Citrus Sinensis ID: 005626


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------
MAWVEKDVSNGRERDPVQDNGFLKGPQSLPGTSGSPVAVGSTLKGFEGKDALSYANILRSRNKFVDALALYEIVLEKDSGNVEAHIGKGICLQMQNMGRLAFDSFSEAVKLDPQNACAHTHCGILYKDEGRLVEAAESYHKALSADPSYKPAAECLAIVLTDLGTSLKLAGNTQDGIQKYYEALKIDPHYAPAYYNLGVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRGDLESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTSWDNTKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYSAVVKADAKTIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYPNTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPTPALTNGFITFGSFNNLAKVLVRSYLCLDKCSTCGG
ccHHHHHHccccccccccHHHHHHccccccccccccHHHccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccccccccccccccEEEEEcccccccHHHHHHHHHHHHccccccEEEEEEccccccHHHHHHHHHHHHccccEEEcccccHHHHHHHHHHccccEEEEccccccccHHHHHHHcHHHHHHHccccccccccccccEEEEcccccccccccccccccEEcccccccccccccccccccccccccccEEEEEccccccccHHHHHHHHHHHcccc
cccHHHcccccccHHHHHHHcHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHcHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEEEccccccHHHHHHHHHHHHcccccEEEEEEEccccccHHHHHHHHHHHHHHcccEEHHcccHHHHHHHHHHcccEEEEEcccccccccccEEEEccccEEEEEEccccccccccEEEEEEccccccHHHHHHHHHHHHcccccEEEccccccccccccccccccccEEEEEEcccccccccEEEEEcccccccc
mawvekdvsngrerdpvqdngflkgpqslpgtsgspvavgstlkgfegkdaLSYANILRSRNKFVDALALYEIVLEkdsgnveahIGKGICLqmqnmgrlafdsfseavkldpqnacahthcgilykdegrLVEAAESYHKalsadpsykpAAECLAIVLTDLGTSLKLAGNTQDGIQKYYEALkidphyapayynLGVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRGDLESAIACYERClavspnfeiaKNNMAIALTDlgtkvklegdinQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLgviykdrdnLDKAVECYQMALSikpnfsqslNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQClkidpdsrnagqNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYtswdntkdperplvigyvspdyfthSVSYFIeaplvyhdyqnYKVVVYSAVVKADAKTIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTghtannklgmmacqpapvqvtwigypnttglptidyritdsladppetkQKHVEELIrlpecflcytpspeagpvcptpaltngfitfGSFNNLAKVLVRSYLCldkcstcgg
mawvekdvsngrerdpvqdngflkgpqslpgtsgSPVAVGSTLKGFEGKDALSYANILRSRNKFVDALALYEIVLEKDSGNVEAHIGKGICLQMQNMGRLAFDSFSEAVKLDPQNACAHTHCGILYKDEGRLVEAAESYHKAlsadpsykPAAECLAIVLTDLGTSLKLAGNTQDGIQKYYEALKIDPHYAPAYYNLGVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRGDLESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSikpnfsqslNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTswdntkdperPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYSAVVKadaktirfrekvmkkggiwrdiygiDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYPNTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPTPALTNGFITFGSFNNLAKVLVRSYLCLDKCSTCGG
MAWVEKDVSNGRERDPVQDNGFLKGPQSLPGTSGSPVAVGSTLKGFEGKDALSYANILRSRNKFVDALALYEIVLEKDSGNVEAHIGKGICLQMQNMGRLAFDSFSEAVKLDPQNACAHTHCGILYKDEGRLVEAAESYHKALSADPSYKPAAECLAIVLTDLGTSLKLAGNTQDGIQKYYEALKIDPHYAPAYYNLGVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRGDLESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLGVVYTVQGkmdaaaemiekaiaaNPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTSWDNTKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYkvvvysavvkadakTIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYPNTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPTPALTNGFITFGSFNNLAKVLVRSYLCLDKCSTCGG
******************************************LKGFEGKDALSYANILRSRNKFVDALALYEIVLEKDSGNVEAHIGKGICLQMQNMGRLAFDSFSEAVKLDPQNACAHTHCGILYKDEGRLVEAAESYHKALSADPSYKPAAECLAIVLTDLGTSLKLAGNTQDGIQKYYEALKIDPHYAPAYYNLGVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRGDLESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTSWDNTKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYSAVVKADAKTIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYPNTTGLPTIDYRITDSL*********HVEELIRLPECFLCYTPSPEAGPVCPTPALTNGFITFGSFNNLAKVLVRSYLCLDKCST***
MAWVEKDVSNGRERDPVQDNGFLKGPQSLPGTSGSPVAVGSTLKGFEGKDALSYANILRSRNKFVDALALYEIVLEKDSGNVEAHIGKGICLQMQNMGRLAFDSFSEAVKLDPQNACAHTHCGILYKDEGRLVEAAESYHKALSADPSYKPAAECLAIVLTDLGTSLKLAGNTQDGIQKYYEALKIDPHYAPAYYNLGVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRGDLESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTSWDNTKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYSAVVKADAKTIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYPNTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPTPALTNGFITFGSFNNLAKVLVRSYLCLDKCSTCG*
*************RDPVQDNGFLKGPQSLPGTSGSPVAVGSTLKGFEGKDALSYANILRSRNKFVDALALYEIVLEKDSGNVEAHIGKGICLQMQNMGRLAFDSFSEAVKLDPQNACAHTHCGILYKDEGRLVEAAESYHKALSADPSYKPAAECLAIVLTDLGTSLKLAGNTQDGIQKYYEALKIDPHYAPAYYNLGVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRGDLESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTSWDNTKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYSAVVKADAKTIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYPNTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPTPALTNGFITFGSFNNLAKVLVRSYLCLDKCSTCGG
MAW***D*SNGRERDPVQDNGFLKGPQSLPGTSGSPVAVGSTLKGFEGKDALSYANILRSRNKFVDALALYEIVLEKDSGNVEAHIGKGICLQMQNMGRLAFDSFSEAVKLDPQNACAHTHCGILYKDEGRLVEAAESYHKALSADPSYKPAAECLAIVLTDLGTSLKLAGNTQDGIQKYYEALKIDPHYAPAYYNLGVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRGDLESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTSWDNTKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYSAVVKADAKTIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYPNTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPTPALTNGFITFGSFNNLAKVLVRSYLCLDKCSTCGG
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAWVEKDVSNGRERDPVQDNGFLKGPQSLPGTSGSPVAVGSTLKGFEGKDALSYANILRSRNKFVDALALYEIVLEKDSGNVEAHIGKGICLQMQNMGRLAFDSFSEAVKLDPQNACAHTHCGILYKDEGRLVEAAESYHKALSADPSYKPAAECLAIVLTDLGTSLKLAGNTQDGIQKYYEALKIDPHYAPAYYNLGVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRGDLESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTSWDNTKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYSAVVKADAKTIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYPNTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPTPALTNGFITFGSFNNLAKVLVRSYLCLDKCSTCGG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query687 2.2.26 [Sep-21-2011]
O82039 932 Probable UDP-N-acetylgluc N/A no 0.976 0.719 0.880 0.0
Q8RVB2 931 Probable UDP-N-acetylgluc N/A no 0.976 0.720 0.871 0.0
Q96301 914 Probable UDP-N-acetylgluc yes no 0.969 0.728 0.850 0.0
O82422 944 Probable UDP-N-acetylgluc N/A no 0.909 0.662 0.841 0.0
Q8LP10 918 Probable UDP-N-acetylgluc N/A no 0.915 0.685 0.840 0.0
Q6YZI0 927 Probable UDP-N-acetylgluc yes no 0.947 0.702 0.801 0.0
Q9M8Y0 977 Probable UDP-N-acetylgluc no no 0.810 0.570 0.282 4e-61
P81436 1046 UDP-N-acetylglucosamine-- yes no 0.823 0.541 0.262 2e-55
Q8CGY8 1046 UDP-N-acetylglucosamine-- yes no 0.823 0.541 0.262 2e-55
Q27HV0 1046 UDP-N-acetylglucosamine-- yes no 0.823 0.541 0.262 2e-55
>sp|O82039|SPY_PETHY Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Petunia hybrida GN=SPY PE=2 SV=1 Back     alignment and function desciption
 Score = 1261 bits (3264), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 591/671 (88%), Positives = 633/671 (94%)

Query: 1   MAWVEKDVSNGRERDPVQDNGFLKGPQSLPGTSGSPVAVGSTLKGFEGKDALSYANILRS 60
           MAW EKDV NG+E D + +NGFLKG QS   + GSPV +    K FEGKDA++YANILRS
Sbjct: 1   MAWTEKDVENGKESDSLGNNGFLKGVQSSSDSKGSPVRISPVKKSFEGKDAITYANILRS 60

Query: 61  RNKFVDALALYEIVLEKDSGNVEAHIGKGICLQMQNMGRLAFDSFSEAVKLDPQNACAHT 120
           RNKFVDALA+YE VL+KDSG++E+ IGKGICLQMQNMGRLAF+SF+EA+KLDPQNACA T
Sbjct: 61  RNKFVDALAIYESVLQKDSGSIESLIGKGICLQMQNMGRLAFESFAEAIKLDPQNACALT 120

Query: 121 HCGILYKDEGRLVEAAESYHKALSADPSYKPAAECLAIVLTDLGTSLKLAGNTQDGIQKY 180
           HCGILYKDEGRLVEAAESY KAL ADPSYKPAAECLAIVLTD+GTSLKLAGN+Q+GIQKY
Sbjct: 121 HCGILYKDEGRLVEAAESYQKALKADPSYKPAAECLAIVLTDIGTSLKLAGNSQEGIQKY 180

Query: 181 YEALKIDPHYAPAYYNLGVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRGD 240
           YEA+KID HYAPAYYNLGVVYSE+MQYD AL CYEKAA+ERPMYAEAYCNMGVIYKNRGD
Sbjct: 181 YEAIKIDSHYAPAYYNLGVVYSEMMQYDMALNCYEKAAIERPMYAEAYCNMGVIYKNRGD 240

Query: 241 LESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYA 300
           LESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYA
Sbjct: 241 LESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYA 300

Query: 301 DAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMA 360
           DAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMA
Sbjct: 301 DAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMA 360

Query: 361 LSIKPNFSQSLNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISL 420
           L+IKPNFSQSLNNLGVVYTVQGKMDAAA MIEKAI ANPTYAEAYNNLGVLYRDAG+ISL
Sbjct: 361 LTIKPNFSQSLNNLGVVYTVQGKMDAAASMIEKAIIANPTYAEAYNNLGVLYRDAGNISL 420

Query: 421 AIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTSWDN 480
           AI+AYEQCLKIDPDSRNAGQNRLLAMNYINEG DDKL+EAHRDWG RFMRLY QY SWDN
Sbjct: 421 AIEAYEQCLKIDPDSRNAGQNRLLAMNYINEGSDDKLYEAHRDWGWRFMRLYQQYNSWDN 480

Query: 481 TKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYSAVVKADAKTIRFREKV 540
           +KDPER LVIGYVSPDYFTHSVSYFIEAPL YHDY NYKVV+YSAVVKADAKT RFR+KV
Sbjct: 481 SKDPERQLVIGYVSPDYFTHSVSYFIEAPLAYHDYANYKVVIYSAVVKADAKTNRFRDKV 540

Query: 541 MKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYP 600
           +KKGG+WRDIYGIDEKKV++M+REDK+DI++ELTGHTANNKLGMMAC+PAPVQVTWIGYP
Sbjct: 541 LKKGGVWRDIYGIDEKKVSSMIREDKVDIMIELTGHTANNKLGMMACRPAPVQVTWIGYP 600

Query: 601 NTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPTPALTNGFI 660
           NTTGLPTIDYRITDS+ADPP TKQKHVEEL+RLP+ FLCYTPSPEAGPV P PALTNGF+
Sbjct: 601 NTTGLPTIDYRITDSMADPPSTKQKHVEELVRLPDSFLCYTPSPEAGPVSPAPALTNGFV 660

Query: 661 TFGSFNNLAKV 671
           TFGSFNNLAK+
Sbjct: 661 TFGSFNNLAKI 671




Probable O-linked N-acetylglucosamine transferase (OGT) involved in various processes such as gibberellin (GA) signaling pathway. OGTs catalyze the addition of nucleotide-activated sugars directly onto the polypeptide through O-glycosidic linkage with the hydroxyl of serine or threonine. Probably acts by adding O-linked sugars to yet unknown proteins.
Petunia hybrida (taxid: 4102)
EC: 2EC: .EC: 4EC: .EC: 1EC: .EC: -
>sp|Q8RVB2|SPY_SOLLC Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Solanum lycopersicum GN=SPY PE=2 SV=1 Back     alignment and function description
>sp|Q96301|SPY_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Arabidopsis thaliana GN=SPY PE=1 SV=1 Back     alignment and function description
>sp|O82422|SPY_HORVU Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Hordeum vulgare GN=SPY PE=2 SV=1 Back     alignment and function description
>sp|Q8LP10|SPY_EUSER Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Eustoma exaltatum subsp. russellianum GN=SPY PE=2 SV=1 Back     alignment and function description
>sp|Q6YZI0|SPY_ORYSJ Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Oryza sativa subsp. japonica GN=SPY PE=3 SV=1 Back     alignment and function description
>sp|Q9M8Y0|SEC_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana GN=SEC PE=2 SV=1 Back     alignment and function description
>sp|P81436|OGT1_RABIT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus GN=OGT PE=1 SV=2 Back     alignment and function description
>sp|Q8CGY8|OGT1_MOUSE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus GN=Ogt PE=1 SV=2 Back     alignment and function description
>sp|Q27HV0|OGT1_PIG UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Sus scrofa GN=OGT PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query687
255579381 930 o-linked n-acetylglucosamine transferase 0.976 0.721 0.901 0.0
75318818 932 RecName: Full=Probable UDP-N-acetylgluco 0.976 0.719 0.880 0.0
224140075 917 predicted protein [Populus trichocarpa] 0.976 0.731 0.888 0.0
224088480 934 predicted protein [Populus trichocarpa] 0.976 0.718 0.882 0.0
225440809 914 PREDICTED: probable UDP-N-acetylglucosam 0.973 0.731 0.889 0.0
256772634 916 putative SPINDLY protein [Rosa lucieae] 0.975 0.731 0.881 0.0
356500631 928 PREDICTED: probable UDP-N-acetylglucosam 0.972 0.719 0.876 0.0
195423963 934 SPINDLY [Sinningia speciosa] 0.979 0.720 0.870 0.0
356534448 929 PREDICTED: probable UDP-N-acetylglucosam 0.972 0.719 0.858 0.0
449526080 925 PREDICTED: probable UDP-N-acetylglucosam 0.976 0.725 0.862 0.0
>gi|255579381|ref|XP_002530535.1| o-linked n-acetylglucosamine transferase, ogt, putative [Ricinus communis] gi|223529939|gb|EEF31867.1| o-linked n-acetylglucosamine transferase, ogt, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1275 bits (3299), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 606/672 (90%), Positives = 638/672 (94%), Gaps = 1/672 (0%)

Query: 1   MAWVEKDVSNGRERDPVQDNGFLKGPQS-LPGTSGSPVAVGSTLKGFEGKDALSYANILR 59
           MAW EK+  NG+E  P++DNGFLKG Q   P  SGSPVAV + LKG E KD+LSYANILR
Sbjct: 1   MAWTEKNNGNGKEGGPIEDNGFLKGTQEPSPSASGSPVAVAAGLKGIEEKDSLSYANILR 60

Query: 60  SRNKFVDALALYEIVLEKDSGNVEAHIGKGICLQMQNMGRLAFDSFSEAVKLDPQNACAH 119
           SRNKFVDALA+YE VLEKDSGNVEA+IGKGICLQMQNMGRLAFDSF+EA+KLDPQNACA 
Sbjct: 61  SRNKFVDALAIYESVLEKDSGNVEAYIGKGICLQMQNMGRLAFDSFAEAIKLDPQNACAL 120

Query: 120 THCGILYKDEGRLVEAAESYHKALSADPSYKPAAECLAIVLTDLGTSLKLAGNTQDGIQK 179
           THCGILYK+EGRLVEAAESY KAL ADP YKPAAECL+IVLTDLGTSLKL+GNTQ+GIQK
Sbjct: 121 THCGILYKEEGRLVEAAESYQKALRADPLYKPAAECLSIVLTDLGTSLKLSGNTQEGIQK 180

Query: 180 YYEALKIDPHYAPAYYNLGVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRG 239
           YYEALKIDPHYAPAYYNLGVVYSE+MQYDTAL CYEKAALERPMYAEAYCNMGVIYKNRG
Sbjct: 181 YYEALKIDPHYAPAYYNLGVVYSEMMQYDTALNCYEKAALERPMYAEAYCNMGVIYKNRG 240

Query: 240 DLESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHY 299
           DLESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQG+AYYKKALYYNWHY
Sbjct: 241 DLESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGIAYYKKALYYNWHY 300

Query: 300 ADAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQM 359
           ADAMYNLGVAYGEMLKFD AIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQ 
Sbjct: 301 ADAMYNLGVAYGEMLKFDNAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQT 360

Query: 360 ALSIKPNFSQSLNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSIS 419
           ALSIKPNFSQSLNNLGVVYTVQGKMDAAA MIEKAI ANPTYAEAYNNLGVLYRDAG+I 
Sbjct: 361 ALSIKPNFSQSLNNLGVVYTVQGKMDAAASMIEKAIMANPTYAEAYNNLGVLYRDAGNIP 420

Query: 420 LAIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTSWD 479
           +AI+AYEQCLKIDPDSRNAGQNRLLAMNYINEGHD+KLFEAHRDWG+RFMRLY QYT WD
Sbjct: 421 MAINAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDEKLFEAHRDWGRRFMRLYPQYTMWD 480

Query: 480 NTKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYSAVVKADAKTIRFREK 539
           N KD +RPLVIGYVSPDYFTHSVSYFIEAPLVYHDY NYKVVVYSAVVKADAKTIRFREK
Sbjct: 481 NPKDLDRPLVIGYVSPDYFTHSVSYFIEAPLVYHDYANYKVVVYSAVVKADAKTIRFREK 540

Query: 540 VMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGY 599
           V+K+GGIWRDIYGIDEKKVA+MVRED +DILVELTGHTANNKLGMMAC+PAP+QVTWIGY
Sbjct: 541 VLKQGGIWRDIYGIDEKKVASMVREDNVDILVELTGHTANNKLGMMACRPAPIQVTWIGY 600

Query: 600 PNTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPTPALTNGF 659
           PNTTGLPTIDYRITDSLADP +TKQKHVEEL+RLP+CFLCYTPSPEAGPVCPTPAL NGF
Sbjct: 601 PNTTGLPTIDYRITDSLADPRDTKQKHVEELVRLPDCFLCYTPSPEAGPVCPTPALANGF 660

Query: 660 ITFGSFNNLAKV 671
           ITFGSFNNLAK+
Sbjct: 661 ITFGSFNNLAKI 672




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|75318818|sp|O82039.1|SPY_PETHY RecName: Full=Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY; AltName: Full=PhSPY gi|3319682|emb|CAA76834.1| SPINDLY protein [Petunia x hybrida] Back     alignment and taxonomy information
>gi|224140075|ref|XP_002323412.1| predicted protein [Populus trichocarpa] gi|222868042|gb|EEF05173.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224088480|ref|XP_002308458.1| predicted protein [Populus trichocarpa] gi|222854434|gb|EEE91981.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225440809|ref|XP_002281883.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY [Vitis vinifera] gi|297740152|emb|CBI30334.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|256772634|emb|CAX46402.1| putative SPINDLY protein [Rosa lucieae] Back     alignment and taxonomy information
>gi|356500631|ref|XP_003519135.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY-like [Glycine max] gi|401721241|gb|AFP99901.1| putative UDP-N-acetylglucosamin [Glycine max] Back     alignment and taxonomy information
>gi|195423963|gb|ACF96937.1| SPINDLY [Sinningia speciosa] Back     alignment and taxonomy information
>gi|356534448|ref|XP_003535766.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY-like [Glycine max] Back     alignment and taxonomy information
>gi|449526080|ref|XP_004170042.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query687
TAIR|locus:2080722 914 SPY "SPINDLY" [Arabidopsis tha 0.969 0.728 0.810 6.4e-305
UNIPROTKB|Q749Z1 585 GSU2601 "TPR domain/SEC-C moti 0.537 0.630 0.375 6.2e-62
TIGR_CMR|GSU_2601 585 GSU_2601 "TPR domain/SEC-C mot 0.537 0.630 0.375 6.2e-62
TAIR|locus:2103025 977 SEC "secret agent" [Arabidopsi 0.564 0.397 0.297 5e-54
WB|WBGene00003858 1151 ogt-1 [Caenorhabditis elegans 0.572 0.341 0.271 4.8e-49
UNIPROTKB|O18158 1151 ogt-1 "UDP-N-acetylglucosamine 0.572 0.341 0.271 4.8e-49
ZFIN|ZDB-GENE-051128-1 1102 ogt.2 "O-linked N-acetylglucos 0.754 0.470 0.264 3.4e-46
RGD|62060 1036 Ogt "O-linked N-acetylglucosam 0.755 0.500 0.263 3.6e-46
MGI|MGI:1339639 1046 Ogt "O-linked N-acetylglucosam 0.755 0.496 0.263 3.7e-46
ZFIN|ZDB-GENE-030131-9631 1062 ogt.1 "O-linked N-acetylglucos 0.756 0.489 0.260 3.9e-46
TAIR|locus:2080722 SPY "SPINDLY" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2926 (1035.1 bits), Expect = 6.4e-305, P = 6.4e-305
 Identities = 544/671 (81%), Positives = 587/671 (87%)

Query:     1 MAWVEKDVSNGRERDPVQDNGFLKGPQSLPGTSGSPVAVGSTLKGFEGKDALSYANILRS 60
             M  +E D    RER PV +NGF  G +S   ++G    +  + K  +G D LSYANILR+
Sbjct:     1 MVGLEDDTE--RERSPVVENGFSNGSRSSSSSAG---VLSPSRKVTQGNDTLSYANILRA 55

Query:    61 RNKFVDALALYEIVLEKDSGNVEAHIGKGICLQMQNMGRLAFDSFSEAVKLDPQNACAHT 120
             RNKF DALALYE +LEKDS NVEAHIGKGICLQ QN G LAFD FSEA++LDP NACA T
Sbjct:    56 RNKFADALALYEAMLEKDSKNVEAHIGKGICLQTQNKGNLAFDCFSEAIRLDPHNACALT 115

Query:   121 HCGILYKDEGRLVEAAESYHKALSADPSYKPAAECLAIVLTDLGTSLKLAGNTQDGIQKY 180
             HCGIL+K+EGRLVEAAESY KAL AD SYKPAAECLAIVLTDLGTSLKLAGNTQ+GIQKY
Sbjct:   116 HCGILHKEEGRLVEAAESYQKALMADASYKPAAECLAIVLTDLGTSLKLAGNTQEGIQKY 175

Query:   181 YEALKIDPHYAPAYYNLGVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRGD 240
             YEALKIDPHYAPAYYNLGVVYSE+MQYD AL CYEKAALERPMYAEAYCNMGVIYKNRGD
Sbjct:   176 YEALKIDPHYAPAYYNLGVVYSEMMQYDNALSCYEKAALERPMYAEAYCNMGVIYKNRGD 235

Query:   241 LESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYA 300
             LE AI CYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGD+ QGVAYYKKALYYNWHYA
Sbjct:   236 LEMAITCYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDVTQGVAYYKKALYYNWHYA 295

Query:   301 DAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMA 360
             DAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGV+YKDRDNLDKAVECYQMA
Sbjct:   296 DAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVLYKDRDNLDKAVECYQMA 355

Query:   361 LSIKPNFSQSLNNLGVVYTVQGXXXXXXXXXXXXXXXNPTYAEAYNNLGVLYRDAGSISL 420
             LSIKPNF+QSLNNLGVVYTVQG               NPTYAEA+NNLGVLYRDAG+I++
Sbjct:   356 LSIKPNFAQSLNNLGVVYTVQGKMDAAASMIEKAILANPTYAEAFNNLGVLYRDAGNITM 415

Query:   421 AIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQYTSWDN 480
             AIDAYE+CLKIDPDSRNAGQNRLLAMNYINEG DDKLFEAHRDWG RF RL+ QYTSWDN
Sbjct:   416 AIDAYEECLKIDPDSRNAGQNRLLAMNYINEGLDDKLFEAHRDWGWRFTRLHPQYTSWDN 475

Query:   481 TKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYXXXXXXXXXXXXXXTIRFREKV 540
              KDPERP+ IGY+SPD+FTHSVSYFIEAPL +HDY  Y              T RFR+KV
Sbjct:   476 LKDPERPITIGYISPDFFTHSVSYFIEAPLTHHDYTKYKVVVYSAVVKADAKTYRFRDKV 535

Query:   541 MKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYP 600
             +KKGG+W+DIYGIDEKK+A+MVREDKIDILVELTGHTANNKLG MAC+PAPVQVTWIGYP
Sbjct:   536 LKKGGVWKDIYGIDEKKIASMVREDKIDILVELTGHTANNKLGTMACRPAPVQVTWIGYP 595

Query:   601 NTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPTPALTNGFI 660
             NTTGLPT+DYRITDSLADPP+TKQK VEEL+RLP+CFLCYTPSPEAGPVCPTPAL+NGF+
Sbjct:   596 NTTGLPTVDYRITDSLADPPDTKQKQVEELVRLPDCFLCYTPSPEAGPVCPTPALSNGFV 655

Query:   661 TFGSFNNLAKV 671
             TFGSFNNLAK+
Sbjct:   656 TFGSFNNLAKI 666




GO:0005634 "nucleus" evidence=ISM;IDA;TAS
GO:0016757 "transferase activity, transferring glycosyl groups" evidence=ISS
GO:0016262 "protein N-acetylglucosaminyltransferase activity" evidence=TAS
GO:0009938 "negative regulation of gibberellic acid mediated signaling pathway" evidence=IGI
GO:0005737 "cytoplasm" evidence=IDA
GO:0009740 "gibberellic acid mediated signaling pathway" evidence=TAS
GO:0005515 "protein binding" evidence=IPI
GO:0009736 "cytokinin mediated signaling pathway" evidence=IMP
GO:0005829 "cytosol" evidence=IDA
GO:2000377 "regulation of reactive oxygen species metabolic process" evidence=IMP
GO:0000278 "mitotic cell cycle" evidence=RCA
GO:0000956 "nuclear-transcribed mRNA catabolic process" evidence=RCA
GO:0006346 "methylation-dependent chromatin silencing" evidence=RCA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=RCA
GO:0006396 "RNA processing" evidence=RCA
GO:0016246 "RNA interference" evidence=RCA
GO:0043687 "post-translational protein modification" evidence=RCA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA
UNIPROTKB|Q749Z1 GSU2601 "TPR domain/SEC-C motif domain protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_2601 GSU_2601 "TPR domain/SEC-C motif domain protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TAIR|locus:2103025 SEC "secret agent" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
WB|WBGene00003858 ogt-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|O18158 ogt-1 "UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-051128-1 ogt.2 "O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase) 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|62060 Ogt "O-linked N-acetylglucosamine (GlcNAc) transferase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1339639 Ogt "O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-9631 ogt.1 "O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase) 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O82422SPY_HORVU2, ., 4, ., 1, ., -0.84160.90970.6620N/Ano
O82039SPY_PETHY2, ., 4, ., 1, ., -0.88070.97670.7199N/Ano
Q8LP10SPY_EUSER2, ., 4, ., 1, ., -0.84020.91550.6851N/Ano
Q96301SPY_ARATH2, ., 4, ., 1, ., -0.85090.96940.7286yesno
Q6YZI0SPY_ORYSJ2, ., 4, ., 1, ., -0.80150.94750.7022yesno
Q8RVB2SPY_SOLLC2, ., 4, ., 1, ., -0.87180.97670.7207N/Ano

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
gw1.XVI.2407.1
hypothetical protein (905 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query687
COG3914 620 COG3914, Spy, Predicted O-linked N-acetylglucosami 7e-46
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 6e-23
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 4e-22
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 9e-21
pfam13844 468 pfam13844, Glyco_transf_41, Glycosyl transferase f 9e-21
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 1e-20
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 5e-20
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 7e-20
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 3e-19
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 1e-18
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 2e-17
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 7e-17
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 2e-15
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 3e-14
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 6e-14
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 9e-14
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 1e-13
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 2e-13
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 1e-11
pfam1341469 pfam13414, TPR_11, TPR repeat 5e-11
pfam1341469 pfam13414, TPR_11, TPR repeat 6e-11
pfam1341469 pfam13414, TPR_11, TPR repeat 1e-10
COG3063250 COG3063, PilF, Tfp pilus assembly protein PilF [Ce 3e-10
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 3e-10
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 4e-10
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 4e-10
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 5e-10
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 3e-09
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 3e-09
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 5e-09
PRK02603172 PRK02603, PRK02603, photosystem I assembly protein 1e-08
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 2e-08
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 5e-08
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 6e-08
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 6e-08
pfam1341469 pfam13414, TPR_11, TPR repeat 9e-08
pfam1341469 pfam13414, TPR_11, TPR repeat 1e-07
PRK02603172 PRK02603, PRK02603, photosystem I assembly protein 3e-07
pfam1341469 pfam13414, TPR_11, TPR repeat 5e-07
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 5e-07
COG3063250 COG3063, PilF, Tfp pilus assembly protein PilF [Ce 6e-07
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 7e-07
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 9e-07
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 1e-06
CHL00033168 CHL00033, ycf3, photosystem I assembly protein Ycf 1e-06
smart0002834 smart00028, TPR, Tetratricopeptide repeats 2e-06
PRK12370553 PRK12370, PRK12370, invasion protein regulator; Pr 2e-06
smart0002834 smart00028, TPR, Tetratricopeptide repeats 3e-06
COG3063250 COG3063, PilF, Tfp pilus assembly protein PilF [Ce 4e-06
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 5e-06
COG5010257 COG5010, TadD, Flp pilus assembly protein TadD, co 7e-06
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 8e-06
COG5010257 COG5010, TadD, Flp pilus assembly protein TadD, co 9e-06
COG4785297 COG4785, NlpI, Lipoprotein NlpI, contains TPR repe 1e-05
TIGR00990615 TIGR00990, 3a0801s09, mitochondrial precursor prot 1e-05
COG3063250 COG3063, PilF, Tfp pilus assembly protein PilF [Ce 2e-05
smart0002834 smart00028, TPR, Tetratricopeptide repeats 2e-05
COG3063250 COG3063, PilF, Tfp pilus assembly protein PilF [Ce 3e-05
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 5e-05
pfam1318134 pfam13181, TPR_8, Tetratricopeptide repeat 5e-05
COG0790292 COG0790, COG0790, FOG: TPR repeat, SEL1 subfamily 7e-05
COG4976287 COG4976, COG4976, Predicted methyltransferase (con 8e-05
COG5010257 COG5010, TadD, Flp pilus assembly protein TadD, co 1e-04
TIGR00990615 TIGR00990, 3a0801s09, mitochondrial precursor prot 1e-04
TIGR03939 800 TIGR03939, PGA_TPR_OMP, poly-beta-1,6 N-acetyl-D-g 1e-04
pfam1343134 pfam13431, TPR_17, Tetratricopeptide repeat 1e-04
COG2956389 COG2956, COG2956, Predicted N-acetylglucosaminyl t 1e-04
pfam1341469 pfam13414, TPR_11, TPR repeat 2e-04
pfam1341469 pfam13414, TPR_11, TPR repeat 2e-04
pfam1318134 pfam13181, TPR_8, Tetratricopeptide repeat 2e-04
COG2956389 COG2956, COG2956, Predicted N-acetylglucosaminyl t 2e-04
pfam0771934 pfam07719, TPR_2, Tetratricopeptide repeat 2e-04
pfam10373276 pfam10373, EST1_DNA_bind, Est1 DNA/RNA binding dom 2e-04
PRK11189296 PRK11189, PRK11189, lipoprotein NlpI; Provisional 2e-04
PRK02603172 PRK02603, PRK02603, photosystem I assembly protein 3e-04
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 3e-04
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 3e-04
COG3063250 COG3063, PilF, Tfp pilus assembly protein PilF [Ce 4e-04
COG4785297 COG4785, NlpI, Lipoprotein NlpI, contains TPR repe 4e-04
pfam1343134 pfam13431, TPR_17, Tetratricopeptide repeat 4e-04
pfam0771934 pfam07719, TPR_2, Tetratricopeptide repeat 6e-04
PRK11447 1157 PRK11447, PRK11447, cellulose synthase subunit Bcs 7e-04
pfam1341469 pfam13414, TPR_11, TPR repeat 0.001
pfam1341469 pfam13414, TPR_11, TPR repeat 0.001
CHL00033168 CHL00033, ycf3, photosystem I assembly protein Ycf 0.001
pfam0771934 pfam07719, TPR_2, Tetratricopeptide repeat 0.001
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 0.002
pfam1318134 pfam13181, TPR_8, Tetratricopeptide repeat 0.002
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 0.003
COG4783484 COG4783, COG4783, Putative Zn-dependent protease, 0.003
COG4235287 COG4235, COG4235, Cytochrome c biogenesis factor [ 0.003
smart0002834 smart00028, TPR, Tetratricopeptide repeats 0.004
COG4783484 COG4783, COG4783, Putative Zn-dependent protease, 0.004
>gnl|CDD|226428 COG3914, Spy, Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
 Score =  172 bits (438), Expect = 7e-46
 Identities = 100/383 (26%), Positives = 153/383 (39%), Gaps = 54/383 (14%)

Query: 317 DMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECY-QMALSIKPNFSQSLNNLG 375
            +A +   +    NP    A  NL    +       A+    ++A  + P+ ++ L +L 
Sbjct: 84  TLAFLAKRIPLSVNPENCPAVQNLAAALELDGLQFLALADISEIAEWLSPDNAEFLGHLI 143

Query: 376 VVYTVQ------GKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISL--------- 420
             Y +       G+   A   +E+A+   P Y      L    ++  S            
Sbjct: 144 RFYQLGRYLKLLGRTAEAELALERAVDLLPKYPRVLGALMTARQEQCSWPEEAPTNLLSQ 203

Query: 421 ------AIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHDDKLFEAHRDWGKRFMRLYSQ 474
                         L  DP    A  N+LL +   N     +                  
Sbjct: 204 LALFLGIYGFSLAYLADDPLKNLAIANQLLKILSQNAPELVR------------------ 245

Query: 475 YTSWDNTKDPE-RPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYS-AVVKADAK 532
           +   D       + L +GY+S D  +H+V + +     YHD   ++V  YS      DA 
Sbjct: 246 FPIRDENIKRNGKRLRVGYLSSDLRSHAVGFLLRWVFEYHDRDKFEVFAYSLGPPHTDAL 305

Query: 533 TIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPV 592
             R    V K    W  I  +D+ ++A  +R D IDILV+L GHT + +  + A +PAP+
Sbjct: 306 QERISAAVEK----WYPIGRMDDAEIANAIRTDGIDILVDLDGHTVDTRCQVFAHRPAPI 361

Query: 593 QVTWIGYPNTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTPSPEAGPVCPT 652
           QV+W+GYP TTG P +DY I+D    PP  ++ + E+L RLP    CY P     PV P 
Sbjct: 362 QVSWLGYPATTGSPNMDYFISDPYTVPPTAEEYYSEKLWRLP---QCYQPVDGFEPVTPP 418

Query: 653 PA-----LTNGFITFGSFNNLAK 670
           P+     L    + F  FNN  K
Sbjct: 419 PSRAQLGLPEDAVVFCCFNNYFK 441


Length = 620

>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|206015 pfam13844, Glyco_transf_41, Glycosyl transferase family 41 Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|225605 COG3063, PilF, Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|179448 PRK02603, PRK02603, photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|179448 PRK02603, PRK02603, photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|225605 COG3063, PilF, Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|176974 CHL00033, ycf3, photosystem I assembly protein Ycf3 Back     alignment and domain information
>gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats Back     alignment and domain information
>gnl|CDD|237080 PRK12370, PRK12370, invasion protein regulator; Provisional Back     alignment and domain information
>gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats Back     alignment and domain information
>gnl|CDD|225605 COG3063, PilF, Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|227343 COG5010, TadD, Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|227343 COG5010, TadD, Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|227124 COG4785, NlpI, Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|225605 COG3063, PilF, Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats Back     alignment and domain information
>gnl|CDD|225605 COG3063, PilF, Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205362 pfam13181, TPR_8, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|223861 COG0790, COG0790, FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>gnl|CDD|227310 COG4976, COG4976, Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>gnl|CDD|227343 COG5010, TadD, Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|234406 TIGR03939, PGA_TPR_OMP, poly-beta-1,6 N-acetyl-D-glucosamine export porin PgaA Back     alignment and domain information
>gnl|CDD|205609 pfam13431, TPR_17, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|225504 COG2956, COG2956, Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|205362 pfam13181, TPR_8, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|225504 COG2956, COG2956, Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|191825 pfam07719, TPR_2, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|220721 pfam10373, EST1_DNA_bind, Est1 DNA/RNA binding domain Back     alignment and domain information
>gnl|CDD|236875 PRK11189, PRK11189, lipoprotein NlpI; Provisional Back     alignment and domain information
>gnl|CDD|179448 PRK02603, PRK02603, photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|225605 COG3063, PilF, Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|227124 COG4785, NlpI, Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>gnl|CDD|205609 pfam13431, TPR_17, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|191825 pfam07719, TPR_2, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|183140 PRK11447, PRK11447, cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|176974 CHL00033, ycf3, photosystem I assembly protein Ycf3 Back     alignment and domain information
>gnl|CDD|191825 pfam07719, TPR_2, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205362 pfam13181, TPR_8, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|227122 COG4783, COG4783, Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>gnl|CDD|226687 COG4235, COG4235, Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats Back     alignment and domain information
>gnl|CDD|227122 COG4783, COG4783, Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 687
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 100.0
PF13844 468 Glyco_transf_41: Glycosyl transferase family 41; P 100.0
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
PRK15174656 Vi polysaccharide export protein VexE; Provisional 100.0
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 100.0
PRK15174656 Vi polysaccharide export protein VexE; Provisional 100.0
KOG0547606 consensus Translocase of outer mitochondrial membr 100.0
PRK10049765 pgaA outer membrane protein PgaA; Provisional 100.0
PRK10049765 pgaA outer membrane protein PgaA; Provisional 100.0
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.98
KOG20021018 consensus TPR-containing nuclear phosphoprotein th 99.97
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.97
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.97
PRK09782987 bacteriophage N4 receptor, outer membrane subunit; 99.96
KOG1126638 consensus DNA-binding cell division cycle control 99.96
KOG0547606 consensus Translocase of outer mitochondrial membr 99.96
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.96
PRK14574822 hmsH outer membrane protein; Provisional 99.96
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.96
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.95
KOG1126638 consensus DNA-binding cell division cycle control 99.95
KOG2076895 consensus RNA polymerase III transcription factor 99.95
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.95
PRK11788389 tetratricopeptide repeat protein; Provisional 99.95
PRK11788389 tetratricopeptide repeat protein; Provisional 99.94
KOG2003840 consensus TPR repeat-containing protein [General f 99.94
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.94
PRK14574822 hmsH outer membrane protein; Provisional 99.94
KOG2003840 consensus TPR repeat-containing protein [General f 99.93
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.93
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.93
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.93
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.92
KOG2076 895 consensus RNA polymerase III transcription factor 99.92
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.92
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.91
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.89
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.89
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.89
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.89
KOG1129478 consensus TPR repeat-containing protein [General f 99.88
PLN032181060 maturation of RBCL 1; Provisional 99.88
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.88
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.88
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.87
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 99.87
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.87
PRK12370553 invasion protein regulator; Provisional 99.87
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 99.86
PLN032181060 maturation of RBCL 1; Provisional 99.86
KOG1125579 consensus TPR repeat-containing protein [General f 99.86
PRK12370553 invasion protein regulator; Provisional 99.86
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.86
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.86
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 99.86
KOG1129478 consensus TPR repeat-containing protein [General f 99.86
PLN03077857 Protein ECB2; Provisional 99.86
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.85
KOG1125579 consensus TPR repeat-containing protein [General f 99.85
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.85
PRK11189296 lipoprotein NlpI; Provisional 99.83
PRK11189296 lipoprotein NlpI; Provisional 99.83
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 99.82
KOG2376652 consensus Signal recognition particle, subunit Srp 99.82
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.82
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.82
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.82
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.82
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.82
PLN03077857 Protein ECB2; Provisional 99.81
KOG1915677 consensus Cell cycle control protein (crooked neck 99.81
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.81
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.8
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.8
PLN02789320 farnesyltranstransferase 99.79
PLN02789320 farnesyltranstransferase 99.77
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.76
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.75
KOG1915677 consensus Cell cycle control protein (crooked neck 99.75
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.74
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.71
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.7
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.69
KOG2376652 consensus Signal recognition particle, subunit Srp 99.68
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.67
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.67
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 99.65
PRK04841903 transcriptional regulator MalT; Provisional 99.63
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.63
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.63
PRK15359144 type III secretion system chaperone protein SscB; 99.63
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.62
PRK15359144 type III secretion system chaperone protein SscB; 99.62
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.61
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 99.6
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.59
PRK10370198 formate-dependent nitrite reductase complex subuni 99.58
PRK04841903 transcriptional regulator MalT; Provisional 99.56
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.55
PRK10370198 formate-dependent nitrite reductase complex subuni 99.54
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.54
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.54
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.53
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.53
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.52
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.5
KOG1128777 consensus Uncharacterized conserved protein, conta 99.49
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.48
KOG0553304 consensus TPR repeat-containing protein [General f 99.45
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 99.45
KOG1128777 consensus Uncharacterized conserved protein, conta 99.44
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.43
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.42
KOG0553304 consensus TPR repeat-containing protein [General f 99.39
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.38
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.38
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.37
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.31
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.3
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 99.27
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.26
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.26
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.23
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.22
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.22
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.2
COG3898531 Uncharacterized membrane-bound protein [Function u 99.16
KOG1941518 consensus Acetylcholine receptor-associated protei 99.16
KOG1941518 consensus Acetylcholine receptor-associated protei 99.15
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.14
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.12
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 99.12
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 99.1
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 99.1
COG4235287 Cytochrome c biogenesis factor [Posttranslational 99.1
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.09
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 99.08
CHL00033168 ycf3 photosystem I assembly protein Ycf3 99.07
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 99.06
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.06
CHL00033168 ycf3 photosystem I assembly protein Ycf3 99.05
cd00189100 TPR Tetratricopeptide repeat domain; typically con 99.04
COG4235287 Cytochrome c biogenesis factor [Posttranslational 99.04
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.02
KOG4648536 consensus Uncharacterized conserved protein, conta 99.02
PRK10803263 tol-pal system protein YbgF; Provisional 99.01
KOG2300629 consensus Uncharacterized conserved protein [Funct 99.0
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.0
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.99
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.99
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.99
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.98
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.97
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.97
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.96
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.96
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.95
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.95
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.94
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.94
PRK15331165 chaperone protein SicA; Provisional 98.93
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.93
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.93
PRK15331165 chaperone protein SicA; Provisional 98.93
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.92
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.91
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 98.9
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.89
PRK11906458 transcriptional regulator; Provisional 98.89
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.89
KOG2300629 consensus Uncharacterized conserved protein [Funct 98.89
PRK11906458 transcriptional regulator; Provisional 98.89
COG3898531 Uncharacterized membrane-bound protein [Function u 98.88
PRK10803263 tol-pal system protein YbgF; Provisional 98.88
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.86
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.86
KOG4648536 consensus Uncharacterized conserved protein, conta 98.85
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.85
KOG2471696 consensus TPR repeat-containing protein [General f 98.8
KOG2471696 consensus TPR repeat-containing protein [General f 98.79
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.79
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.76
PF13512142 TPR_18: Tetratricopeptide repeat 98.75
KOG4234271 consensus TPR repeat-containing protein [General f 98.74
PF12688120 TPR_5: Tetratrico peptide repeat 98.74
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.74
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.72
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.72
KOG4234271 consensus TPR repeat-containing protein [General f 98.7
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.7
PF12688120 TPR_5: Tetratrico peptide repeat 98.69
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.67
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.63
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.63
COG4700251 Uncharacterized protein conserved in bacteria cont 98.61
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 98.59
PF1337173 TPR_9: Tetratricopeptide repeat 98.57
PF1337173 TPR_9: Tetratricopeptide repeat 98.56
KOG1586288 consensus Protein required for fusion of vesicles 98.51
PF13512142 TPR_18: Tetratricopeptide repeat 98.51
KOG4555175 consensus TPR repeat-containing protein [Function 98.49
KOG2796366 consensus Uncharacterized conserved protein [Funct 98.49
KOG2796366 consensus Uncharacterized conserved protein [Funct 98.48
KOG1586288 consensus Protein required for fusion of vesicles 98.46
KOG4507886 consensus Uncharacterized conserved protein, conta 98.45
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.44
COG4700251 Uncharacterized protein conserved in bacteria cont 98.44
KOG4555175 consensus TPR repeat-containing protein [Function 98.44
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.37
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.35
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.35
KOG1585308 consensus Protein required for fusion of vesicles 98.35
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 98.34
KOG1585308 consensus Protein required for fusion of vesicles 98.3
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.3
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.28
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 98.25
KOG1258577 consensus mRNA processing protein [RNA processing 98.24
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.21
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 98.2
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 98.17
KOG4507886 consensus Uncharacterized conserved protein, conta 98.15
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 98.13
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 98.11
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 98.1
PF13281374 DUF4071: Domain of unknown function (DUF4071) 98.09
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 98.08
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 98.07
KOG2610491 consensus Uncharacterized conserved protein [Funct 98.06
KOG2610491 consensus Uncharacterized conserved protein [Funct 98.05
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 98.04
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 98.04
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 98.04
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 98.04
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 98.03
KOG1550552 consensus Extracellular protein SEL-1 and related 98.01
KOG09851666 consensus Vesicle coat protein clathrin, heavy cha 97.97
PF1342844 TPR_14: Tetratricopeptide repeat 97.96
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 97.96
KOG1550552 consensus Extracellular protein SEL-1 and related 97.92
PF1342844 TPR_14: Tetratricopeptide repeat 97.9
KOG0376476 consensus Serine-threonine phosphatase 2A, catalyt 97.9
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 97.87
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.85
KOG09851666 consensus Vesicle coat protein clathrin, heavy cha 97.85
PF1343134 TPR_17: Tetratricopeptide repeat 97.83
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 97.82
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.82
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 97.81
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 97.81
PF1343134 TPR_17: Tetratricopeptide repeat 97.77
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.77
KOG0530318 consensus Protein farnesyltransferase, alpha subun 97.77
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.75
KOG0376476 consensus Serine-threonine phosphatase 2A, catalyt 97.74
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.73
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 97.72
KOG0530318 consensus Protein farnesyltransferase, alpha subun 97.72
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.7
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 97.68
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 97.62
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 97.61
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 97.56
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.47
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.47
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.43
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.42
PRK15180831 Vi polysaccharide biosynthesis protein TviD; Provi 97.39
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.39
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 97.37
KOG1258577 consensus mRNA processing protein [RNA processing 97.36
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 97.35
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 97.35
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 97.34
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.32
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 97.3
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 97.28
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.23
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.18
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 97.17
KOG20411189 consensus WD40 repeat protein [General function pr 97.14
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 97.11
COG5159421 RPN6 26S proteasome regulatory complex component [ 97.02
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 96.97
KOG3783546 consensus Uncharacterized conserved protein [Funct 96.95
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 96.88
KOG3824472 consensus Huntingtin interacting protein HYPE [Gen 96.81
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 96.8
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.79
KOG1463411 consensus 26S proteasome regulatory complex, subun 96.78
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.75
KOG3824472 consensus Huntingtin interacting protein HYPE [Gen 96.74
PRK11619644 lytic murein transglycosylase; Provisional 96.73
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 96.71
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 96.66
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 96.65
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 96.59
KOG20411189 consensus WD40 repeat protein [General function pr 96.52
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 96.4
PRK11619644 lytic murein transglycosylase; Provisional 96.3
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 96.25
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 96.23
KOG3783546 consensus Uncharacterized conserved protein [Funct 96.21
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 96.2
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 96.17
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.16
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 96.07
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 96.03
KOG15381081 consensus Uncharacterized conserved protein WDR10, 96.01
PRK10941269 hypothetical protein; Provisional 96.0
PF09986214 DUF2225: Uncharacterized protein conserved in bact 95.98
PRK10941269 hypothetical protein; Provisional 95.95
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 95.94
COG5159421 RPN6 26S proteasome regulatory complex component [ 95.91
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 95.9
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 95.88
COG4976287 Predicted methyltransferase (contains TPR repeat) 95.87
KOG1463411 consensus 26S proteasome regulatory complex, subun 95.85
KOG15381081 consensus Uncharacterized conserved protein WDR10, 95.82
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 95.76
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 95.7
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 95.53
COG4649221 Uncharacterized protein conserved in bacteria [Fun 95.43
COG1747 711 Uncharacterized N-terminal domain of the transcrip 95.33
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 95.19
COG4649221 Uncharacterized protein conserved in bacteria [Fun 95.18
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 95.1
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 95.07
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 95.01
KOG3364149 consensus Membrane protein involved in organellar 94.94
PF09986214 DUF2225: Uncharacterized protein conserved in bact 94.91
KOG1310758 consensus WD40 repeat protein [General function pr 94.89
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 94.85
KOG1310758 consensus WD40 repeat protein [General function pr 94.49
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 94.49
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 94.44
COG4976287 Predicted methyltransferase (contains TPR repeat) 94.37
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 94.34
KOG4814872 consensus Uncharacterized conserved protein [Funct 94.31
KOG3364149 consensus Membrane protein involved in organellar 94.3
COG1747 711 Uncharacterized N-terminal domain of the transcrip 93.75
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 93.73
KOG4814872 consensus Uncharacterized conserved protein [Funct 93.58
KOG0529421 consensus Protein geranylgeranyltransferase type I 93.56
KOG3807556 consensus Predicted membrane protein ST7 (tumor su 93.54
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 93.21
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 92.91
KOG2422665 consensus Uncharacterized conserved protein [Funct 92.87
COG5191435 Uncharacterized conserved protein, contains HAT (H 92.74
KOG0529421 consensus Protein geranylgeranyltransferase type I 92.56
KOG2422665 consensus Uncharacterized conserved protein [Funct 92.46
COG3629280 DnrI DNA-binding transcriptional activator of the 92.42
KOG2063877 consensus Vacuolar assembly/sorting proteins VPS39 92.06
PF15015569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 92.04
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 92.0
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 91.74
COG2912269 Uncharacterized conserved protein [Function unknow 91.72
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 91.68
COG5191435 Uncharacterized conserved protein, contains HAT (H 91.62
PF09670379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 91.36
KOG2581493 consensus 26S proteasome regulatory complex, subun 91.24
PF1286294 Apc5: Anaphase-promoting complex subunit 5 91.23
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 90.5
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 90.3
COG2912269 Uncharacterized conserved protein [Function unknow 90.07
COG3629280 DnrI DNA-binding transcriptional activator of the 90.03
KOG3807556 consensus Predicted membrane protein ST7 (tumor su 89.53
PF00244236 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 89.52
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 89.42
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 89.2
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 88.93
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 88.28
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 88.17
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 88.13
PF04348 536 LppC: LppC putative lipoprotein; InterPro: IPR0074 88.06
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 88.0
KOG2063877 consensus Vacuolar assembly/sorting proteins VPS39 87.98
PF1286294 Apc5: Anaphase-promoting complex subunit 5 87.97
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 87.94
PF15015569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 87.83
COG4941415 Predicted RNA polymerase sigma factor containing a 87.7
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 87.28
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 86.91
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 86.74
PF12739414 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 86.72
smart00299140 CLH Clathrin heavy chain repeat homology. 86.69
COG4455273 ImpE Protein of avirulence locus involved in tempe 86.65
PF12739414 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 86.1
KOG0889 3550 consensus Histone acetyltransferase SAGA, TRRAP/TR 85.75
PF14863141 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB 85.56
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 85.2
COG4941415 Predicted RNA polymerase sigma factor containing a 84.77
PF10373278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 84.15
PF00244236 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 83.65
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 83.58
COG3947361 Response regulator containing CheY-like receiver a 82.94
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 82.75
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 82.38
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 82.15
PF10373278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 81.89
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 81.49
COG3947361 Response regulator containing CheY-like receiver a 81.45
KOG0546372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 81.32
KOG2581493 consensus 26S proteasome regulatory complex, subun 80.58
cd03811 353 GT1_WabH_like This family is most closely related 80.48
KOG0546372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 80.27
PF09670379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 80.11
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=2.3e-122  Score=896.62  Aligned_cols=657  Identities=37%  Similarity=0.537  Sum_probs=607.8

Q ss_pred             CCCCCCCccCCCccCCCCCCCCCCCCCcccccccccCchHhHHHHHHHHHhCCCHHHHHHHHHHHHHhCCCCHHHHHhHH
Q 005626           10 NGRERDPVQDNGFLKGPQSLPGTSGSPVAVGSTLKGFEGKDALSYANILRSRNKFVDALALYEIVLEKDSGNVEAHIGKG   89 (687)
Q Consensus        10 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~g~~~~A~~~~~~~l~~~p~~~~~~~~la   89 (687)
                      ..++...+...+|..+...+.+...+..+  ....+.-.+.+-.+|+++..+|++++|+.+|+.++++.|++.++|.++|
T Consensus        80 t~~~~llll~ai~~q~~r~d~s~a~~~~a--~r~~~q~ae~ysn~aN~~kerg~~~~al~~y~~aiel~p~fida~inla  157 (966)
T KOG4626|consen   80 TNTERLLLLSAIFFQGSRLDKSSAGSLLA--IRKNPQGAEAYSNLANILKERGQLQDALALYRAAIELKPKFIDAYINLA  157 (966)
T ss_pred             Ccccceeeehhhhhcccchhhhhhhhhhh--hhccchHHHHHHHHHHHHHHhchHHHHHHHHHHHHhcCchhhHHHhhHH
Confidence            34455556666666665555444433322  2333456777888999999999999999999999999999999999999


Q ss_pred             HHHHHhCChHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHhHHHHHH
Q 005626           90 ICLQMQNMGRLAFDSFSEAVKLDPQNACAHTHCGILYKDEGRLVEAAESYHKALSADPSYKPAAECLAIVLTDLGTSLKL  169 (687)
Q Consensus        90 ~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~la~~~~~lg~~~~~  169 (687)
                      .++...|+.+.|.++|.++++++|....+...+|..+...|+..+|..+|.++++..|...-       +|.++|..+..
T Consensus       158 ~al~~~~~~~~a~~~~~~alqlnP~l~ca~s~lgnLlka~Grl~ea~~cYlkAi~~qp~fAi-------awsnLg~~f~~  230 (966)
T KOG4626|consen  158 AALVTQGDLELAVQCFFEALQLNPDLYCARSDLGNLLKAEGRLEEAKACYLKAIETQPCFAI-------AWSNLGCVFNA  230 (966)
T ss_pred             HHHHhcCCCcccHHHHHHHHhcCcchhhhhcchhHHHHhhcccchhHHHHHHHHhhCCceee-------eehhcchHHhh
Confidence            99999999999999999999999999999999999999999999999999999999997544       48889999999


Q ss_pred             cCChHHHHHHHHHHHhhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHH
Q 005626          170 AGNTQDGIQKYYEALKIDPHYAPAYYNLGVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRGDLESAIACYE  249 (687)
Q Consensus       170 ~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~  249 (687)
                      +|+...|+..|+++++++|+..++|++||.+|.+.+.+++|+.+|.+++...|+++.++.++|.+|..+|..+-|+..|+
T Consensus       231 ~Gei~~aiq~y~eAvkldP~f~dAYiNLGnV~ke~~~~d~Avs~Y~rAl~lrpn~A~a~gNla~iYyeqG~ldlAI~~Yk  310 (966)
T KOG4626|consen  231 QGEIWLAIQHYEEAVKLDPNFLDAYINLGNVYKEARIFDRAVSCYLRALNLRPNHAVAHGNLACIYYEQGLLDLAIDTYK  310 (966)
T ss_pred             cchHHHHHHHHHHhhcCCCcchHHHhhHHHHHHHHhcchHHHHHHHHHHhcCCcchhhccceEEEEeccccHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhcCCCcHHHHHHHHHHHHHhchhhhhcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHhh
Q 005626          250 RCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFDMAIVFYELAFHF  329 (687)
Q Consensus       250 ~al~~~~~~~~~~~~l~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~  329 (687)
                      +++++.|+.++++.+++.++..+       |+..+|..+|.+++.+.|.++++.++||.++.++|++++|..+|.++++.
T Consensus       311 ral~~~P~F~~Ay~NlanALkd~-------G~V~ea~~cYnkaL~l~p~hadam~NLgni~~E~~~~e~A~~ly~~al~v  383 (966)
T KOG4626|consen  311 RALELQPNFPDAYNNLANALKDK-------GSVTEAVDCYNKALRLCPNHADAMNNLGNIYREQGKIEEATRLYLKALEV  383 (966)
T ss_pred             HHHhcCCCchHHHhHHHHHHHhc-------cchHHHHHHHHHHHHhCCccHHHHHHHHHHHHHhccchHHHHHHHHHHhh
Confidence            99999999999999888888875       69999999999999999999999999999999999999999999999999


Q ss_pred             CCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCcHHHHHHHH
Q 005626          330 NPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLG  409 (687)
Q Consensus       330 ~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la  409 (687)
                      .|..+.++.+||.+|.++|++++|+.+|++++.+.|..++++.++|..|..+|+.+.|+..|.+++.++|..++++.+||
T Consensus       384 ~p~~aaa~nNLa~i~kqqgnl~~Ai~~YkealrI~P~fAda~~NmGnt~ke~g~v~~A~q~y~rAI~~nPt~AeAhsNLa  463 (966)
T KOG4626|consen  384 FPEFAAAHNNLASIYKQQGNLDDAIMCYKEALRIKPTFADALSNMGNTYKEMGDVSAAIQCYTRAIQINPTFAEAHSNLA  463 (966)
T ss_pred             ChhhhhhhhhHHHHHHhcccHHHHHHHHHHHHhcCchHHHHHHhcchHHHHhhhHHHHHHHHHHHHhcCcHHHHHHhhHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHcCCHHHHHHHHHHHHhcCCCChhhhhhHHHHhhhccCCCh-----HHHHHHHHHHHH--HHhhh-----------
Q 005626          410 VLYRDAGSISLAIDAYEQCLKIDPDSRNAGQNRLLAMNYINEGHD-----DKLFEAHRDWGK--RFMRL-----------  471 (687)
Q Consensus       410 ~~~~~~g~~~~A~~~~~~al~~~p~~~~a~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~--~~~~~-----------  471 (687)
                      .+|...|+..+|+..|+.+|+++||.+++..|++.++.+++.|.+     .++.+.+++|..  ++...           
T Consensus       464 si~kDsGni~~AI~sY~~aLklkPDfpdA~cNllh~lq~vcdw~D~d~~~~kl~sivrdql~~~rlpsvhP~hsm~ypl~  543 (966)
T KOG4626|consen  464 SIYKDSGNIPEAIQSYRTALKLKPDFPDAYCNLLHCLQIVCDWTDYDKRMKKLVSIVRDQLEKNRLPSVHPHHSMLYPLS  543 (966)
T ss_pred             HHhhccCCcHHHHHHHHHHHccCCCCchhhhHHHHHHHHHhcccchHHHHHHHHHHHHHHHhhhcCCccCcccccccccc
Confidence            999999999999999999999999999999999999999999987     788888888884  33221           


Q ss_pred             -----------------------ccCcCCCCCCCCCCCCeEEEEecCCcccchHHHHHHhhccccCCCceEEEEEecCCC
Q 005626          472 -----------------------YSQYTSWDNTKDPERPLVIGYVSPDYFTHSVSYFIEAPLVYHDYQNYKVVVYSAVVK  528 (687)
Q Consensus       472 -----------------------~~~~~~~~~~~~~~~~lriGy~S~df~~h~v~~~~~~~~~~~d~~~fev~~y~~~~~  528 (687)
                                             .+|+..|.+-+.+++||||||||+||.+||++|||+.++.+|||++||||||+.++.
T Consensus       544 ~~~~~aia~k~a~~c~~~~~~~~k~pyth~~~l~~~~~rlrIGYvSsDFgnHp~Shlmqsv~gmHdr~kveVfcYals~~  623 (966)
T KOG4626|consen  544 HILRKAIAAKHANLCLDKVHVLGKPPYTHPDNLKVKEGRLRIGYVSSDFGNHPTSHLMQSVPGMHDRSKVEVFCYALSVN  623 (966)
T ss_pred             hHHHHHHHHHHhhhhHHHHHhccCCCCCChhhCCCCcCceEEEeecccccCCchHHHhccCcCcCCccceEEEEEEeecC
Confidence                                   134556667777889999999999999999999999999999999999999998775


Q ss_pred             CChHhHHHHHHhhhcCCceEeCCCCCHHHHHHHHHhCCCcEEEecCCCCCCCcchhhccCCCceEEecccCCCCCCCCCc
Q 005626          529 ADAKTIRFREKVMKKGGIWRDIYGIDEKKVAAMVREDKIDILVELTGHTANNKLGMMACQPAPVQVTWIGYPNTTGLPTI  608 (687)
Q Consensus       529 ~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~i~~d~idilvdl~g~t~~~r~~~~a~r~APvq~~~lG~p~t~g~~~~  608 (687)
                      ++..   ||..+.++++||+|+++++...+|..|++|+|||||+|+|||.|+|.++||+|||||||+|+|||||||+++|
T Consensus       624 d~t~---fR~kv~~e~ehf~Dls~i~~~kiA~~I~qD~I~ILvnlnGyTkgarneifAlrPAPIQv~wlGyPgTtGa~~m  700 (966)
T KOG4626|consen  624 DGTN---FRDKVMKEAEHFVDLSQIPCNKIADKIRQDKIHILVNLNGYTKGARNEIFALRPAPIQVMWLGYPGTTGATFM  700 (966)
T ss_pred             CCch---HHHHHHhhccceeehhcCChHHHHHHHhhcCceEEEeccccccccccceeeccCCceeEEeecCCCCCCCcee
Confidence            4432   7888888899999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cEEEecCCCCCcccccccccceeecCCCccccCCCC--------CCCCCCCCCCCCCCCeEEEecCCCCCCCHHHHHHHh
Q 005626          609 DYRITDSLADPPETKQKHVEELIRLPECFLCYTPSP--------EAGPVCPTPALTNGFITFGSFNNLAKVLVRSYLCLD  680 (687)
Q Consensus       609 Dy~i~d~~~~p~~~~~~~~E~l~~lp~~~~~~~~~~--------~~~~~~~~~~~~~~~~~f~~fn~~~k~~~~~~~~w~  680 (687)
                      ||+|+|.++.|++....|||||++|||||+|+++..        ...|+++.++|++|+|||||||+++||+|.|+.+|.
T Consensus       701 DYiITDs~tsPl~~a~~ysEkLv~lPh~ffi~d~~qk~~~~~dpn~kP~r~~y~Lp~d~vvf~~FNqLyKidP~~l~~W~  780 (966)
T KOG4626|consen  701 DYIITDSVTSPLELAQQYSEKLVYLPHCFFIGDHKQKNQDVLDPNNKPTRSQYGLPEDAVVFCNFNQLYKIDPSTLQMWA  780 (966)
T ss_pred             eEEeecccCChHHHHHHHHHHHhhCCceEEecCcccccccccCCCCCCCCCCCCCCCCeEEEeechhhhcCCHHHHHHHH
Confidence            999999999999999999999999999999999866        455678889999999999999999999999999999


Q ss_pred             hhhhc
Q 005626          681 KCSTC  685 (687)
Q Consensus       681 ~~~~~  685 (687)
                      +||..
T Consensus       781 ~ILk~  785 (966)
T KOG4626|consen  781 NILKR  785 (966)
T ss_pred             HHHHh
Confidence            99864



>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13844 Glyco_transf_41: Glycosyl transferase family 41; PDB: 3PE4_C 3PE3_D 3TAX_C 2XGO_A 2JLB_B 2XGM_A 2VSY_B 2XGS_B 2VSN_A Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG2063 consensus Vacuolar assembly/sorting proteins VPS39/VAM6/VPS3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF04348 LppC: LppC putative lipoprotein; InterPro: IPR007443 This entry includes several bacterial outer membrane antigens, whose molecular function is unknown Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>KOG2063 consensus Vacuolar assembly/sorting proteins VPS39/VAM6/VPS3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>PF12739 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 85 kDa subunit; InterPro: IPR024420 This entry represents Trs85, a subunit of the TRAPP III complex [] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PF12739 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 85 kDa subunit; InterPro: IPR024420 This entry represents Trs85, a subunit of the TRAPP III complex [] Back     alignment and domain information
>KOG0889 consensus Histone acetyltransferase SAGA, TRRAP/TRA1 component, PI-3 kinase superfamily [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription] Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03811 GT1_WabH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query687
1w3b_A388 The Superhelical Tpr Domain Of O-Linked Glcnac Tran 2e-32
1w3b_A388 The Superhelical Tpr Domain Of O-Linked Glcnac Tran 2e-14
3pe3_A 723 Structure Of Human O-Glcnac Transferase And Its Com 3e-28
2fo7_A136 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 8e-19
2fo7_A136 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 2e-18
2fo7_A136 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 2e-11
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 4e-16
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 2e-13
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 5e-12
2wqh_A125 Crystal Structure Of Ctpr3y3 Length = 125 9e-15
2wqh_A125 Crystal Structure Of Ctpr3y3 Length = 125 9e-11
3kd7_A125 Designed Tpr Module (Ctpr390) In Complex With Its P 6e-13
3kd7_A125 Designed Tpr Module (Ctpr390) In Complex With Its P 6e-10
2vsn_A 568 Structure And Topological Arrangement Of An O-Glcna 2e-12
2vsy_A 568 Xanthomonas Campestris Putative Ogt (Xcc0866), Apos 2e-12
1na3_A91 Design Of Stable Alpha-Helical Arrays From An Ideal 3e-11
3vtx_A184 Crystal Structure Of Mama Protein Length = 184 5e-10
3vtx_A184 Crystal Structure Of Mama Protein Length = 184 3e-04
2avp_A70 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 1e-08
3r9a_B328 Human Alanine-Glyoxylate Aminotransferase In Comple 3e-08
3r9a_B328 Human Alanine-Glyoxylate Aminotransferase In Comple 1e-06
4eqf_A365 Trip8b-1a#206-567 Interacting With The Carboxy-Term 4e-08
2j9q_A328 A Novel Conformation For The Tpr Domain Of Pex5p Le 8e-08
2j9q_A328 A Novel Conformation For The Tpr Domain Of Pex5p Le 1e-06
2c0m_A319 Apo Form Of The Tpr Domain Of The Pex5p Receptor Le 9e-08
2c0m_A319 Apo Form Of The Tpr Domain Of The Pex5p Receptor Le 1e-06
2c0l_A305 Tpr Domain Of Human Pex5p In Complex With Human Msc 1e-07
2c0l_A305 Tpr Domain Of Human Pex5p In Complex With Human Msc 1e-06
1fch_A368 Crystal Structure Of The Pts1 Complexed To The Tpr 1e-07
1fch_A368 Crystal Structure Of The Pts1 Complexed To The Tpr 1e-06
3cvq_A327 Structure Of Peroxisomal Targeting Signal 1 (pts1) 2e-06
3cv0_A327 Structure Of Peroxisomal Targeting Signal 1 (Pts1) 2e-06
2q7f_A243 Crystal Structure Of Yrrb: A Tpr Protein With An Un 3e-05
2q7f_A243 Crystal Structure Of Yrrb: A Tpr Protein With An Un 3e-04
2vyi_A131 Crystal Structure Of The Tpr Domain Of Human Sgt Le 5e-05
2xpi_A597 Crystal Structure Of ApcC HETERO-Tetramer Cut9-Hcn1 9e-05
3lca_A533 Structure Of Tom71 Complexed With Hsp70 Ssa1 C Term 4e-04
3fp2_A537 Crystal Structure Of Tom71 Complexed With Hsp82 C-T 5e-04
>pdb|1W3B|A Chain A, The Superhelical Tpr Domain Of O-Linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha. Length = 388 Back     alignment and structure

Iteration: 1

Score = 137 bits (346), Expect = 2e-32, Method: Compositional matrix adjust. Identities = 101/353 (28%), Positives = 168/353 (47%), Gaps = 15/353 (4%) Query: 89 GICLQMQNMGRLAFDSFSEAVKLDPQNACAHTHCGILYKDEGRLVEAAESYHKALSADPS 148 I Q + + R A S + A+K +P A A+++ G +YK+ G+L EA E Y AL P Sbjct: 41 SIHFQCRRLDRSAHFS-TLAIKQNPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPD 99 Query: 149 YKPAAECLAIVLTDLGTSLKLAGNTQDGIQKYYEALKIDPHYAPAYYNLGVVYSELMQYD 208 + +L +L AG+ + +Q Y AL+ +P +LG + L + + Sbjct: 100 FIDG-------YINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLE 152 Query: 209 TALGCYEKAALERPMYAEAYCNMGVIYKNRGDLESAIACYERCLAVSPNFEIAKNNMAIA 268 A CY KA +P +A A+ N+G ++ +G++ AI +E+ + + PNF A Sbjct: 153 EAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNF-------LDA 205 Query: 269 LTDLGTKVKLEGDINQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFDMAIVFYELAFH 328 +LG +K ++ VA Y +AL + ++A NL Y E D+AI Y A Sbjct: 206 YINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIE 265 Query: 329 FNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLGVVYTVQGXXXXXX 388 PH +A NL K++ ++ +A +CY AL + P + SLNNL + QG Sbjct: 266 LQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAV 325 Query: 389 XXXXXXXXXNPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRNAGQN 441 P +A A++NL + + G + A+ Y++ ++I P +A N Sbjct: 326 RLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSN 378
>pdb|1W3B|A Chain A, The Superhelical Tpr Domain Of O-Linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha. Length = 388 Back     alignment and structure
>pdb|3PE3|A Chain A, Structure Of Human O-Glcnac Transferase And Its Complex With A Peptide Substrate Length = 723 Back     alignment and structure
>pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 Back     alignment and structure
>pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 Back     alignment and structure
>pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 Back     alignment and structure
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure
>pdb|2WQH|A Chain A, Crystal Structure Of Ctpr3y3 Length = 125 Back     alignment and structure
>pdb|2WQH|A Chain A, Crystal Structure Of Ctpr3y3 Length = 125 Back     alignment and structure
>pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 Back     alignment and structure
>pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 Back     alignment and structure
>pdb|2VSN|A Chain A, Structure And Topological Arrangement Of An O-Glcnac Transferase Homolog: Insight Into Molecular Control Of Intracellular Glycosylation Length = 568 Back     alignment and structure
>pdb|2VSY|A Chain A, Xanthomonas Campestris Putative Ogt (Xcc0866), Apostructure Length = 568 Back     alignment and structure
>pdb|1NA3|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 91 Back     alignment and structure
>pdb|3VTX|A Chain A, Crystal Structure Of Mama Protein Length = 184 Back     alignment and structure
>pdb|3VTX|A Chain A, Crystal Structure Of Mama Protein Length = 184 Back     alignment and structure
>pdb|2AVP|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix Length = 70 Back     alignment and structure
>pdb|3R9A|B Chain B, Human Alanine-Glyoxylate Aminotransferase In Complex With The Tpr Domain Of Human Pex5p Length = 328 Back     alignment and structure
>pdb|3R9A|B Chain B, Human Alanine-Glyoxylate Aminotransferase In Complex With The Tpr Domain Of Human Pex5p Length = 328 Back     alignment and structure
>pdb|4EQF|A Chain A, Trip8b-1a#206-567 Interacting With The Carboxy-Terminal Seven Residues Of Hcn2 Length = 365 Back     alignment and structure
>pdb|2J9Q|A Chain A, A Novel Conformation For The Tpr Domain Of Pex5p Length = 328 Back     alignment and structure
>pdb|2J9Q|A Chain A, A Novel Conformation For The Tpr Domain Of Pex5p Length = 328 Back     alignment and structure
>pdb|2C0M|A Chain A, Apo Form Of The Tpr Domain Of The Pex5p Receptor Length = 319 Back     alignment and structure
>pdb|2C0M|A Chain A, Apo Form Of The Tpr Domain Of The Pex5p Receptor Length = 319 Back     alignment and structure
>pdb|2C0L|A Chain A, Tpr Domain Of Human Pex5p In Complex With Human Mscp2 Length = 305 Back     alignment and structure
>pdb|2C0L|A Chain A, Tpr Domain Of Human Pex5p In Complex With Human Mscp2 Length = 305 Back     alignment and structure
>pdb|1FCH|A Chain A, Crystal Structure Of The Pts1 Complexed To The Tpr Region Of Human Pex5 Length = 368 Back     alignment and structure
>pdb|1FCH|A Chain A, Crystal Structure Of The Pts1 Complexed To The Tpr Region Of Human Pex5 Length = 368 Back     alignment and structure
>pdb|3CVQ|A Chain A, Structure Of Peroxisomal Targeting Signal 1 (pts1) Binding Domain Of Trypanosoma Brucei Peroxin 5 (tbpex5)complexed To Pts1 Peptide (7- Skl) Length = 327 Back     alignment and structure
>pdb|3CV0|A Chain A, Structure Of Peroxisomal Targeting Signal 1 (Pts1) Binding Domain Of Trypanosoma Brucei Peroxin 5 (Tbpex5)complexed To T. Brucei Phosphoglucoisomerase (Pgi) Pts1 Peptide Length = 327 Back     alignment and structure
>pdb|2Q7F|A Chain A, Crystal Structure Of Yrrb: A Tpr Protein With An Unusual Peptide- Binding Site Length = 243 Back     alignment and structure
>pdb|2Q7F|A Chain A, Crystal Structure Of Yrrb: A Tpr Protein With An Unusual Peptide- Binding Site Length = 243 Back     alignment and structure
>pdb|2VYI|A Chain A, Crystal Structure Of The Tpr Domain Of Human Sgt Length = 131 Back     alignment and structure
>pdb|2XPI|A Chain A, Crystal Structure Of ApcC HETERO-Tetramer Cut9-Hcn1 Length = 597 Back     alignment and structure
>pdb|3LCA|A Chain A, Structure Of Tom71 Complexed With Hsp70 Ssa1 C Terminal Tail Indicating Conformational Plasticity Length = 533 Back     alignment and structure
>pdb|3FP2|A Chain A, Crystal Structure Of Tom71 Complexed With Hsp82 C-Terminal Fragment Length = 537 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query687
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-132
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-100
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-83
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 5e-71
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 8e-67
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 1e-104
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 7e-31
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 1e-28
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 1e-26
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 7e-20
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 9e-16
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 6e-05
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 4e-85
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 3e-75
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-73
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-67
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 3e-28
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 1e-84
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 5e-59
3tax_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 1e-21
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 3e-83
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 5e-80
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 9e-79
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-73
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 4e-64
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-60
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 5e-39
4eqf_A365 PEX5-related protein; accessory protein, tetratric 6e-78
4eqf_A365 PEX5-related protein; accessory protein, tetratric 5e-75
4eqf_A365 PEX5-related protein; accessory protein, tetratric 2e-59
4eqf_A365 PEX5-related protein; accessory protein, tetratric 1e-45
4eqf_A365 PEX5-related protein; accessory protein, tetratric 3e-41
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 2e-74
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 2e-62
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 6e-28
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-25
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 1e-73
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 2e-68
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 2e-65
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 1e-31
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 4e-71
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 3e-70
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 6e-70
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 3e-59
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 1e-53
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 4e-50
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 7e-44
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 6e-71
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 6e-71
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-70
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-60
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 4e-60
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 5e-26
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 5e-24
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-06
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 9e-71
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-68
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-46
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 9e-28
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-25
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 9e-18
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 4e-69
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 7e-61
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-50
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 4e-47
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 6e-47
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-45
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 6e-35
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-26
2gw1_A514 Mitochondrial precursor proteins import receptor; 3e-68
2gw1_A514 Mitochondrial precursor proteins import receptor; 3e-67
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-66
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-63
2gw1_A514 Mitochondrial precursor proteins import receptor; 3e-58
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-52
2gw1_A514 Mitochondrial precursor proteins import receptor; 1e-24
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 8e-66
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 6e-64
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 3e-58
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-51
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-51
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 5e-38
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 7e-27
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 1e-64
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 2e-56
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 9e-44
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 8e-40
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 4e-09
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 8e-64
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-62
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-62
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 6e-62
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 6e-61
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-58
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-54
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-49
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-49
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-46
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-45
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-37
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-36
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 1e-63
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 7e-59
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 1e-55
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 8e-48
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 4e-42
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 6e-37
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 3e-09
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 5e-63
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 6e-56
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 3e-47
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 3e-42
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 2e-29
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 5e-14
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-61
3u4t_A272 TPR repeat-containing protein; structural genomics 3e-58
3u4t_A272 TPR repeat-containing protein; structural genomics 4e-55
3u4t_A272 TPR repeat-containing protein; structural genomics 5e-52
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-39
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-21
4g1t_A472 Interferon-induced protein with tetratricopeptide 1e-60
4g1t_A472 Interferon-induced protein with tetratricopeptide 2e-53
4g1t_A472 Interferon-induced protein with tetratricopeptide 3e-52
4g1t_A472 Interferon-induced protein with tetratricopeptide 1e-44
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 1e-60
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 1e-50
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 3e-38
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 9e-29
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 2e-17
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 3e-58
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 9e-52
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 3e-19
3q3e_A 631 HMW1C-like glycosyltransferase; N-glycosylation; 2 5e-55
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 1e-54
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 2e-39
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 2e-37
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 5e-23
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 2e-53
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 2e-51
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 2e-47
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 2e-42
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 4e-42
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 2e-31
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 7e-17
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 7e-07
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 3e-50
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 5e-29
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 3e-50
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 3e-49
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 5e-39
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 2e-34
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 1e-48
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 1e-40
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 2e-34
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 7e-34
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 5e-21
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 3e-17
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 1e-06
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 4e-04
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 3e-48
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 1e-45
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 9e-43
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 1e-08
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 6e-43
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 3e-36
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 3e-31
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 2e-28
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 4e-40
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 5e-35
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 3e-31
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 4e-39
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 8e-35
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 4e-34
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 6e-34
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 3e-33
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 2e-24
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 9e-20
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 2e-15
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 1e-34
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 4e-34
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 2e-28
3q15_A378 PSP28, response regulator aspartate phosphatase H; 6e-33
3q15_A378 PSP28, response regulator aspartate phosphatase H; 2e-32
3q15_A378 PSP28, response regulator aspartate phosphatase H; 9e-31
3q15_A378 PSP28, response regulator aspartate phosphatase H; 4e-22
3q15_A378 PSP28, response regulator aspartate phosphatase H; 1e-21
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 3e-32
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 7e-29
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 3e-27
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 6e-22
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 1e-21
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 2e-28
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 3e-27
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 2e-25
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 1e-22
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 2e-20
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 2e-20
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 8e-12
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 7e-06
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 1e-27
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 1e-23
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 1e-20
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 3e-20
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 2e-13
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 3e-11
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 7e-27
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 9e-26
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 6e-25
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 4e-19
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 1e-26
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 2e-22
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 1e-19
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 2e-16
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 1e-26
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 9e-23
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 4e-22
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 3e-21
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 4e-21
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 2e-19
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 3e-18
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 9e-18
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 2e-14
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 7e-26
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 3e-16
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 1e-13
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 4e-12
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 1e-10
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 8e-25
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 4e-19
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 2e-17
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 1e-24
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 1e-24
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 5e-22
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 6e-22
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 3e-21
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 3e-16
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 3e-15
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 2e-13
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 4e-06
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 7e-05
2kat_A115 Uncharacterized protein; NESG, structure, structur 3e-23
2kat_A115 Uncharacterized protein; NESG, structure, structur 2e-22
2kat_A115 Uncharacterized protein; NESG, structure, structur 7e-21
2kat_A115 Uncharacterized protein; NESG, structure, structur 5e-18
2kat_A115 Uncharacterized protein; NESG, structure, structur 7e-18
2kat_A115 Uncharacterized protein; NESG, structure, structur 7e-14
2kat_A115 Uncharacterized protein; NESG, structure, structur 7e-14
2kat_A115 Uncharacterized protein; NESG, structure, structur 3e-12
2kat_A115 Uncharacterized protein; NESG, structure, structur 3e-04
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 3e-23
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 1e-22
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 2e-22
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 5e-18
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 1e-15
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 1e-14
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 6e-05
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 4e-22
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 5e-20
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 1e-17
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 1e-16
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 3e-12
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 1e-08
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 7e-08
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 1e-21
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 1e-20
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 1e-18
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 3e-18
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 3e-16
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 1e-15
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 2e-10
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 7e-08
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 3e-05
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 4e-21
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 3e-19
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 3e-11
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 6e-21
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 2e-17
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 8e-16
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 9e-16
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 2e-14
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 4e-13
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 5e-10
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 1e-09
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 1e-20
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 2e-20
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 2e-19
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 1e-17
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 9e-14
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 3e-12
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 3e-04
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 2e-20
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 3e-20
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 7e-18
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 2e-17
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 2e-15
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 2e-14
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 1e-09
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 2e-09
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 4e-20
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 3e-19
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 2e-18
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 4e-17
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 3e-15
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 3e-14
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 9e-13
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 9e-12
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 2e-04
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 3e-19
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 3e-18
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 6e-13
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 1e-09
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 4e-19
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 6e-17
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 3e-13
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 3e-09
3k9i_A117 BH0479 protein; putative protein binding protein, 3e-18
3k9i_A117 BH0479 protein; putative protein binding protein, 2e-17
3k9i_A117 BH0479 protein; putative protein binding protein, 7e-16
3k9i_A117 BH0479 protein; putative protein binding protein, 2e-14
3k9i_A117 BH0479 protein; putative protein binding protein, 3e-13
3k9i_A117 BH0479 protein; putative protein binding protein, 3e-12
3k9i_A117 BH0479 protein; putative protein binding protein, 7e-12
3k9i_A117 BH0479 protein; putative protein binding protein, 5e-09
3k9i_A117 BH0479 protein; putative protein binding protein, 4e-08
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 3e-17
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 1e-15
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 3e-12
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 1e-09
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 2e-07
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 1e-06
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 2e-06
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 8e-17
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 7e-13
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 3e-12
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 1e-09
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 1e-16
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 2e-16
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 5e-16
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 7e-12
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 6e-16
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 1e-15
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 3e-11
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 3e-11
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 1e-15
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 4e-15
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 5e-12
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 9e-11
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 3e-06
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 5e-06
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 3e-15
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 4e-14
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 5e-10
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 1e-07
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 1e-07
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 1e-06
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 3e-15
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 1e-12
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 2e-10
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 8e-14
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 3e-11
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 1e-07
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 1e-05
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 2e-05
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 1e-13
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 3e-13
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 4e-08
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 1e-07
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 6e-07
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 3e-06
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 8e-05
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 1e-12
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 7e-12
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 4e-11
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 1e-10
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 8e-10
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 2e-06
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 2e-06
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 5e-06
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 1e-05
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 2e-12
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 7e-12
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 2e-07
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 9e-07
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 9e-06
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 2e-12
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 7e-12
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 1e-06
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 7e-05
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 8e-05
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 1e-11
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 4e-09
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 1e-08
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 8e-07
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 2e-04
3q49_B137 STIP1 homology and U box-containing protein 1; E3 7e-11
3q49_B137 STIP1 homology and U box-containing protein 1; E3 3e-10
3q49_B137 STIP1 homology and U box-containing protein 1; E3 9e-06
3q49_B137 STIP1 homology and U box-containing protein 1; E3 1e-05
3q49_B137 STIP1 homology and U box-containing protein 1; E3 1e-05
3q49_B137 STIP1 homology and U box-containing protein 1; E3 2e-05
3q49_B137 STIP1 homology and U box-containing protein 1; E3 3e-04
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 2e-10
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 9e-09
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 1e-05
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 8e-05
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 1e-04
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 3e-04
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 4e-04
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 4e-10
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 4e-09
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 2e-06
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 7e-06
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 9e-05
2l6j_A111 TPR repeat-containing protein associated with HSP; 1e-09
2l6j_A111 TPR repeat-containing protein associated with HSP; 3e-08
2l6j_A111 TPR repeat-containing protein associated with HSP; 2e-07
2l6j_A111 TPR repeat-containing protein associated with HSP; 4e-06
2l6j_A111 TPR repeat-containing protein associated with HSP; 2e-05
2l6j_A111 TPR repeat-containing protein associated with HSP; 5e-05
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 2e-09
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 6e-09
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 3e-08
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 4e-08
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 9e-09
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 9e-07
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 2e-04
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 8e-08
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 1e-07
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 6e-05
1klx_A138 Cysteine rich protein B; structural genomics, heli 2e-07
1klx_A138 Cysteine rich protein B; structural genomics, heli 7e-06
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 3e-07
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 3e-06
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 7e-06
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 8e-07
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 2e-04
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 8e-07
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 6e-05
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 1e-05
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 2e-04
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 4e-04
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 1e-05
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 3e-05
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 2e-05
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 2e-05
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 5e-05
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 2e-05
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 2e-05
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 2e-04
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 1e-04
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 2e-04
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 8e-04
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
 Score =  394 bits (1015), Expect = e-132
 Identities = 102/388 (26%), Positives = 175/388 (45%), Gaps = 14/388 (3%)

Query: 55  ANILRSRNKFVDALALYEIVLEKDSGNVEAHIGKGICLQMQNMGRLAFDSFSEAVKLDPQ 114
           A+       F  A      +  ++  N    +              +    + A+K +P 
Sbjct: 6   AHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPL 65

Query: 115 NACAHTHCGILYKDEGRLVEAAESYHKALSADPSYKPAAECLAIVLTDLGTSLKLAGNTQ 174
            A A+++ G +YK+ G+L EA E Y  AL   P +      LA  L   G       + +
Sbjct: 66  LAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAG-------DME 118

Query: 175 DGIQKYYEALKIDPHYAPAYYNLGVVYSELMQYDTALGCYEKAALERPMYAEAYCNMGVI 234
             +Q Y  AL+ +P       +LG +   L + + A  CY KA   +P +A A+ N+G +
Sbjct: 119 GAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCV 178

Query: 235 YKNRGDLESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYKKALY 294
           +  +G++  AI  +E+ + + PNF  A  N+   L +           ++ VA Y +AL 
Sbjct: 179 FNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEAR-------IFDRAVAAYLRALS 231

Query: 295 YNWHYADAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAV 354
            + ++A    NL   Y E    D+AI  Y  A    PH  +A  NL    K++ ++ +A 
Sbjct: 232 LSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAE 291

Query: 355 ECYQMALSIKPNFSQSLNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRD 414
           +CY  AL + P  + SLNNL  +   QG ++ A  +  KA+   P +A A++NL  + + 
Sbjct: 292 DCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQ 351

Query: 415 AGSISLAIDAYEQCLKIDPDSRNAGQNR 442
            G +  A+  Y++ ++I P   +A  N 
Sbjct: 352 QGKLQEALMHYKEAIRISPTFADAYSNM 379


>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>3q3e_A HMW1C-like glycosyltransferase; N-glycosylation; 2.10A {Actinobacillus pleuropneumoniae serovaorganism_taxid} PDB: 3q3h_A* 3q3i_A Length = 631 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Length = 273 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Length = 273 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Length = 273 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Length = 490 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Length = 452 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Length = 212 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Length = 212 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Length = 212 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Length = 212 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Length = 497 Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Length = 497 Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Length = 497 Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Length = 497 Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Length = 497 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Length = 158 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Length = 158 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Length = 158 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Length = 158 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Length = 138 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Length = 138 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Length = 159 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Length = 159 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Length = 176 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Length = 176 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Length = 282 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Length = 493 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Length = 273 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query687
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 100.0
3q3e_A 631 HMW1C-like glycosyltransferase; N-glycosylation; 2 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
2gw1_A514 Mitochondrial precursor proteins import receptor; 100.0
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 100.0
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 100.0
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 100.0
2gw1_A514 Mitochondrial precursor proteins import receptor; 100.0
4g1t_A472 Interferon-induced protein with tetratricopeptide 100.0
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 100.0
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 100.0
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 100.0
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 100.0
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 100.0
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.97
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.97
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.97
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.96
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.96
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.96
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.96
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.96
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.96
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.96
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.95
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.95
3u4t_A272 TPR repeat-containing protein; structural genomics 99.94
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.94
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.94
3u4t_A272 TPR repeat-containing protein; structural genomics 99.94
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.94
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.94
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.94
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.94
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.94
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.93
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.92
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.92
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.92
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.92
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.91
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.91
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.91
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.91
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.91
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.91
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.9
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.9
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.9
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.9
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.9
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.9
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.9
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.89
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.89
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.89
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.89
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.89
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.88
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.88
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.88
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.87
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.87
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.86
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.86
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.85
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.85
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.84
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.84
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.84
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.84
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.83
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.83
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.83
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.83
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.82
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.82
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.81
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.81
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.81
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.81
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.81
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.79
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.79
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.79
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.79
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.78
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.77
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.77
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.77
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.77
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.77
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.77
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.76
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.76
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.75
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.73
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.73
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.72
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.71
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.71
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.71
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.71
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.71
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.7
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.69
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.68
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 99.68
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.67
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.66
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.66
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.65
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.64
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.63
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.63
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.63
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.62
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.62
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.6
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.59
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.59
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.59
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.58
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.58
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.57
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.57
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.57
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.57
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.57
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.55
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.55
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.55
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.54
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.54
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.54
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.54
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.54
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.54
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.54
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.53
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.52
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.52
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.52
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.52
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.52
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.51
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 99.5
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.5
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.5
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.5
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.49
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.48
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.48
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.47
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.46
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.46
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.45
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.45
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.44
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.43
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 99.43
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.43
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.43
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.43
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.43
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.42
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.42
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.41
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.41
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.4
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.39
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.39
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.39
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 99.38
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.38
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.36
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.36
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.35
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.34
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.34
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 99.33
3k9i_A117 BH0479 protein; putative protein binding protein, 99.33
3k9i_A117 BH0479 protein; putative protein binding protein, 99.32
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.31
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.3
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.3
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.22
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.11
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.1
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.08
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.08
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.05
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.02
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.99
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.98
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.96
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.96
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.94
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.94
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.93
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.92
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.91
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.85
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.82
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.75
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.65
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.65
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.59
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.54
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.45
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.44
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.44
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.43
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.43
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.32
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 98.21
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 98.08
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 98.05
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.96
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 97.77
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 97.7
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 97.66
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 97.57
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 97.37
1qsa_A618 Protein (soluble lytic transglycosylase SLT70); al 97.31
1qsa_A618 Protein (soluble lytic transglycosylase SLT70); al 97.26
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 97.24
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 97.18
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 97.17
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 97.14
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.96
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.75
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 96.64
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 96.63
4ady_A963 RPN2, 26S proteasome regulatory subunit RPN2; prot 96.51
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 96.41
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 96.04
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.7
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 95.66
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.58
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 95.56
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 95.45
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 95.45
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 95.34
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 94.77
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 94.68
4b4t_S523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 94.09
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 94.08
4ady_A963 RPN2, 26S proteasome regulatory subunit RPN2; prot 93.8
4b4t_S523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 93.65
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 93.58
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 93.19
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 93.19
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 93.16
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 93.12
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 91.07
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 89.56
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 89.31
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 85.34
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 81.22
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 80.98
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
Probab=100.00  E-value=1.6e-83  Score=706.45  Aligned_cols=370  Identities=25%  Similarity=0.384  Sum_probs=320.1

Q ss_pred             HHHHHhchhhhhcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHhhCCCCHHHHHHHHHHHHH
Q 005626          267 IALTDLGTKVKLEGDINQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKD  346 (687)
Q Consensus       267 ~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~  346 (687)
                      .++..+|.++..+|++++|+..|+++++++|++..++.++|.++..+|++++|+..|+++++++|+++.+++++|.++..
T Consensus        10 ~al~nLG~~~~~~G~~~eAi~~~~kAl~l~P~~~~a~~nLg~~l~~~g~~~eA~~~~~~Al~l~P~~~~a~~nLg~~l~~   89 (723)
T 4gyw_A           10 DSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKE   89 (723)
T ss_dssp             HHHHHHHHHHHHTTCHHHHHHHHHHHHHHCSCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHH
Confidence            44555666666678999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCHHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCcHHHHHHHHHHHHHcCCHHHHHHHHH
Q 005626          347 RDNLDKAVECYQMALSIKPNFSQSLNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYE  426 (687)
Q Consensus       347 ~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~  426 (687)
                      +|++++|++.|+++++++|++..++.++|.++..+|++++|+..|+++++++|+++.++.++|.++..+|++++|.+.++
T Consensus        90 ~g~~~~A~~~~~kAl~l~P~~~~a~~~Lg~~~~~~g~~~eAi~~~~~Al~l~P~~~~a~~~L~~~l~~~g~~~~A~~~~~  169 (723)
T 4gyw_A           90 MQDVQGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMK  169 (723)
T ss_dssp             TTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCSCCHHHHHHHHHHHHHTTCCTTHHHHHH
T ss_pred             cCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCChHHHhhhhhHHHhcccHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhcCCCChhhhhh----HHHHhhhccCCChHHHHHHHHHHHHHHhh----h-ccCcCCCCCCCCCCCCeEEEEecCCc
Q 005626          427 QCLKIDPDSRNAGQN----RLLAMNYINEGHDDKLFEAHRDWGKRFMR----L-YSQYTSWDNTKDPERPLVIGYVSPDY  497 (687)
Q Consensus       427 ~al~~~p~~~~a~~~----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~-~~~~~~~~~~~~~~~~lriGy~S~df  497 (687)
                      +++++.|+.......    ....+.+  ...........++++.....    . .++...+...+.+++||||||||+||
T Consensus       170 kal~l~~~~~~~~~l~~~~~~~~l~~--~~~~~~~~aia~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~klrIGyvS~df  247 (723)
T 4gyw_A          170 KLVSIVADQLEKNRLPSVHPHHSMLY--PLSHGFRKAIAERHGNLCLDKINVLHKPPYEHPKDLKLSDGRLRVGYVSSDF  247 (723)
T ss_dssp             HHHHHHHHHHHTTCCCSSCTTGGGGS--CCCHHHHHHHHHHHHHHHHHHHHTTTCCCCCCCCSSTTTTTCEEEEEEESCS
T ss_pred             HHHHhChhHHhhccCcccchhhhhhh--hcCHHHHHHHHHHHHHhhhhhhhcccCccccCccccccccccceeeeechhh
Confidence            999998765432110    0011111  11121111222233322211    1 11222223345568899999999999


Q ss_pred             ccchHHHHHHhhccccCCCceEEEEEecCCC-CChHhHHHHHHhhhcCCceEeCCCC-CHHHHHHHHHhCCCcEEEecCC
Q 005626          498 FTHSVSYFIEAPLVYHDYQNYKVVVYSAVVK-ADAKTIRFREKVMKKGGIWRDIYGI-DEKKVAAMVREDKIDILVELTG  575 (687)
Q Consensus       498 ~~h~v~~~~~~~~~~~d~~~fev~~y~~~~~-~d~~~~~~~~~~~~~~~~~~~~~~~-~~~~~a~~i~~d~idilvdl~g  575 (687)
                      ++|||++|+.++|++|||++|||++|++++. .|..+.+++..+    ++|+++.++ +|.+++++|++|+|||||||+|
T Consensus       248 ~~H~v~~~~~~~~~~~d~~~fei~~y~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~d~~~a~~i~~d~iDIlidl~g  323 (723)
T 4gyw_A          248 GNHPTSHLMQSIPGMHNPDKFEVFCYALSPDDGTNFRVKVMAEA----NHFIDLSQIPCNGKAADRIHQDGIHILVNMNG  323 (723)
T ss_dssp             SSSHHHHHHTTHHHHSCTTTEEEEEEESSCCCSCHHHHHHHHHS----SEEEEGGGCCCHHHHHHHHHHTTCSEEEESCS
T ss_pred             ccCcHHHHHHHHHHHhccCceeEEEEEcCCCCccHHHHHHHHhh----ccccccccCCcHHHHHHHHHhccceeEEeccC
Confidence            9999999999999999999999999998864 567788777765    899999998 7999999999999999999999


Q ss_pred             CCCCCcchhhccCCCceEEecccCCCCCCCCCccEEEecCCCCCcccccccccceeecCCCccccCC
Q 005626          576 HTANNKLGMMACQPAPVQVTWIGYPNTTGLPTIDYRITDSLADPPETKQKHVEELIRLPECFLCYTP  642 (687)
Q Consensus       576 ~t~~~r~~~~a~r~APvq~~~lG~p~t~g~~~~Dy~i~d~~~~p~~~~~~~~E~l~~lp~~~~~~~~  642 (687)
                      ||.++|+.||++|||||||+|||||+|||+++|||+|+|++++|++.+.+|||||||||+||+|++|
T Consensus       324 ~t~~~r~~i~a~r~APvQv~~lG~p~TtG~~~iDY~i~D~~~~P~~~~~~ysEklirLP~~~~~~d~  390 (723)
T 4gyw_A          324 YTKGARNELFALRPAPIQAMWLGYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDH  390 (723)
T ss_dssp             SBTTCCTHHHHTCCSSEEEECSSCSSCCCCTTCCEEEECTTTSCGGGGGGCSSEEEECSSCSCCCCH
T ss_pred             CCCCCcchhhhcCCCCceeeeccCCCCCCCCcCCEEEeCCCCCCchhhhcceeeeeeCCCccccCCc
Confidence            9999999999999999999999999999999999999999999999999999999999999999974



>3q3e_A HMW1C-like glycosyltransferase; N-glycosylation; 2.10A {Actinobacillus pleuropneumoniae serovaorganism_taxid} PDB: 3q3h_A* 3q3i_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 687
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 7e-53
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 3e-36
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-34
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 3e-28
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-11
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 2e-39
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 1e-36
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 1e-35
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 7e-30
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 1e-28
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 1e-25
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 1e-06
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 1e-05
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 6e-26
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 3e-17
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 4e-11
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 1e-10
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 1e-06
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 1e-25
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 4e-24
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 7e-19
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 1e-16
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 5e-10
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 1e-25
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 4e-24
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 5e-12
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 5e-11
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 2e-08
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 4e-05
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 7e-05
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 1e-20
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 5e-19
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 4e-15
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 4e-14
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 5e-06
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 4e-18
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 9e-15
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 9e-10
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 4e-17
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 2e-08
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 1e-07
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 2e-16
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 4e-16
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 6e-16
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 3e-15
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 1e-14
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 3e-11
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 1e-14
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 3e-13
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 3e-13
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 5e-12
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 1e-11
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 1e-11
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 2e-11
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 7e-14
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 1e-11
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 3e-11
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 8e-11
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 2e-10
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 8e-10
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 3e-08
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 4e-07
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 7e-07
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 7e-06
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 6e-13
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 2e-10
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 4e-10
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 2e-09
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 4e-06
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 8e-06
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 1e-04
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 1e-12
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 3e-11
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 1e-10
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 1e-09
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 8e-09
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 5e-05
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 9e-04
d1p5qa1170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 1e-10
d1p5qa1170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 9e-07
d1p5qa1170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 2e-05
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 3e-10
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 1e-08
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 2e-08
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 1e-07
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 2e-05
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 3e-04
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 4e-10
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 2e-09
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 3e-08
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 0.004
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 6e-10
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 7e-09
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 4e-07
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 1e-06
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 1e-04
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 3e-04
d1tjca_95 a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subuni 7e-10
d1tjca_95 a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subuni 9e-10
d1tjca_95 a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subuni 1e-08
d1tjca_95 a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subuni 4e-07
d1tjca_95 a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subuni 2e-05
d1tjca_95 a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subuni 0.001
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 1e-09
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 8e-09
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 3e-07
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 7e-07
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 1e-06
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 2e-05
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 9e-05
d1ouva_265 a.118.18.1 (A:) Cysteine rich protein C (HcpC) {He 1e-07
d1ouva_265 a.118.18.1 (A:) Cysteine rich protein C (HcpC) {He 4e-04
d2ff4a2179 a.118.8.3 (A:105-283) Probable regulatory protein 8e-07
d2ff4a2179 a.118.8.3 (A:105-283) Probable regulatory protein 3e-04
d2ff4a2179 a.118.8.3 (A:105-283) Probable regulatory protein 0.001
d2hr2a1156 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {C 2e-06
d2hr2a1156 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {C 4e-06
d2hr2a1156 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {C 0.002
d2onda1308 a.118.8.7 (A:242-549) Cleavage stimulation factor 5e-04
d2pqrb1124 a.118.8.1 (B:5-128) Mitochondria fission protein F 7e-04
d2pqrb1124 a.118.8.1 (B:5-128) Mitochondria fission protein F 0.001
d2pqrb1124 a.118.8.1 (B:5-128) Mitochondria fission protein F 0.002
d2pqrb1124 a.118.8.1 (B:5-128) Mitochondria fission protein F 0.004
d1zu2a1145 a.118.8.1 (A:1-145) Mitochondrial import receptor 0.002
d1zu2a1145 a.118.8.1 (A:1-145) Mitochondrial import receptor 0.002
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  185 bits (469), Expect = 7e-53
 Identities = 98/392 (25%), Positives = 166/392 (42%), Gaps = 34/392 (8%)

Query: 52  LSYANILRSRNKFVDALALYEIVLEKDSGNVEAHIGKGICLQMQNMGRLAFDSFSEAVKL 111
           +  A+       F  A      +  ++  N    +              +    + A+K 
Sbjct: 3   MELAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQ 62

Query: 112 DPQNACAHTHCGILYKDEGRLVEAAESYHKALSADPSYKPAAECLAIVLTDLGTSLKLAG 171
           +P  A A+++ G +YK+ G+L EA E Y  AL   P +      LA  L   G       
Sbjct: 63  NPLLAEAYSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQ 122

Query: 172 NTQDG---------------------------IQKYYEALKIDPHYAPAYYNLGVVYSEL 204
                                              Y +A++  P++A A+ NLG V++  
Sbjct: 123 AYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQ 182

Query: 205 MQYDTALGCYEKAALERPMYAEAYCNMGVIYKNRGDLESAIACYERCLAVSPNFEIAKNN 264
            +   A+  +EKA    P + +AY N+G + K     + A+A Y R L++SPN  +   N
Sbjct: 183 GEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGN 242

Query: 265 MAIALTDLGTKVKLEGDINQGVAYYKKALYYNWHYADAMYNLGVAYGEMLKFDMAIVFYE 324
           +A    + G        I+  +  Y++A+    H+ DA  NL  A  E      A   Y 
Sbjct: 243 LACVYYEQG-------LIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYN 295

Query: 325 LAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQSLNNLGVVYTVQGKM 384
            A    P  A++ NNL  I +++ N+++AV  Y+ AL + P F+ + +NL  V   QGK+
Sbjct: 296 TALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKL 355

Query: 385 DAAAEMIEKAIAANPTYAEAYNNLGVLYRDAG 416
             A    ++AI  +PT+A+AY+N+G   ++  
Sbjct: 356 QEALMHYKEAIRISPTFADAYSNMGNTLKEMQ 387


>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Length = 265 Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Length = 265 Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 179 Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 179 Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 179 Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Length = 156 Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Length = 156 Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Length = 156 Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 308 Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 124 Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 124 Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 124 Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 124 Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 145 Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 145 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query687
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.96
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.95
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.9
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.89
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.88
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.87
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.85
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.83
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.83
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.82
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.66
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.65
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.65
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.65
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.64
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.64
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.63
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.63
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.61
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.6
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.6
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.58
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.51
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.51
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.48
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.46
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.45
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.44
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.43
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.42
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.42
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.42
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.41
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.41
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.41
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.41
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.39
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.39
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.38
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.37
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.33
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.31
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.1
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.06
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.06
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.03
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.98
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.84
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.8
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.72
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 98.21
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.16
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 98.1
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.1
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 97.64
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 97.46
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.01
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.0
d2o02a1230 zeta isoform {Cow (Bos taurus) [TaxId: 9913]} 87.82
d1o9da_236 14-3-3-like protein C {Common tobacco (Nicotiana t 83.4
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=3.4e-39  Score=332.70  Aligned_cols=381  Identities=27%  Similarity=0.372  Sum_probs=356.1

Q ss_pred             HHHHHHHHHhCCCHHHHHHHHHHHHHhCCCCHHHHHhHHHHHHHhCChHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHcC
Q 005626           51 ALSYANILRSRNKFVDALALYEIVLEKDSGNVEAHIGKGICLQMQNMGRLAFDSFSEAVKLDPQNACAHTHCGILYKDEG  130 (687)
Q Consensus        51 ~~~~a~~~~~~g~~~~A~~~~~~~l~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g  130 (687)
                      ++++|..+++.|+|++|++.|+++++.+|+++.++..+|.++...|++++|+..|+++++.+|+++.++..+|.++...|
T Consensus         2 ll~la~~~~~~G~~~~A~~~~~~~l~~~p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~a~~~l~~~~~~~g   81 (388)
T d1w3ba_           2 PMELAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERG   81 (388)
T ss_dssp             CCTHHHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHT
T ss_pred             hHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHhhhhc
Confidence            35789999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CHHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHhHHHHHHcCChHHHHHHHHHHHhhCCCCHHHHHHHHHHHHHcCCHHHH
Q 005626          131 RLVEAAESYHKALSADPSYKPAAECLAIVLTDLGTSLKLAGNTQDGIQKYYEALKIDPHYAPAYYNLGVVYSELMQYDTA  210 (687)
Q Consensus       131 ~~~~A~~~~~~al~~~~~~~~~~~~la~~~~~lg~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A  210 (687)
                      ++++|+..+.++....+.....       ....+......+....+...........+.........+......+....+
T Consensus        82 ~~~~A~~~~~~~~~~~~~~~~~-------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  154 (388)
T d1w3ba_          82 QLQEAIEHYRHALRLKPDFIDG-------YINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEA  154 (388)
T ss_dssp             CHHHHHHHHHHHHHHCTTCHHH-------HHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHHHHHTTSCHHHH
T ss_pred             cccccccccccccccccccccc-------cccccccccccccccccccccccccccccccccccccccccccccchhhhh
Confidence            9999999999999999998776       444555556668888888888888888899999999999999999999999


Q ss_pred             HHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCcHHHHHHHHHHHHHhchhhhhcCCHHHHHHHHH
Q 005626          211 LGCYEKAALERPMYAEAYCNMGVIYKNRGDLESAIACYERCLAVSPNFEIAKNNMAIALTDLGTKVKLEGDINQGVAYYK  290 (687)
Q Consensus       211 ~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~l~~~~~~l~~~~~~~~~~~~A~~~~~  290 (687)
                      ...+.+.+...|++..++..+|.++...|++++|...++++++.+|++...+..++.+       +...+++++|+..++
T Consensus       155 ~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~-------~~~~~~~~~A~~~~~  227 (388)
T d1w3ba_         155 KACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNV-------LKEARIFDRAVAAYL  227 (388)
T ss_dssp             HHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHH-------HHTTTCTTHHHHHHH
T ss_pred             HHHHHHhhccCcchhHHHHhhcccccccCcHHHHHHHHHHHHHhCcccHHHHHHHhhh-------hhccccHHHHHHHHH
Confidence            9999999999999999999999999999999999999999999999988766555554       445679999999999


Q ss_pred             HHHHhCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHhhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCCHHH
Q 005626          291 KALYYNWHYADAMYNLGVAYGEMLKFDMAIVFYELAFHFNPHCAEACNNLGVIYKDRDNLDKAVECYQMALSIKPNFSQS  370 (687)
Q Consensus       291 ~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~  370 (687)
                      ++....+.....+..+|.++...|++++|+..|+++++++|+++.++..+|.++...|++++|++.+++++...|.+...
T Consensus       228 ~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~~  307 (388)
T d1w3ba_         228 RALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADS  307 (388)
T ss_dssp             HHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTCSSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHCTTCHHH
T ss_pred             HhHHHhhhHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhccCCccchh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHcCCHHHHHHHHHHHHHhCCCcHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCChhhhhhHHHH
Q 005626          371 LNNLGVVYTVQGKMDAAAEMIEKAIAANPTYAEAYNNLGVLYRDAGSISLAIDAYEQCLKIDPDSRNAGQNRLLA  445 (687)
Q Consensus       371 ~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~p~~~~a~~~~~~~  445 (687)
                      +..++.++...|++++|+..|+++++++|+++.+++++|.++..+|++++|+.+|+++++++|+++.++.++..+
T Consensus       308 ~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l~P~~~~a~~~lg~~  382 (388)
T d1w3ba_         308 LNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNT  382 (388)
T ss_dssp             HHHHHHHHHTTTCHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTCTTCHHHHHHHHHH
T ss_pred             hhHHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHH
Confidence            999999999999999999999999999999999999999999999999999999999999999999988776443



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2o02a1 a.118.7.1 (A:1-230) zeta isoform {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1o9da_ a.118.7.1 (A:) 14-3-3-like protein C {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure