); electron transport(flavocytochrome); HET: FAD HEM; 2.53A {Allochromatium vinosum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Length = 401 | Back alignment and structure |
|---|
| >3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Length = 351 | Back alignment and structure |
|---|
| >3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Length = 437 | Back alignment and structure |
|---|
| >2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Length = 499 | Back alignment and structure |
|---|
| >2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Length = 500 | Back alignment and structure |
|---|
| >2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Length = 300 | Back alignment and structure |
|---|
| >3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Length = 570 | Back alignment and structure |
|---|
| >1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Length = 460 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 688 | ||||
| d2dw4a2 | 449 | c.3.1.2 (A:274-654,A:764-831) Lysine-specific hist | 4e-57 | |
| d2v5za1 | 383 | c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {H | 1e-32 | |
| d1b5qa1 | 347 | c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai | 5e-30 | |
| d1b5qa1 | 347 | c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai | 3e-06 | |
| d2iida1 | 370 | c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {M | 5e-28 | |
| d2dw4a3 | 109 | d.16.1.5 (A:655-763) Lysine-specific histone demet | 1e-26 | |
| d2iida2 | 113 | d.16.1.5 (A:320-432) L-aminoacid oxidase {Malayan | 4e-25 | |
| d2v5za2 | 112 | d.16.1.5 (A:290-401) Monoamine oxidase B {Human (H | 1e-24 | |
| d1b5qa2 | 112 | d.16.1.5 (A:294-405) Polyamine oxidase {Maize (Zea | 1e-24 | |
| d2ivda1 | 347 | c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen ox | 2e-19 | |
| d1seza1 | 373 | c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen ox | 4e-17 | |
| d1i8ta1 | 298 | c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mu | 1e-12 | |
| d2bcgg1 | 297 | c.3.1.3 (G:5-301) Guanine nucleotide dissociation | 6e-12 | |
| d2bi7a1 | 314 | c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mu | 6e-12 | |
| d1d5ta1 | 336 | c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide di | 7e-11 | |
| d1w4xa1 | 298 | c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxy | 3e-09 | |
| d2gqfa1 | 253 | c.3.1.8 (A:1-194,A:343-401) Hypothetical protein H | 2e-08 | |
| d2i0za1 | 251 | c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {B | 3e-08 | |
| d1cjca2 | 230 | c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase | 5e-08 | |
| d2gf3a1 | 281 | c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bac | 6e-08 | |
| d1ryia1 | 276 | c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO { | 7e-08 | |
| d1dxla1 | 221 | c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehyd | 9e-08 | |
| d2voua1 | 265 | c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydr | 1e-07 | |
| d1v59a1 | 233 | c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehyd | 2e-07 | |
| d2gv8a1 | 335 | c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monox | 2e-07 | |
| d1k0ia1 | 292 | c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydr | 2e-07 | |
| d1lqta2 | 239 | c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reduct | 3e-07 | |
| d1c0pa1 | 268 | c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxida | 3e-07 | |
| d1ojta1 | 229 | c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide deh | 3e-07 | |
| d1y0pa2 | 308 | c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 ( | 3e-07 | |
| d1d4ca2 | 322 | c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 ( | 4e-07 | |
| d1qo8a2 | 317 | c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 ( | 6e-07 | |
| d3lada1 | 229 | c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehyd | 8e-07 | |
| d1gtea4 | 196 | c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine de | 1e-06 | |
| d1gesa1 | 217 | c.3.1.5 (A:3-146,A:263-335) Glutathione reductase | 1e-06 | |
| d3grsa1 | 221 | c.3.1.5 (A:18-165,A:291-363) Glutathione reductase | 1e-06 | |
| d2bs2a2 | 336 | c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wo | 2e-06 | |
| d1onfa1 | 259 | c.3.1.5 (A:1-153,A:271-376) Glutathione reductase | 3e-06 | |
| d1neka2 | 330 | c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase | 3e-06 | |
| d1ebda1 | 223 | c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehyd | 3e-06 | |
| d1lvla1 | 220 | c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehyd | 5e-06 | |
| d2gmha1 | 380 | c.3.1.2 (A:4-236,A:336-482) Electron transfer flav | 6e-06 | |
| d1mo9a1 | 261 | c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketop | 6e-06 | |
| d1pj5a2 | 305 | c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine ox | 6e-06 | |
| d1kifa1 | 246 | c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N | 6e-06 | |
| d1h6va1 | 235 | c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin | 6e-06 | |
| d1rp0a1 | 278 | c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi | 8e-06 | |
| d3c96a1 | 288 | c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Ps | 1e-05 | |
| d2gjca1 | 311 | c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Th | 1e-05 | |
| d1vdca1 | 192 | c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase | 2e-05 | |
| d1ps9a3 | 179 | c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA redu | 2e-05 | |
| d1fl2a1 | 184 | c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide | 2e-05 | |
| d1kf6a2 | 311 | c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Es | 3e-05 | |
| d1q1ra1 | 185 | c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductas | 3e-05 | |
| d1d7ya1 | 183 | c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredo | 3e-05 | |
| d1trba1 | 190 | c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase | 3e-05 | |
| d1fcda1 | 186 | c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulf | 8e-05 | |
| d1xdia1 | 233 | c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehyd | 8e-05 | |
| d1nhpa1 | 198 | c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enter | 2e-04 | |
| d1chua2 | 305 | c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {E | 2e-04 | |
| d1xhca1 | 167 | c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite | 4e-04 | |
| d2cula1 | 230 | c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {T | 4e-04 | |
| d1jnra2 | 356 | c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reduct | 6e-04 | |
| d1pn0a1 | 360 | c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {So | 6e-04 | |
| d1n4wa1 | 367 | c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of | 7e-04 | |
| d3coxa1 | 370 | c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of | 8e-04 | |
| d2jfga1 | 93 | c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D- | 8e-04 | |
| d1feca1 | 240 | c.3.1.5 (A:1-169,A:287-357) Trypanothione reductas | 0.001 | |
| d1aoga1 | 238 | c.3.1.5 (A:3-169,A:287-357) Trypanothione reductas | 0.001 | |
| d2dw4a1 | 102 | a.4.1.18 (A:172-273) Lysine-specific histone demet | 0.001 | |
| d1m6ia1 | 213 | c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing f | 0.002 | |
| d2f5va1 | 379 | c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {W | 0.002 | |
| d1l7da1 | 183 | c.2.1.4 (A:144-326) Nicotinamide nucleotide transh | 0.004 |
| >d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 449 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: FAD/NAD(P)-binding domain superfamily: FAD/NAD(P)-binding domain family: FAD-linked reductases, N-terminal domain domain: Lysine-specific histone demethylase 1, LSD1 species: Human (Homo sapiens) [TaxId: 9606]
Score = 198 bits (503), Expect = 4e-57
Identities = 118/462 (25%), Positives = 180/462 (38%), Gaps = 34/462 (7%)
Query: 43 PSSNKLRVLVIGAGLAGLAAARQLMRLGFRVTVLEGRKRAGGRVYTKKMEGGAGNRISAS 102
P+ +V++IG+G++GLAAARQL G VT+LE R R GGRV T +
Sbjct: 1 PTKKTGKVIIIGSGVSGLAAARQLQSFGMDVTLLEARDRVGGRVATFRKGNYV------- 53
Query: 103 ADLGGSVLTGTLGNPLGILAKQLGSLLHKVRDKCPLYRLDGNSVDPEIDMKVEADFNRLL 162
ADLG V+TG GNP+ +++KQ+ L K++ KCPLY +G +V E D VE +FNRLL
Sbjct: 54 ADLGAMVVTGLGGNPMAVVSKQVNMELAKIKQKCPLYEANGQAVPKEKDEMVEQEFNRLL 113
Query: 163 DKASRLRQLMGEVAM---DVSLGSALETFWRVYWDSGNAEAMNLFNWHLANLEYANASLL 219
+ S L + + VSLG ALE ++ E + + + E L
Sbjct: 114 EATSYLSHQLDFNVLNNKPVSLGQALEVVIQLQEKHVKDEQIEHWKKIVKTQEELKELLN 173
Query: 220 SKLSLAFWDQD---DPYDMGGDHCFLPGGNGRLVQALVENVPILYEKTVHTIRYGSDGVQ 276
++L ++ + LV++ ++ L ++ +
Sbjct: 174 KMVNLKEKIKELHQQYKEASEVKPPRDITAEFLVKSKHRDLTALCKEYDELAETQGKLEE 233
Query: 277 VLAGSQVFEGDMVLCTVPLGVLKSGSIKFIPELPQRKLDAIKRLGYGLLNKVAMLFPYVF 336
L + V + + + L + + + ++
Sbjct: 234 KLQELEANPPSDVYLSSRDRQILDWHFANLEFANATPLSTLSLKHWDQDDDFEFTGSHLT 293
Query: 337 WETDLDTFGHLTDDSSSRGEFFLFYSYATVAGGPLLIALVAGEAAHKFESMPPTDAVTKV 396
+ A G +IA+ + F T
Sbjct: 294 VRNGYSCVPVALAEGLDIKLNTAVRQVRYTASGCEVIAVNTRSTSQTFIYKCDAVLCTLP 353
Query: 397 LQILKGIYEPKGINVPEPIQTVCTRWGGDPFSLGSYSNVAVGASGDDYDIMAESVGD--- 453
L +LK P P W G+SG+DYD+MA+ +
Sbjct: 354 LGVLKQQPPAVQFVPPLP------EWKTSAVQRMVA----AGSSGNDYDLMAQPITPGPS 403
Query: 454 --------GRLFFAGEATIRRYPATMHGAFLSGLRETAKMAH 487
RLFFAGE TIR YPAT+HGA LSGLRE ++A
Sbjct: 404 IPGAPQPIPRLFFAGEHTIRNYPATVHGALLSGLREAGRIAD 445
|
| >d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 383 | Back information, alignment and structure |
|---|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 | Back information, alignment and structure |
|---|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 | Back information, alignment and structure |
|---|
| >d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Length = 370 | Back information, alignment and structure |
|---|
| >d2dw4a3 d.16.1.5 (A:655-763) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d2iida2 d.16.1.5 (A:320-432) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Length = 113 | Back information, alignment and structure |
|---|
| >d2v5za2 d.16.1.5 (A:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 112 | Back information, alignment and structure |
|---|
| >d1b5qa2 d.16.1.5 (A:294-405) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 112 | Back information, alignment and structure |
|---|
| >d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Length = 347 | Back information, alignment and structure |
|---|
| >d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 373 | Back information, alignment and structure |
|---|
| >d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 298 | Back information, alignment and structure |
|---|
| >d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297 | Back information, alignment and structure |
|---|
| >d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Length = 314 | Back information, alignment and structure |
|---|
| >d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Length = 336 | Back information, alignment and structure |
|---|
| >d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Length = 298 | Back information, alignment and structure |
|---|
| >d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Length = 253 | Back information, alignment and structure |
|---|
| >d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Length = 251 | Back information, alignment and structure |
|---|
| >d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Length = 230 | Back information, alignment and structure |
|---|
| >d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Length = 281 | Back information, alignment and structure |
|---|
| >d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Length = 276 | Back information, alignment and structure |
|---|
| >d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 221 | Back information, alignment and structure |
|---|
| >d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 265 | Back information, alignment and structure |
|---|
| >d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 | Back information, alignment and structure |
|---|
| >d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 335 | Back information, alignment and structure |
|---|
| >d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Length = 292 | Back information, alignment and structure |
|---|
| >d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 239 | Back information, alignment and structure |
|---|
| >d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Length = 268 | Back information, alignment and structure |
|---|
| >d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 229 | Back information, alignment and structure |
|---|
| >d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 308 | Back information, alignment and structure |
|---|
| >d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Length = 322 | Back information, alignment and structure |
|---|
| >d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 317 | Back information, alignment and structure |
|---|
| >d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 229 | Back information, alignment and structure |
|---|
| >d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Length = 196 | Back information, alignment and structure |
|---|
| >d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 217 | Back information, alignment and structure |
|---|
| >d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 336 | Back information, alignment and structure |
|---|
| >d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 259 | Back information, alignment and structure |
|---|
| >d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Length = 330 | Back information, alignment and structure |
|---|
| >d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 223 | Back information, alignment and structure |
|---|
| >d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 220 | Back information, alignment and structure |
|---|
| >d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 380 | Back information, alignment and structure |
|---|
| >d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 261 | Back information, alignment and structure |
|---|
| >d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Length = 305 | Back information, alignment and structure |
|---|
| >d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 246 | Back information, alignment and structure |
|---|
| >d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 235 | Back information, alignment and structure |
|---|
| >d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Length = 278 | Back information, alignment and structure |
|---|
| >d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Length = 288 | Back information, alignment and structure |
|---|
| >d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 311 | Back information, alignment and structure |
|---|
| >d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 192 | Back information, alignment and structure |
|---|
| >d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Length = 179 | Back information, alignment and structure |
|---|
| >d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 184 | Back information, alignment and structure |
|---|
| >d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Length = 311 | Back information, alignment and structure |
|---|
| >d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Length = 185 | Back information, alignment and structure |
|---|
| >d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Length = 183 | Back information, alignment and structure |
|---|
| >d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Length = 190 | Back information, alignment and structure |
|---|
| >d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Length = 186 | Back information, alignment and structure |
|---|
| >d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 233 | Back information, alignment and structure |
|---|
| >d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Length = 198 | Back information, alignment and structure |
|---|
| >d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Length = 305 | Back information, alignment and structure |
|---|
| >d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Length = 167 | Back information, alignment and structure |
|---|
| >d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Length = 230 | Back information, alignment and structure |
|---|
| >d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 356 | Back information, alignment and structure |
|---|
| >d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Length = 360 | Back information, alignment and structure |
|---|
| >d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Length = 367 | Back information, alignment and structure |
|---|
| >d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Length = 370 | Back information, alignment and structure |
|---|
| >d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Length = 93 | Back information, alignment and structure |
|---|
| >d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 240 | Back information, alignment and structure |
|---|
| >d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Length = 238 | Back information, alignment and structure |
|---|
| >d2dw4a1 a.4.1.18 (A:172-273) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Length = 213 | Back information, alignment and structure |
|---|
| >d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Length = 379 | Back information, alignment and structure |
|---|
| >d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Length = 183 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 688 | |||
| d2dw4a2 | 449 | Lysine-specific histone demethylase 1, LSD1 {Human | 100.0 | |
| d2v5za1 | 383 | Monoamine oxidase B {Human (Homo sapiens) [TaxId: | 100.0 | |
| d2iida1 | 370 | L-aminoacid oxidase {Malayan pit viper (Calloselas | 99.97 | |
| d1b5qa1 | 347 | Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | 99.96 | |
| d2ivda1 | 347 | Protoporphyrinogen oxidase {Myxococcus xanthus [Ta | 99.93 | |
| d1seza1 | 373 | Protoporphyrinogen oxidase {Tobacco (Nicotiana tab | 99.92 | |
| d2bcgg1 | 297 | Guanine nucleotide dissociation inhibitor, GDI {Ba | 99.86 | |
| d1d5ta1 | 336 | Guanine nucleotide dissociation inhibitor, GDI {Co | 99.83 | |
| d2bi7a1 | 314 | UDP-galactopyranose mutase, N-terminal domain {Kle | 99.8 | |
| d1i8ta1 | 298 | UDP-galactopyranose mutase, N-terminal domain {Esc | 99.71 | |
| d2gf3a1 | 281 | Sarcosine oxidase {Bacillus sp., strain b0618 [Tax | 99.54 | |
| d1ryia1 | 276 | Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | 99.54 | |
| d2gqfa1 | 253 | Hypothetical protein HI0933 {Haemophilus influenza | 99.44 | |
| d2i0za1 | 251 | Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] | 99.39 | |
| d2v5za2 | 112 | Monoamine oxidase B {Human (Homo sapiens) [TaxId: | 99.36 | |
| d1pj5a2 | 305 | N,N-dimethylglycine oxidase {Arthrobacter globifor | 99.35 | |
| d1b5qa2 | 112 | Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | 99.33 | |
| d2gv8a1 | 335 | Flavin-dependent monoxygenase SPBP16F5.08c {Schizo | 99.31 | |
| d1w4xa1 | 298 | Phenylacetone monooxygenase {Thermobifida fusca [T | 99.29 | |
| d1y0pa2 | 308 | Flavocytochrome c3 (respiratory fumarate reductase | 99.28 | |
| d1d4ca2 | 322 | Flavocytochrome c3 (respiratory fumarate reductase | 99.27 | |
| d2dw4a3 | 109 | Lysine-specific histone demethylase 1, LSD1 {Human | 99.26 | |
| d2iida2 | 113 | L-aminoacid oxidase {Malayan pit viper (Calloselas | 99.16 | |
| d1qo8a2 | 317 | Flavocytochrome c3 (respiratory fumarate reductase | 99.15 | |
| d2voua1 | 265 | Dihydroxypyridine hydroxylase DhpH {Arthrobacter n | 99.08 | |
| d2bs2a2 | 336 | Fumarate reductase {Wolinella succinogenes [TaxId: | 98.97 | |
| d1vg0a1 | 491 | Rab escort protein 1 {Rat (Rattus norvegicus) [Tax | 98.9 | |
| d1kf6a2 | 311 | Fumarate reductase {Escherichia coli [TaxId: 562]} | 98.89 | |
| d1n4wa1 | 367 | Cholesterol oxidase of GMC family {Streptomyces sp | 98.85 | |
| d1ps9a3 | 179 | 2,4-dienoyl-CoA reductase, middle domain {Escheric | 98.85 | |
| d2gmha1 | 380 | Electron transfer flavoprotein-ubiquinone oxidored | 98.76 | |
| d1v59a1 | 233 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 98.75 | |
| d1rp0a1 | 278 | Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara | 98.73 | |
| d1c0pa1 | 268 | D-aminoacid oxidase, N-terminal domain {Rhodotorul | 98.69 | |
| d1dxla1 | 221 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 98.68 | |
| d1lqta2 | 239 | Ferredoxin:NADP reductase FprA {Mycobacterium tube | 98.65 | |
| d1djqa3 | 233 | Trimethylamine dehydrogenase, middle domain {Methy | 98.62 | |
| d1cjca2 | 230 | Adrenodoxin reductase of mitochondrial p450 system | 98.56 | |
| d1ojta1 | 229 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 98.56 | |
| d2f5va1 | 379 | Pyranose 2-oxidase {White-rot fungus (Peniophora s | 98.55 | |
| d1gtea4 | 196 | Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su | 98.53 | |
| d3lada1 | 229 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 98.52 | |
| d2gjca1 | 311 | Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( | 98.52 | |
| d1gesa1 | 217 | Glutathione reductase {Escherichia coli [TaxId: 56 | 98.52 | |
| d3c96a1 | 288 | Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: | 98.44 | |
| d1chua2 | 305 | L-aspartate oxidase {Escherichia coli [TaxId: 562] | 98.44 | |
| d1neka2 | 330 | Succinate dehydogenase {Escherichia coli [TaxId: 5 | 98.37 | |
| d1onfa1 | 259 | Glutathione reductase {Plasmodium falciparum [TaxI | 98.35 | |
| d1pn0a1 | 360 | Phenol hydroxylase {Soil-living yeast (Trichosporo | 98.35 | |
| d1mo9a1 | 261 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 98.35 | |
| d1k0ia1 | 292 | p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a | 98.34 | |
| d1ebda1 | 223 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 98.33 | |
| d1jnra2 | 356 | Adenylylsulfate reductase A subunit {Archaeon Arch | 98.32 | |
| d3coxa1 | 370 | Cholesterol oxidase of GMC family {Brevibacterium | 98.3 | |
| d1h6va1 | 235 | Mammalian thioredoxin reductase {Rat (Rattus norve | 98.29 | |
| d1gesa2 | 116 | Glutathione reductase {Escherichia coli [TaxId: 56 | 98.28 | |
| d3grsa1 | 221 | Glutathione reductase {Human (Homo sapiens) [TaxId | 98.27 | |
| d2ivda2 | 108 | Protoporphyrinogen oxidase {Myxococcus xanthus [Ta | 98.26 | |
| d1trba1 | 190 | Thioredoxin reductase {Escherichia coli [TaxId: 56 | 98.25 | |
| d1ebda2 | 117 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 98.25 | |
| d1lvla1 | 220 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 98.24 | |
| d1fl2a1 | 184 | Alkyl hydroperoxide reductase subunit F (AhpF), C- | 98.21 | |
| d3lada2 | 119 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 98.17 | |
| d1onfa2 | 117 | Glutathione reductase {Plasmodium falciparum [TaxI | 98.17 | |
| d1seza2 | 112 | Protoporphyrinogen oxidase {Tobacco (Nicotiana tab | 98.17 | |
| d1q1ra2 | 133 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 98.15 | |
| d1gpea1 | 391 | Glucose oxidase {Penicillium amagasakiense [TaxId: | 98.14 | |
| d1kdga1 | 360 | Flavoprotein domain of flavocytochrome cellobiose | 98.14 | |
| d1aoga1 | 238 | Trypanothione reductase {Trypanosoma cruzi [TaxId: | 98.13 | |
| d1nhpa2 | 123 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 98.13 | |
| d2cula1 | 230 | GidA-related protein TTHA1897 {Thermus thermophilu | 98.11 | |
| d1cf3a1 | 385 | Glucose oxidase {Aspergillus niger [TaxId: 5061]} | 98.06 | |
| d1feca1 | 240 | Trypanothione reductase {Crithidia fasciculata [Ta | 98.04 | |
| d1m6ia2 | 137 | Apoptosis-inducing factor (AIF) {Human (Homo sapie | 98.03 | |
| d1dxla2 | 123 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 97.99 | |
| d1vdca1 | 192 | Thioredoxin reductase {Mouse-ear cress (Arabidopsi | 97.98 | |
| d1kifa1 | 246 | D-aminoacid oxidase, N-terminal domain {Pig (Sus s | 97.9 | |
| d1aoga2 | 117 | Trypanothione reductase {Trypanosoma cruzi [TaxId: | 97.84 | |
| d1ju2a1 | 351 | Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI | 97.78 | |
| d1feca2 | 117 | Trypanothione reductase {Crithidia fasciculata [Ta | 97.77 | |
| d1ojta2 | 125 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 97.73 | |
| d1xdia1 | 233 | Dihydrolipoamide dehydrogenase {Mycobacterium tube | 97.7 | |
| d1fcda1 | 186 | Flavocytochrome c sulfide dehydrogenase, FCSD, fla | 97.29 | |
| d1d7ya2 | 121 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 97.26 | |
| d1xhca2 | 122 | NADH oxidase /nitrite reductase {Pyrococcus furios | 97.05 | |
| d1lvla2 | 115 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 97.02 | |
| d1nhpa1 | 198 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 96.97 | |
| d1q1ra1 | 185 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 96.95 | |
| d1v59a2 | 122 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 96.93 | |
| d3grsa2 | 125 | Glutathione reductase {Human (Homo sapiens) [TaxId | 96.89 | |
| d2jfga1 | 93 | UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase | 96.88 | |
| d1d7ya1 | 183 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 96.68 | |
| d1e5qa1 | 182 | Saccharopine reductase {Rice blast fungus (Magnapo | 96.61 | |
| d1m6ia1 | 213 | Apoptosis-inducing factor (AIF) {Human (Homo sapie | 96.59 | |
| d1xhca1 | 167 | NADH oxidase /nitrite reductase {Pyrococcus furios | 96.53 | |
| d1h6va2 | 122 | Mammalian thioredoxin reductase {Rat (Rattus norve | 96.48 | |
| d1bg6a2 | 184 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A | 96.47 | |
| d1mo9a2 | 121 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 96.41 | |
| d1gtea3 | 153 | Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su | 96.1 | |
| d1ks9a2 | 167 | Ketopantoate reductase PanE {Escherichia coli [Tax | 96.05 | |
| d1pjca1 | 168 | L-alanine dehydrogenase {Phormidium lapideum [TaxI | 95.62 | |
| d1wdka3 | 186 | Fatty oxidation complex alpha subunit, middle doma | 95.41 | |
| d1mv8a2 | 202 | GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos | 95.37 | |
| d1f0ya2 | 192 | Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum | 95.35 | |
| d1l7da1 | 183 | Nicotinamide nucleotide transhydrogenase dI compon | 95.3 | |
| d1djqa2 | 156 | Trimethylamine dehydrogenase, C-terminal domain {M | 95.29 | |
| d1lssa_ | 132 | Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax | 95.01 | |
| d2hmva1 | 134 | Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | 94.32 | |
| d1n1ea2 | 189 | Glycerol-3- phosphate dehydrogenase {Trypanosome ( | 93.63 | |
| d2f1ka2 | 165 | Prephenate dehydrogenase TyrA {Synechocystis sp. p | 93.36 | |
| d1pzga1 | 154 | Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 | 93.13 | |
| d1i0za1 | 160 | Lactate dehydrogenase {Human (Homo sapiens), heart | 92.94 | |
| d1txga2 | 180 | Glycerol-3- phosphate dehydrogenase {Archaeoglobus | 92.85 | |
| d1ez4a1 | 146 | Lactate dehydrogenase {Lactobacillus pentosus [Tax | 92.75 | |
| d2pv7a2 | 152 | Prephenate dehydrogenase TyrA {Haemophilus influen | 92.74 | |
| d1kyqa1 | 150 | Bifunctional dehydrogenase/ferrochelatase Met8p, N | 92.73 | |
| d1dlja2 | 196 | UDP-glucose dehydrogenase (UDPGDH) {Streptococcus | 92.27 | |
| d1pjqa1 | 113 | Siroheme synthase CysG, domain 1 {Salmonella typhi | 91.48 | |
| d1djqa3 | 233 | Trimethylamine dehydrogenase, middle domain {Methy | 90.97 | |
| d2gv8a2 | 107 | Flavin-dependent monoxygenase SPBP16F5.08c {Schizo | 90.87 | |
| d2dw4a1 | 102 | Lysine-specific histone demethylase 1, LSD1 {Human | 90.49 | |
| d1jaya_ | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae | 90.36 | |
| d2ldxa1 | 159 | Lactate dehydrogenase {Mouse (Mus musculus) [TaxId | 90.11 | |
| d1trba2 | 126 | Thioredoxin reductase {Escherichia coli [TaxId: 56 | 90.01 | |
| d1nyta1 | 170 | Shikimate 5-dehydrogenase AroE {Escherichia coli [ | 89.9 | |
| d3cuma2 | 162 | Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru | 89.83 | |
| d2pgda2 | 176 | 6-phosphogluconate dehydrogenase {Sheep (Ovis orie | 89.76 | |
| d1pgja2 | 178 | 6-phosphogluconate dehydrogenase {Trypanosoma bruc | 89.72 | |
| d1fl2a2 | 126 | Alkyl hydroperoxide reductase subunit F (AhpF), C- | 89.71 | |
| d1vpda2 | 161 | Hydroxyisobutyrate dehydrogenase {Salmonella typhi | 89.5 | |
| d1y6ja1 | 142 | Lactate dehydrogenase {Clostridium thermocellum [T | 89.34 | |
| d1ps9a2 | 162 | 2,4-dienoyl-CoA reductase, C-terminal domain {Esch | 89.27 | |
| d1vdca2 | 130 | Thioredoxin reductase {Mouse-ear cress (Arabidopsi | 89.2 | |
| d1ldna1 | 148 | Lactate dehydrogenase {Bacillus stearothermophilus | 88.87 | |
| d1uxja1 | 142 | Malate dehydrogenase {Chloroflexus aurantiacus [Ta | 88.7 | |
| d1e3ja2 | 170 | Ketose reductase (sorbitol dehydrogenase) {Silverl | 88.46 | |
| d1pl8a2 | 171 | Ketose reductase (sorbitol dehydrogenase) {Human ( | 88.15 | |
| d1qyda_ | 312 | Pinoresinol-lariciresinol reductase {Giant arborvi | 87.65 | |
| d1llda1 | 143 | Lactate dehydrogenase {Bifidobacterium longum, str | 87.62 | |
| d1v59a2 | 122 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 87.54 | |
| d1guza1 | 142 | Malate dehydrogenase {Chlorobium vibrioforme [TaxI | 87.43 | |
| d1id1a_ | 153 | Rck domain from putative potassium channel Kch {Es | 87.38 | |
| d1hyha1 | 146 | L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La | 87.3 | |
| d1npya1 | 167 | Shikimate 5-dehydrogenase-like protein HI0607 {Hae | 87.27 | |
| d1i36a2 | 152 | Conserved hypothetical protein MTH1747 {Archaeon M | 87.11 | |
| d1piwa2 | 168 | Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas | 86.99 | |
| d2g5ca2 | 171 | Prephenate dehydrogenase TyrA {Aquifex aeolicus [T | 86.77 | |
| d1llua2 | 166 | Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax | 86.67 | |
| d1hyea1 | 145 | MJ0490, lactate/malate dehydrogenase {Archaeon Met | 86.2 | |
| d1w4xa2 | 235 | Phenylacetone monooxygenase {Thermobifida fusca [T | 85.93 | |
| d1t2da1 | 150 | Lactate dehydrogenase {Malaria parasite (Plasmodiu | 85.73 | |
| d1hdoa_ | 205 | Biliverdin IX beta reductase {Human (Homo sapiens) | 85.7 | |
| d1ojua1 | 142 | Malate dehydrogenase {Archaeon Archaeoglobus fulgi | 85.59 | |
| d1qyca_ | 307 | Phenylcoumaran benzylic ether reductase {Loblolly | 85.57 | |
| d1mo9a2 | 121 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 84.76 | |
| d2c5aa1 | 363 | GDP-mannose-3', 5'-epimerase {Thale cress (Arabido | 84.35 | |
| d1mlda1 | 144 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 83.94 | |
| d2fq3a1 | 85 | Transcription regulatory protein swi3 {Baker's yea | 83.27 | |
| d1vj0a2 | 182 | Hypothetical protein TM0436 {Thermotoga maritima [ | 83.2 | |
| d1vi2a1 | 182 | Putative shikimate dehydrogenase YdiB {Escherichia | 82.92 | |
| d1a5za1 | 140 | Lactate dehydrogenase {Thermotoga maritima [TaxId: | 82.92 | |
| d1a9xa4 | 121 | Carbamoyl phosphate synthetase (CPS), large subuni | 82.45 | |
| d1jw9b_ | 247 | Molybdenum cofactor biosynthesis protein MoeB {Esc | 81.95 | |
| d1jqba2 | 174 | Bacterial secondary alcohol dehydrogenase {Clostri | 81.7 | |
| d1m6ia1 | 213 | Apoptosis-inducing factor (AIF) {Human (Homo sapie | 80.93 | |
| d1uufa2 | 168 | Hypothetical protein YahK {Escherichia coli [TaxId | 80.7 |
| >d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: FAD/NAD(P)-binding domain superfamily: FAD/NAD(P)-binding domain family: FAD-linked reductases, N-terminal domain domain: Lysine-specific histone demethylase 1, LSD1 species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=1e-31 Score=227.44 Aligned_cols=138 Identities=46% Similarity=0.697 Sum_probs=112.9
Q ss_pred CCCCCCEEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCCCEEEEEECCCCCCCCCCEEEECCCEEECCCCCCHHHHHHH
Q ss_conf 99999379997628899999999979996899925999731011023299988877605501450532999959999999
Q 005607 44 SSNKLRVLVIGAGLAGLAAARQLMRLGFRVTVLEGRKRAGGRVYTKKMEGGAGNRISASADLGGSVLTGTLGNPLGILAK 123 (688)
Q Consensus 44 ~~~~~dVvIIGAGiaGLsAA~~L~k~G~~V~VlE~~~~~GGr~~s~~~~g~~g~~~~~~~d~G~~~i~~~~~~~l~~l~~ 123 (688)
++++.+|||||||+|||+||++|+++|++|+|||+++++|||++|.+..|+ .+|+|+++|++...+++..+++
T Consensus 2 ~~~~~kViVIGaG~aGL~aA~~L~~~G~~V~VlEa~~r~GGr~~t~~~~g~-------~~d~G~~~i~~~~~~~~~~l~~ 74 (449)
T d2dw4a2 2 TKKTGKVIIIGSGVSGLAAARQLQSFGMDVTLLEARDRVGGRVATFRKGNY-------VADLGAMVVTGLGGNPMAVVSK 74 (449)
T ss_dssp SSCCCEEEEECCBHHHHHHHHHHHHTTCEEEEECSSSSSBTTCCEEEETTE-------EEESSCCEECCSBTCHHHHHHH
T ss_pred CCCCCCEEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCEEEEEECCE-------EEECCCEEECCCCCCHHHHHHH
T ss_conf 999994899898889999999998589998999079987566779972998-------9978977988999749999999
Q ss_pred HHCCCEEEECCCCCEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCC---CCCCCHHHHHHHH
Q ss_conf 8299665550882178159932191355899999999999999999984001---3699988999999
Q 005607 124 QLGSLLHKVRDKCPLYRLDGNSVDPEIDMKVEADFNRLLDKASRLRQLMGEV---AMDVSLGSALETF 188 (688)
Q Consensus 124 ~lGl~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~ll~~~~~~~~~~~~~---~~~~s~~~~l~~~ 188 (688)
++|++.........++..+|..+...........+..++.....+....... ....++.++++..
T Consensus 75 ~lgl~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 142 (449)
T d2dw4a2 75 QVNMELAKIKQKCPLYEANGQAVPKEKDEMVEQEFNRLLEATSYLSHQLDFNVLNNKPVSLGQALEVV 142 (449)
T ss_dssp HHTCCEEECCCCCCEECTTSCBCCHHHHHHHHHHHHHHHHHHHHHHHTSCCCEETTEECBHHHHHHHH
T ss_pred HCCCCCEECCCCCEEEECCCCEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHH
T ss_conf 75996254389834991399372044136679999999999999988752210023320078999877
|
| >d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} | Back information, alignment and structure |
|---|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} | Back information, alignment and structure |
|---|
| >d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2v5za2 d.16.1.5 (A:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} | Back information, alignment and structure |
|---|
| >d1b5qa2 d.16.1.5 (A:294-405) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} | Back information, alignment and structure |
|---|
| >d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} | Back information, alignment and structure |
|---|
| >d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} | Back information, alignment and structure |
|---|
| >d2dw4a3 d.16.1.5 (A:655-763) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2iida2 d.16.1.5 (A:320-432) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} | Back information, alignment and structure |
|---|
| >d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} | Back information, alignment and structure |
|---|
| >d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} | Back information, alignment and structure |
|---|
| >d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} | Back information, alignment and structure |
|---|
| >d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} | Back information, alignment and structure |
|---|
| >d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} | Back information, alignment and structure |
|---|
| >d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} | Back information, alignment and structure |
|---|
| >d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|
| >d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} | Back information, alignment and structure |
|---|
| >d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ivda2 d.16.1.5 (A:307-414) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} | Back information, alignment and structure |
|---|
| >d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1seza2 d.16.1.5 (A:330-441) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} | Back information, alignment and structure |
|---|
| >d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} | Back information, alignment and structure |
|---|
| >d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} | Back information, alignment and structure |
|---|
| >d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} | Back information, alignment and structure |
|---|
| >d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} | Back information, alignment and structure |
|---|
| >d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|
| >d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} | Back information, alignment and structure |
|---|
| >d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} | Back information, alignment and structure |
|---|
| >d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} | Back information, alignment and structure |
|---|
| >d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
|---|
| >d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} | Back information, alignment and structure |
|---|
| >d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2dw4a1 a.4.1.18 (A:172-273) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} | Back information, alignment and structure |
|---|
| >d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} | Back information, alignment and structure |
|---|
| >d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} | Back information, alignment and structure |
|---|
| >d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} | Back information, alignment and structure |
|---|
| >d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} | Back information, alignment and structure |
|---|
| >d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} | Back information, alignment and structure |
|---|
| >d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} | Back information, alignment and structure |
|---|
| >d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} | Back information, alignment and structure |
|---|
| >d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|
| >d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2fq3a1 a.4.1.18 (A:311-395) Transcription regulatory protein swi3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} | Back information, alignment and structure |
|---|
| >d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|