Citrus Sinensis ID: 005639

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680------
MDLLKYGTGLHIFKGTYTMQETRDRLYALVHKLKDYCLLLDGPTEDWIRMHDLVREVAISIASRDRHVFMLRNDIQIEWPVADMLKNCPTIFLHDCKHWEVPEGLEYPQLEFFCMSPRDHSIKIPNHVFAGMSNLRGLALSNMQFLSLPSLFHLPLNLQTLCLDRCALGDIAIIGNLKKLEILSLVDSNIEQLPEEMAQLTQLRLFDLSGCSKLKVIPPNLLSGLSRLEDLYMGNTSVKWEFEGLNVGRSNASLQELKLLSHLTTLEIQICDAMILPKGLFSKKLERYKIFIGDEWDWSGNYKNKRVLKLKLYTSNVDEVIMQLKGIEELYLDEVPGIKNVLYDLDIEGFLQLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVLHNLIHLEKICLGQLRAESFYKLKIIKVRNCDKLKNIFSFSFVRGLPQLQTLNVINCKNMKEIFTVGRENDVDCHEVDKIEFSQLHSLTLKFLPQLTSFYSQVKTSAASQTRLKELSTHTLPREVILEDECDTLMPFFNEKVVFPNLETLELCAISTEKIWCNQLAAVYSQNLTRLIVHGCEKLKYLFPSSMIRNFVQLEHLEICYCSSLESIVGKESGEEATTTFVFPKVTFLKLWNLSELKTFYPGTHTSKWPMLKKLEVYGCDKVKIFTSRFLRFQEINEGQFDIPTQQALFLVEKV
ccHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcccccccccccEEEEcHHHHHHHHHHHcccccEEEEEcccccccccccccccEEEEEccccccccccccccccccEEEEEcccccccccccHHHccccccEEEEccccccccccccccccccccEEEcccccccccccccccccccEEcccccccccccHHHHccccccEEEEcccccccccccccccccccccEEEcccccccEEEcccccccccccHHHHcccccccEEEEEEEccccccccHHccccccccEEEccccccccccccccEEEEEEcccccccHHccccccccEEEccccccccccccccccccccccEEEEEccccEEEEEccccccccccccccEEEEEcccccccEEccccccccccccccEEEEEcccccccccccccccccccccEEEEEEcccccHHcccccccccccccccccccccccEEEccccccccccccccccccHHHHcccccccccccccEEccccccccccccccccccccccEEEEEcccccccccccccccccccccEEEEEcccccccccccccccccccccEEEEEEccccccccccccccccccccccccccEEEEccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccEEEccc
ccHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccccccccccEEEHHHHHHHHHHHHHcccccEEEEEcccccccccHHHHccEEEEEEccccHHHccccccccccEEEEEccccccccccHHHHHHccccEEEEccccccccccccHHHHHHccEEEccccccccHHHHHHHHccEEEEcccccHHHccHHHHHHHcccEEEccccccccEccccHHHHHHccEEEEEEcccEEEEEcccccccccccHHHHHHcccccEEEEEEcccccccccccHHHHcEEEEEEccccccccccccHHHHHccccccccccHHHHHccccEEEEccccccHHcccHcccccccccEEEEEEccccHEEEccccccccccccccccEEEEcccHHHHHHccccccccccccccEEEEcccccHcccccHHHHHHcHcccEEEEcccHHHHHHEcccccccccccccccccccccEEEEEcccccccEccccccccccccccccEEEEccccccEEccccccccccccccEEccccccEEEEEcccccEEcccccccccccccEEEEEccccccHEcccHHHHHHHHcccEEEEcccHcHHHEEccccccccccccccccccEEEEcccccccHccccccccccccccEEEEEccccHHEcccccccccccEEEEccccccccEEEEEEc
mdllkygtglhifkgtytMQETRDRLYALVHKLKDYcllldgptedwIRMHDLVREVAISIASRDRHVFMLRNDIQIEwpvadmlkncptiflhdckhwevpegleypqleffcmsprdhsikipnhvFAGMSNLRGLALSnmqflslpslfhlplnlqtlcldrcalgdiaiignLKKLEILSLVDSNIEQLPEEMAQLTQLRLfdlsgcsklkvippnllsglsrledlymgnTSVKWEFeglnvgrsnaSLQELKLLSHLTTLEIQICDamilpkglfskKLERYKIFigdewdwsgnyknkrVLKLKLYTSNVDEVIMQLKGIEElyldevpgiknVLYDLDIEGFLQLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVLHNLIHLEKICLGQLRAESFYKLKIIKVRNCDKLKNIFSfsfvrglpqlqtlnvincknmkeiftvgrendvdchevdkiefsqlhsltlkflpqlTSFYSQVKTSAASQTRLKElsthtlpreviledecdtlmpffnekvvfpnletlELCAISTEKIWCNQLAAVYSQNLTRLIVHGCeklkylfpssmirnfvqLEHLEICYcsslesivgkesgeeatttfvfpKVTFLKLwnlselktfypgthtskwpmlkklevygcdkvkiFTSRFLRFQeinegqfdiptqQALFLVEKV
mdllkygtglhifkgtytmqeTRDRLYALVHKLKDYCLLLDGPTEDWIRMHDLVREVAISiasrdrhvFMLRNDIQIEWPVADMLKNCPTIFLHDCKHWEVPEGLEYPQLEFFCMSPRDHSIKIPNHVFAGMSNLRGLALSNMQFLSLPSLFHLPLNLQTLCLDRCALGDIAIIGNLKKLEILSLVDSNIEQLPEEMAQLTQLRLFDLSGCSKLKVIPPNLLSGLSRLEDLYMGNTSVKWEFEGLNVGRSNASLQELKLLSHLTTLEIQICDAMILPKGLFSKKLERYKIFigdewdwsgnykNKRVLKLKLYTSNVDEVIMQLKGIEELYLDEVPGIKNVLYDLDIEGFLQLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVLHNLIHLEKICLGQLRAESFYKLKIIKVRNCDKLKNIFSfsfvrglpqlqTLNVINCKNMKEIFTVGRENDVDCHEVDKIEFSQLHSLTLKFLPQLTSFYSQVKTSAasqtrlkelsthtlprevILEDECDTLMPFFNEKVVFPNLETLELCAISTEKIWCNQLAAVYSQNLTRLIVHGCEKLKYLFPSSMIRNFVQLEHLEICYCSSLESIVGKESGEEATTTFVFPKVTFLKLWNLSELKTfypgthtskwpmlKKLEVYGCDKVKIFTSRFLRFQEinegqfdiptqqaLFLVEKV
MDLLKYGTGLHIFKGTYTMQETRDRLYALVHKLKDYCLLLDGPTEDWIRMHDLVREVAISIASRDRHVFMLRNDIQIEWPVADMLKNCPTIFLHDCKHWEVPEGLEYPQLEFFCMSPRDHSIKIPNHVFAGMSNLRGLALSNMQflslpslfhlplnlQTLCLDRCALGDIAIIGNLKKLEILSLVDSNIEQLPEEMAQLTQLRLFDLSGCSKLKVIPPNLLSGLSRLEDLYMGNTSVKWEFEGLNVGRSNASLQELKLLSHLTTLEIQICDAMILPKGLFSKKLERYKIFIGDEWDWSGNYKNKRVLKLKLYTSNVDEVIMQLKGIEELYLDEVPGIKNVLYDLDIEGFLQLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVLHNLIHLEKICLGQLRAESFYKLKIIKVRNCDKLKNIFSFSFVRGLPQLQTLNVINCKNMKEIFTVGRENDVDCHEVDKIEFSQLHSLTLKFLPQLTSFYSQVKTSAASQTRLKELSTHTLPREVILEDECDTLMPFFNEKVVFPNLETLELCAISTEKIWCNQLAAVYSQNLTRLIVHGCEKLKYLFPSSMIRNFVQLEHLEICYCSSLESIVGKESGEEATTTFVFPKVTFLKLWNLSELKTFYPGTHTSKWPMLKKLEVYGCDKVKIFTSRFLRFQEINEGQFDIPTQQALFLVEKV
***LKYGTGLHIFKGTYTMQETRDRLYALVHKLKDYCLLLDGPTEDWIRMHDLVREVAISIASRDRHVFMLRNDIQIEWPVADMLKNCPTIFLHDCKHWEVPEGLEYPQLEFFCMSPRDHSIKIPNHVFAGMSNLRGLALSNMQFLSLPSLFHLPLNLQTLCLDRCALGDIAIIGNLKKLEILSLVDSNIEQLPEEMAQLTQLRLFDLSGCSKLKVIPPNLLSGLSRLEDLYMGNTSVKWEFEGLNVGRSNASLQELKLLSHLTTLEIQICDAMILPKGLFSKKLERYKIFIGDEWDWSGNYKNKRVLKLKLYTSNVDEVIMQLKGIEELYLDEVPGIKNVLYDLDIEGFLQLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVLHNLIHLEKICLGQLRAESFYKLKIIKVRNCDKLKNIFSFSFVRGLPQLQTLNVINCKNMKEIFTVGRENDVDCHEVDKIEFSQLHSLTLKFLPQLTSFYSQVKT*******LKELSTHTLPREVILEDECDTLMPFFNEKVVFPNLETLELCAISTEKIWCNQLAAVYSQNLTRLIVHGCEKLKYLFPSSMIRNFVQLEHLEICYCSSLESIVGKESGEEATTTFVFPKVTFLKLWNLSELKTFYPGTHTSKWPMLKKLEVYGCDKVKIFTSRFLRFQEINEGQFDIPTQQALFLV***
MDLLKYGTGLHIFKGTYTMQETRDRLYALVHKLKDYCLLLDGPTEDWIRMHDLVREVAISIASRDRHVFMLRNDIQIEWPVADMLKNCPTIFLHDCKHWEVPEGLEYPQLEFFCMSPRDHSIKIPNHVFAGMSNLRGLALSNMQFLSLPSLFHLPLNLQTLCLDRCALGDIAIIGNLKKLEILSLVDSNIEQLPEEMAQLTQLRLFDLSGCSKLKVIPPNLLSGLSRLEDLYMGNTSVKWEFEG*********LQELKLLSHLTTLEIQICDAMILPKGLFSKKLERYKIFIGDEWDWSGNYKNKRVLKLKLYTSNVDEVIMQLKGIEELYLDEVPGIKNVLYDLDIEGFLQLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVLHNLIHLEKICLGQLRAESFYKLKIIKVRNCDKLKNIFSFSFVRGLPQLQTLNVINCKNMKEIFTVGR********VDKIEFSQLHSLTLKFLPQLTSFYSQVKTSAASQTRLKELSTHTLPREVILEDECDTLMPFFNEKVVFPNLETLELCAISTEKIWCNQLAAVYSQNLTRLIVHGCEKLKYLFPSSMIRNFVQLEHLEICYCSSLESIVG*********TFVFPKVTFLKLWNLSELKTFYPGTHTSKWPMLKKLEVYGCDKVKIF***************DIPTQQALFLVEKV
MDLLKYGTGLHIFKGTYTMQETRDRLYALVHKLKDYCLLLDGPTEDWIRMHDLVREVAISIASRDRHVFMLRNDIQIEWPVADMLKNCPTIFLHDCKHWEVPEGLEYPQLEFFCMSPRDHSIKIPNHVFAGMSNLRGLALSNMQFLSLPSLFHLPLNLQTLCLDRCALGDIAIIGNLKKLEILSLVDSNIEQLPEEMAQLTQLRLFDLSGCSKLKVIPPNLLSGLSRLEDLYMGNTSVKWEFEGLNVGRSNASLQELKLLSHLTTLEIQICDAMILPKGLFSKKLERYKIFIGDEWDWSGNYKNKRVLKLKLYTSNVDEVIMQLKGIEELYLDEVPGIKNVLYDLDIEGFLQLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVLHNLIHLEKICLGQLRAESFYKLKIIKVRNCDKLKNIFSFSFVRGLPQLQTLNVINCKNMKEIFTVGRENDVDCHEVDKIEFSQLHSLTLKFLPQLTSFYSQ**********LKELSTHTLPREVILEDECDTLMPFFNEKVVFPNLETLELCAISTEKIWCNQLAAVYSQNLTRLIVHGCEKLKYLFPSSMIRNFVQLEHLEICYCSSLESIVGKESGEEATTTFVFPKVTFLKLWNLSELKTFYPGTHTSKWPMLKKLEVYGCDKVKIFTSRFLRFQEINEGQFDIPTQQALFLVEKV
MDLLKYGTGLHIFKGTYTMQETRDRLYALVHKLKDYCLLLDGPTEDWIRMHDLVREVAISIASRDRHVFMLRNDIQIEWPVADMLKNCPTIFLHDCKHWEVPEGLEYPQLEFFCMSPRDHSIKIPNHVFAGMSNLRGLALSNMQFLSLPSLFHLPLNLQTLCLDRCALGDIAIIGNLKKLEILSLVDSNIEQLPEEMAQLTQLRLFDLSGCSKLKVIPPNLLSGLSRLEDLYMGNTSVKWEFEGLNVGRSNASLQELKLLSHLTTLEIQICDAMILPKGLFSKKLERYKIFIGDEWDWSGNYKNKRVLKLKLYTSNVDEVIMQLKGIEELYLDEVPGIKNVLYDLDIEGFLQLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVLHNLIHLEKICLGQLRAESFYKLKIIKVRNCDKLKNIFSFSFVRGLPQLQTLNVINCKNMKEIFTVGRENDVDCHEVDKIEFSQLHSLTLKFLPQLTSFYSQVKTSAASQTRLKELSTHTLPREVILEDECDTLMPFFNEKVVFPNLETLELCAISTEKIWCNQLAAVYSQNLTRLIVHGCEKLKYLFPSSMIRNFVQLEHLEICYCSSLESIVGKESGEEATTTFVFPKVTFLKLWNLSELKTFYPGTHTSKWPMLKKLEVYGCDKVKIFTSRFLRFQEINEGQFDIPTQQALFLVEKV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDLLKYGTGLHIFKGTYTMQETRDRLYALVHKLKDYCLLLDGPTEDWIRMHDLVREVAISIASRDRHVFMLRNDIQIEWPVADMLKNCPTIFLHDCKHWEVPEGLEYPQLEFFCMSPRDHSIKIPNHVFAGMSNLRGLALSNMQFLSLPSLFHLPLNLQTLCLDRCALGDIAIIGNLKKLEILSLVDSNIEQLPEEMAQLTQLRLFDLSGCSKLKVIPPNLLSGLSRLEDLYMGNTSVKWEFEGLNVGRSNASLQELKLLSHLTTLEIQICDAMILPKGLFSKKLERYKIFIGDEWDWSGNYKNKRVLKLKLYTSNVDEVIMQLKGIEELYLDEVPGIKNVLYDLDIEGFLQLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVLHNLIHLEKICLGQLRAESFYKLKIIKVRNCDKLKNIFSFSFVRGLPQLQTLNVINCKNMKEIFTVGRENDVDCHEVDKIEFSQLHSLTLKFLPQLTSFYSQVKTSAASQTRLKELSTHTLPREVILEDECDTLMPFFNEKVVFPNLETLELCAISTEKIWCNQLAAVYSQNLTRLIVHGCEKLKYLFPSSMIRNFVQLEHLEICYCSSLESIVGKESGEEATTTFVFPKVTFLKLWNLSELKTFYPGTHTSKWPMLKKLEVYGCDKVKIFTSRFLRFQEINEGQFDIPTQQALFLVEKV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query686 2.2.26 [Sep-21-2011]
O81825919 Probable disease resistan yes no 0.695 0.519 0.266 2e-30
Q9T048985 Disease resistance protei no no 0.635 0.442 0.247 6e-24
Q42484909 Disease resistance protei no no 0.568 0.429 0.247 5e-16
O35930 734 Platelet glycoprotein Ib yes no 0.266 0.249 0.296 4e-07
Q9SH22884 Probable disease resistan no no 0.583 0.452 0.232 2e-06
Q01513 2145 Adenylate cyclase OS=Podo yes no 0.132 0.042 0.354 3e-06
P07359626 Platelet glycoprotein Ib yes no 0.236 0.258 0.287 1e-05
Q9RBS21024 Protein PopC OS=Ralstonia yes no 0.157 0.105 0.351 6e-05
Q9SI85893 Probable disease resistan no no 0.568 0.436 0.224 7e-05
Q8N9N7239 Leucine-rich repeat-conta no no 0.126 0.364 0.416 0.0002
>sp|O81825|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1 Back     alignment and function desciption
 Score =  134 bits (338), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 132/496 (26%), Positives = 222/496 (44%), Gaps = 19/496 (3%)

Query: 2   DLLKYGTGLHIFKGTYTMQETRDRLYALVHKLKDYCLLLDGPTEDWIRMHDLVREVAI-- 59
           +L+ Y     +  G +  ++  +    LV +LKD CLL DG + D ++MHD+VR+ AI  
Sbjct: 383 ELIMYWVAEGLLDGQHHYEDMMNEGVTLVERLKDSCLLEDGDSCDTVKMHDVVRDFAIWF 442

Query: 60  -SIASRDRHVFMLRNDIQIEWPVADMLKNCPTIFLHDCKHWEVPEG-LEYPQLEFFCMSP 117
            S      H  ++     IE+P    + +   + L   K   +P   +E  +     +  
Sbjct: 443 MSSQGEGFHSLVMAGRGLIEFPQDKFVSSVQRVSLMANKLERLPNNVIEGVETLVLLLQG 502

Query: 118 RDHSIKIPNHVFAGMSNLRGLALSNMQFLSLPSLFHLPLNLQTLCLDRC-ALGDIAIIGN 176
             H  ++PN       NLR L LS ++  +LP  F    +L++L L  C  L ++  + +
Sbjct: 503 NSHVKEVPNGFLQAFPNLRILDLSGVRIRTLPDSFSNLHSLRSLVLRNCKKLRNLPSLES 562

Query: 177 LKKLEILSLVDSNIEQLPEEMAQLTQLRLFDLSGCSKLKVIPPNLLSGLSRLEDLYMGNT 236
           L KL+ L L +S I +LP  +  L+ LR   +S   +L+ IP   +  LS LE L M  +
Sbjct: 563 LVKLQFLDLHESAIRELPRGLEALSSLRYICVSNTYQLQSIPAGTILQLSSLEVLDMAGS 622

Query: 237 SVKWEFEGLNVGRSNASLQELKLLSHLTTLEIQICDAMILPKGL--FSKKLERYKIFIGD 294
           +  W  +G       A+L E+  L HL  L I++ D +         +K+L +++     
Sbjct: 623 AYSWGIKG-EEREGQATLDEVTCLPHLQFLAIKLLDVLSFSYEFDSLTKRLTKFQFLFSP 681

Query: 295 EWDWSGNYKNKRVLKLKLYTSNVDEVIMQLKGIEELYLDEVPGIKNVLYDL---DIEGFL 351
               S     +  L +     +   +   L+ +  L L+   G+  +  +L       F+
Sbjct: 682 IRSVSPPGTGEGCLAISDVNVSNASIGWLLQHVTSLDLNYCEGLNGMFENLVTKSKSSFV 741

Query: 352 QLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVLHNLIHLEKIC-LGQLRAESFYKLK 410
            +K L +   P +     S    + + F  LE L L N ++LE I  L         KLK
Sbjct: 742 AMKALSIHYFPSLSLA--SGCESQLDLFPNLEELSLDN-VNLESIGELNGFLGMRLQKLK 798

Query: 411 IIKVRNCDKLKNIFSFSFVRG-LPQLQTLNVINCKNMKEIFTVGRENDVDCHEVDKIEFS 469
           +++V  C +LK +FS   + G LP LQ + V++C  ++E+F         C E       
Sbjct: 799 LLQVSGCRQLKRLFSDQILAGTLPNLQEIKVVSCLRLEELFNFSSVPVDFCAES---LLP 855

Query: 470 QLHSLTLKFLPQLTSF 485
           +L  + LK+LPQL S 
Sbjct: 856 KLTVIKLKYLPQLRSL 871
Probable disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9T048|DRL27_ARATH Disease resistance protein At4g27190 OS=Arabidopsis thaliana GN=At4g27190 PE=2 SV=1 Back     alignment and function description
>sp|Q42484|RPS2_ARATH Disease resistance protein RPS2 OS=Arabidopsis thaliana GN=RPS2 PE=1 SV=1 Back     alignment and function description
>sp|O35930|GP1BA_MOUSE Platelet glycoprotein Ib alpha chain OS=Mus musculus GN=Gp1ba PE=2 SV=2 Back     alignment and function description
>sp|Q9SH22|DRL20_ARATH Probable disease resistance protein At1g63360 OS=Arabidopsis thaliana GN=At1g63360 PE=2 SV=1 Back     alignment and function description
>sp|Q01513|CYAA_PODAS Adenylate cyclase OS=Podospora anserina PE=3 SV=1 Back     alignment and function description
>sp|P07359|GP1BA_HUMAN Platelet glycoprotein Ib alpha chain OS=Homo sapiens GN=GP1BA PE=1 SV=1 Back     alignment and function description
>sp|Q9RBS2|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2 Back     alignment and function description
>sp|Q9SI85|DRL14_ARATH Probable disease resistance protein At1g62630 OS=Arabidopsis thaliana GN=At1g62630 PE=3 SV=2 Back     alignment and function description
>sp|Q8N9N7|LRC57_HUMAN Leucine-rich repeat-containing protein 57 OS=Homo sapiens GN=LRRC57 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query686
224111296 1315 cc-nbs-lrr resistance protein [Populus t 0.953 0.497 0.470 1e-149
255563252 1603 Disease resistance protein RPS5, putativ 0.954 0.408 0.472 1e-149
224083434 1144 cc-nbs-lrr resistance protein [Populus t 0.948 0.569 0.455 1e-145
224111284 1340 cc-nbs-lrr resistance protein [Populus t 0.941 0.482 0.459 1e-141
224143316 1337 cc-nbs-lrr resistance protein [Populus t 0.941 0.483 0.456 1e-139
296087872 1152 unnamed protein product [Vitis vinifera] 0.985 0.586 0.421 1e-139
255542484 2460 phosphoprotein phosphatase, putative [Ri 0.953 0.265 0.451 1e-138
255574526 1232 Disease resistance protein RFL1, putativ 0.937 0.521 0.458 1e-135
224110992 2359 cc-nbs-lrr resistance protein [Populus t 0.937 0.272 0.447 1e-135
224125154 949 cc-nbs-lrr resistance protein [Populus t 0.766 0.554 0.474 1e-125
>gi|224111296|ref|XP_002332952.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834264|gb|EEE72741.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  535 bits (1379), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 314/667 (47%), Positives = 425/667 (63%), Gaps = 13/667 (1%)

Query: 2    DLLKYGTGLHIFKGTYTMQETRDRLYALVHKLKDYCLLLDGPTEDWIRMHDLVREVAISI 61
            DLL+YG GL +FKG  T++ETR+ L  LV +LK  CLLL+G  +  ++MHD+V   AIS+
Sbjct: 412  DLLRYGIGLDLFKGCSTLEETRNSLLTLVDELKASCLLLEGDKDGSVKMHDVVHSFAISV 471

Query: 62   ASRDRHVFMLRNDIQIEWPVADMLKNCPTIFLHDCKHWEVPEGLEYPQLEFFCMSPRDHS 121
            A RD HV  + ++ + EWP  D+L+    I L   K  ++P  LE P L  F +  +D S
Sbjct: 472  ALRDHHVLTVADEFK-EWPANDVLQQYTAISLPFRKIPDLPAILECPNLNSFLLLNKDPS 530

Query: 122  IKIPNHVFAGMSNLRGLALSNMQFLSLPSLFHLPLNLQTLCLDRCALGDIAIIGNLKKLE 181
            ++IP+  F  M  L+ L L+ +    LPS      NLQTLCLD C L DI+IIG L KL+
Sbjct: 531  LQIPDSFFREMKELKILDLTEVNLSPLPSSLQFLENLQTLCLDHCVLEDISIIGELNKLK 590

Query: 182  ILSLVDSNIEQLPEEMAQLTQLRLFDLSGCSKLKVIPPNLLSGLSRLEDLYMGNTSVKWE 241
            +LSL+ SNI +LP E+ ++T+L+L DLS C +L+VI PN LS L+RLEDLYMGN+ VKWE
Sbjct: 591  VLSLMSSNIVRLPREIGKVTRLQLLDLSNCERLEVISPNALSSLTRLEDLYMGNSFVKWE 650

Query: 242  FEGLNVGRSNASLQELKLLSHLTTLEIQICDAMILPKGLFS--KKLERYKIFIGDEWDWS 299
             EG +  R+NA L ELK LS+L+TL +QI DA  +PK LFS  + LER++IFIGD WDWS
Sbjct: 651  TEGSSSQRNNACLSELKHLSNLSTLHMQITDADNMPKDLFSSFQNLERFRIFIGDGWDWS 710

Query: 300  GNYKNKRVLKLKLYTS-NVDE-VIMQLKGIEELYLDEVPGIKNVLYDLDIEGFLQLKHLH 357
                  R LKLKL T   ++E V   LK  EEL+L E+ G+K++L DLD EGF QL+HLH
Sbjct: 711  VKDATSRTLKLKLNTVIQLEEGVNTLLKITEELHLQELNGVKSILNDLDGEGFPQLRHLH 770

Query: 358  VQNNPFILFIVDSMAWVRYNAFLLLESLVLHNLIHLEKICLGQLRAESFYKLKIIKVRNC 417
            VQN P + +I++S+      AFL L+SL L NL +LEKIC GQL AES   L+I+KV +C
Sbjct: 771  VQNCPGVQYIINSIRMGPRTAFLNLDSLFLENLDNLEKICHGQLMAESLGNLRILKVESC 830

Query: 418  DKLKNIFSFSFVRGLPQLQTLNVINCKNMKEIFTVGRENDVDCHEVDKIEFSQLHSLTLK 477
             +LKN+FS S  R L +L+ + +I+CK M+E+     END    E   IEF+QL  LTL+
Sbjct: 831  HRLKNLFSVSMARRLVRLEEITIIDCKIMEEVVAEESENDAADGE-PIIEFTQLRRLTLQ 889

Query: 478  FLPQLTSFYSQVKTSAASQTRLKELSTHTLPREVILEDECDTLMPFFNEKVVFPNLETLE 537
             LPQ TSF+S V+ S+ SQ R K L++    +E++  +E  T M  FN K++FPNLE L+
Sbjct: 890  CLPQFTSFHSNVEESSDSQRRQKLLASEARSKEIVAGNELGTSMSLFNTKILFPNLEDLK 949

Query: 538  LCAISTEKIWCNQLAAVYS---QNLTRLIVHGCEKLKYLFPSSMIRNFVQLEHLEICYCS 594
            L +I  EKIW +Q  +V S   +NL  + V  C  L YL  SSM+ +  QL+ LEIC C 
Sbjct: 950  LSSIKVEKIWHDQ-PSVQSPCVKNLASIAVENCRNLNYLLTSSMVESLAQLKKLEICNCK 1008

Query: 595  SLESIVGKESGEEAT--TTFVFPKVTFLKLWNLSELKTFYPGTHTSKWPMLKKLEVYGCD 652
            S+E IV  E   E    +  +FPK+  L L  L +L T +  ++  +   LK L V  C 
Sbjct: 1009 SMEEIVVPEDIGEGKMMSKMLFPKLLILSLIRLPKL-TRFCTSNLLECHSLKVLTVGNCP 1067

Query: 653  KVKIFTS 659
            ++K F S
Sbjct: 1068 ELKEFIS 1074

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255563252|ref|XP_002522629.1| Disease resistance protein RPS5, putative [Ricinus communis] gi|223538105|gb|EEF39716.1| Disease resistance protein RPS5, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224083434|ref|XP_002307025.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222856474|gb|EEE94021.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224111284|ref|XP_002332949.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834261|gb|EEE72738.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224143316|ref|XP_002336027.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222838884|gb|EEE77235.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|296087872|emb|CBI35155.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255542484|ref|XP_002512305.1| phosphoprotein phosphatase, putative [Ricinus communis] gi|223548266|gb|EEF49757.1| phosphoprotein phosphatase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255574526|ref|XP_002528174.1| Disease resistance protein RFL1, putative [Ricinus communis] gi|223532386|gb|EEF34181.1| Disease resistance protein RFL1, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224110992|ref|XP_002332999.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834484|gb|EEE72961.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224125154|ref|XP_002319513.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222857889|gb|EEE95436.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query686
TAIR|locus:2131689919 AT4G27220 [Arabidopsis thalian 0.692 0.516 0.264 1.6e-29
TAIR|locus:2136447985 AT4G27190 [Arabidopsis thalian 0.596 0.415 0.254 5e-21
TAIR|locus:2005517909 RPS2 "RESISTANT TO P. SYRINGAE 0.139 0.105 0.281 2.7e-11
TAIR|locus:2153474874 AT5G05400 [Arabidopsis thalian 0.278 0.218 0.235 1.5e-06
TAIR|locus:2034765884 AT1G12290 [Arabidopsis thalian 0.132 0.102 0.306 1.6e-06
MGI|MGI:1333744 734 Gp1ba "glycoprotein 1b, alpha 0.252 0.235 0.292 1.9e-06
TAIR|locus:2201986885 RFL1 "AT1G12210" [Arabidopsis 0.160 0.124 0.285 1.7e-05
TAIR|locus:2171579843 AT5G47250 [Arabidopsis thalian 0.572 0.466 0.247 2.7e-05
TAIR|locus:2201996889 RPS5 "AT1G12220" [Arabidopsis 0.135 0.104 0.323 4e-05
TAIR|locus:2091662 1424 AT3G14460 [Arabidopsis thalian 0.265 0.127 0.297 4.8e-05
TAIR|locus:2131689 AT4G27220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 359 (131.4 bits), Expect = 1.6e-29, P = 1.6e-29
 Identities = 131/496 (26%), Positives = 220/496 (44%)

Query:     2 DLLKYGTGLHIFKGTYTMQETRDRLYALVHKLKDYCLLLDGPTEDWIRMHDLVREVAISI 61
             +L+ Y     +  G +  ++  +    LV +LKD CLL DG + D ++MHD+VR+ AI  
Sbjct:   383 ELIMYWVAEGLLDGQHHYEDMMNEGVTLVERLKDSCLLEDGDSCDTVKMHDVVRDFAIWF 442

Query:    62 ASRDR---HVFMLRNDIQIEWPVADMLKNCPTIFLHDCKHWEVPEG-LEYPQLEFFCMSP 117
              S      H  ++     IE+P    + +   + L   K   +P   +E  +     +  
Sbjct:   443 MSSQGEGFHSLVMAGRGLIEFPQDKFVSSVQRVSLMANKLERLPNNVIEGVETLVLLLQG 502

Query:   118 RDHSIKIPNHVFAGMSNLRGLALSNMQXXXXXXXXXXXXXXQTLCLDRCA-LGDIAIIGN 176
               H  ++PN       NLR L LS ++              ++L L  C  L ++  + +
Sbjct:   503 NSHVKEVPNGFLQAFPNLRILDLSGVRIRTLPDSFSNLHSLRSLVLRNCKKLRNLPSLES 562

Query:   177 LKKLEILSLVDSNIEQLPEEMAQLTQLRLFDLSGCSKLKVIPPNLLSGLSRLEDLYMGNT 236
             L KL+ L L +S I +LP  +  L+ LR   +S   +L+ IP   +  LS LE L M  +
Sbjct:   563 LVKLQFLDLHESAIRELPRGLEALSSLRYICVSNTYQLQSIPAGTILQLSSLEVLDMAGS 622

Query:   237 SVKWEFEGLNVGRSNASLQELKLLSHLTTLEIQICDAMILPKGLFS--KKLERYKIFIGD 294
             +  W  +G       A+L E+  L HL  L I++ D +       S  K+L +++     
Sbjct:   623 AYSWGIKG-EEREGQATLDEVTCLPHLQFLAIKLLDVLSFSYEFDSLTKRLTKFQFLFSP 681

Query:   295 EWDWSGNYKNKRVLKLK-LYTSN--VDEVIMQLKGIEELYLDEVPGIKNVLYDLDIEGFL 351
                 S     +  L +  +  SN  +  ++  +  ++  Y + + G+   L       F+
Sbjct:   682 IRSVSPPGTGEGCLAISDVNVSNASIGWLLQHVTSLDLNYCEGLNGMFENLVTKSKSSFV 741

Query:   352 QLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVLHNLIHLEKIC-LGQLRAESFYKLK 410
              +K L +   P +     S    + + F  LE L L N ++LE I  L         KLK
Sbjct:   742 AMKALSIHYFPSLSLA--SGCESQLDLFPNLEELSLDN-VNLESIGELNGFLGMRLQKLK 798

Query:   411 IIKVRNCDKLKNIFSFSFVRG-LPQLQTLNVINCKNMKEIFTVGRENDVD-CHEVDKIEF 468
             +++V  C +LK +FS   + G LP LQ + V++C  ++E+F       VD C E      
Sbjct:   799 LLQVSGCRQLKRLFSDQILAGTLPNLQEIKVVSCLRLEELFNFSSV-PVDFCAES---LL 854

Query:   469 SQLHSLTLKFLPQLTS 484
              +L  + LK+LPQL S
Sbjct:   855 PKLTVIKLKYLPQLRS 870
GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2136447 AT4G27190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005517 RPS2 "RESISTANT TO P. SYRINGAE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153474 AT5G05400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034765 AT1G12290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
MGI|MGI:1333744 Gp1ba "glycoprotein 1b, alpha polypeptide" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
TAIR|locus:2201986 RFL1 "AT1G12210" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171579 AT5G47250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201996 RPS5 "AT1G12220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.03110007
cc-nbs-lrr resistance protein (1315 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query686
PLN03210 1153 PLN03210, PLN03210, Resistant to P 4e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 8e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-04
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.002
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 0.002
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information 
 Score = 53.3 bits (128), Expect = 4e-07
 Identities = 70/255 (27%), Positives = 103/255 (40%), Gaps = 52/255 (20%)

Query: 393 LEKICLGQLRAESFYKLKIIKVRNCDKLKNIFSFSFVRGLPQLQTLNVINCKNMKE---- 448
           LEK+  G     S   L+ I +R    LK I   S       L+TL + +C ++ E    
Sbjct: 623 LEKLWDG---VHSLTGLRNIDLRGSKNLKEIPDLSMA---TNLETLKLSDCSSLVELPSS 676

Query: 449 IFTVGRENDVDCHEVDKIE-------FSQLHSLTLKFLPQLTSFYSQVKTSAASQTRLKE 501
           I  + +  D+D    + +E          L+ L L    +L SF     ++  S   L E
Sbjct: 677 IQYLNKLEDLDMSRCENLEILPTGINLKSLYRLNLSGCSRLKSFPD--ISTNISWLDLDE 734

Query: 502 LSTHTLPREVILEDECDTLMPFFNEKVVFPNLETLELCAISTEKIWCNQ-----LAAVYS 556
            +    P  + LE                 NL+ L LC + +EK+W        L  + S
Sbjct: 735 TAIEEFPSNLRLE-----------------NLDELILCEMKSEKLWERVQPLTPLMTMLS 777

Query: 557 QNLTRLIVHGCEKLKYLFPSSMIRNFVQLEHLEICYCSSLESIVGKESGEEATTTFVFPK 616
            +LTRL +     L  L PSS I+N  +LEHLEI  C +LE++          T      
Sbjct: 778 PSLTRLFLSDIPSLVEL-PSS-IQNLHKLEHLEIENCINLETL---------PTGINLES 826

Query: 617 VTFLKLWNLSELKTF 631
           +  L L   S L+TF
Sbjct: 827 LESLDLSGCSRLRTF 841

syringae 6; Provisional. Length = 1153
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 686
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.97
PLN032101153 Resistant to P. syringae 6; Provisional 99.9
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.88
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.85
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.84
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.84
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.83
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.83
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.82
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.75
KOG0617264 consensus Ras suppressor protein (contains leucine 99.68
KOG0617264 consensus Ras suppressor protein (contains leucine 99.62
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.5
KOG4237498 consensus Extracellular matrix protein slit, conta 99.47
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.45
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.43
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.41
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.4
KOG4237498 consensus Extracellular matrix protein slit, conta 99.26
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.17
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.12
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.11
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.11
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.1
KOG4341483 consensus F-box protein containing LRR [General fu 99.09
KOG0532722 consensus Leucine-rich repeat (LRR) protein, conta 99.01
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.95
KOG4341483 consensus F-box protein containing LRR [General fu 98.93
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.9
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.81
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.75
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.61
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.54
PLN03150623 hypothetical protein; Provisional 98.51
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.48
PLN03150623 hypothetical protein; Provisional 98.44
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.44
PRK15386 426 type III secretion protein GogB; Provisional 98.36
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.32
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 98.27
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.19
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.17
PRK15386 426 type III secretion protein GogB; Provisional 98.17
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.12
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.05
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.04
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.03
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 98.0
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.83
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.74
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.7
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.65
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 97.64
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.58
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.55
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.55
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.46
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.26
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.19
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.06
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.99
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.75
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.59
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.58
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.34
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.7
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.55
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.5
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 95.24
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.24
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.18
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.34
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 93.26
KOG0473326 consensus Leucine-rich repeat protein [Function un 91.98
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 90.79
smart0037026 LRR Leucine-rich repeats, outliers. 90.79
KOG0473326 consensus Leucine-rich repeat protein [Function un 88.05
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 86.47
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 84.73
smart0037026 LRR Leucine-rich repeats, outliers. 84.73
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.9e-33  Score=331.15  Aligned_cols=510  Identities=18%  Similarity=0.131  Sum_probs=301.3

Q ss_pred             CCCCEEEecCCCCccC-CC-CCCCCCCcEEEecCCccCCccChhhhhCCCCCcEEEecCCCCcc-CCcccCCCCCCcEEE
Q 005639           86 KNCPTIFLHDCKHWEV-PE-GLEYPQLEFFCMSPRDHSIKIPNHVFAGMSNLRGLALSNMQFLS-LPSLFHLPLNLQTLC  162 (686)
Q Consensus        86 ~~lr~l~l~~~~~~~l-~~-~~~~~~Lr~L~l~~~~~~~~~~~~~f~~l~~Lr~L~L~~~~~~~-lp~~i~~l~~L~~L~  162 (686)
                      .+++.|+++++.+... +. ...+++|++|++++|.+.+.+|..+|.++++||+|++++|.+.. +|.  +.+++|++|+
T Consensus        69 ~~v~~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~  146 (968)
T PLN00113         69 SRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLD  146 (968)
T ss_pred             CcEEEEEecCCCccccCChHHhCCCCCCEEECCCCccCCcCChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEE
Confidence            4577777777776433 22 22777888888888877777777777778888888888877653 442  4577778888


Q ss_pred             ccCCCCCC--chhhcCCCCCcEEEccCCCCc-cccHHHhcCCCCCEEeccCCCCCcccCcccccCCCCCcEEEcCCCccc
Q 005639          163 LDRCALGD--IAIIGNLKKLEILSLVDSNIE-QLPEEMAQLTQLRLFDLSGCSKLKVIPPNLLSGLSRLEDLYMGNTSVK  239 (686)
Q Consensus       163 l~~~~l~~--~~~i~~L~~L~~L~l~~~~l~-~lp~~i~~l~~L~~L~l~~~~~l~~~p~~~i~~L~~L~~L~l~~~~~~  239 (686)
                      +++|.+..  |..++++++|++|++++|.+. .+|..++++++|++|++++|.....+|.. ++++++|++|++++|.+.
T Consensus       147 Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~-l~~l~~L~~L~L~~n~l~  225 (968)
T PLN00113        147 LSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRE-LGQMKSLKWIYLGYNNLS  225 (968)
T ss_pred             CcCCcccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCCCCcCcCChH-HcCcCCccEEECcCCccC
Confidence            87777764  667777778888888777665 67777777777888877777644556655 777777777777777655


Q ss_pred             cccccccccccccchhhhccCCCCcEEEEEecCCc-ccCcccc-ccCccEEEEEEcCc----cCCCCccccceEEEEecC
Q 005639          240 WEFEGLNVGRSNASLQELKLLSHLTTLEIQICDAM-ILPKGLF-SKKLERYKIFIGDE----WDWSGNYKNKRVLKLKLY  313 (686)
Q Consensus       240 ~~~~~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~-~~~~~~~-~~~L~~L~l~~~~~----~~~~~~~~~l~~l~l~~~  313 (686)
                      .           ..+..++.+++|++|++++|... .+|..+. .++|+.|.+..+..    +.......+++.|++..+
T Consensus       226 ~-----------~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n  294 (968)
T PLN00113        226 G-----------EIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDN  294 (968)
T ss_pred             C-----------cCChhHhcCCCCCEEECcCceeccccChhHhCCCCCCEEECcCCeeeccCchhHhhccCcCEEECcCC
Confidence            2           23355667777777777776643 3444332 36666666654332    122233456666666543


Q ss_pred             CC--chHHHHHHhhccceeecccccCccccccccccccccccceEeeccccCceeEEecccccccccccccchhhccCCc
Q 005639          314 TS--NVDEVIMQLKGIEELYLDEVPGIKNVLYDLDIEGFLQLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVLHNLI  391 (686)
Q Consensus       314 ~~--~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~l~~l~~~~~~~~~~~~~~L~~L~l~~~~  391 (686)
                      .-  ........+++|+.|++.++......+.  .+..+++|+.|++.+|.....+|     .....+++|+.|+++++.
T Consensus       295 ~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~--~~~~l~~L~~L~L~~n~l~~~~p-----~~l~~~~~L~~L~Ls~n~  367 (968)
T PLN00113        295 SLSGEIPELVIQLQNLEILHLFSNNFTGKIPV--ALTSLPRLQVLQLWSNKFSGEIP-----KNLGKHNNLTVLDLSTNN  367 (968)
T ss_pred             eeccCCChhHcCCCCCcEEECCCCccCCcCCh--hHhcCCCCCEEECcCCCCcCcCC-----hHHhCCCCCcEEECCCCe
Confidence            21  1111223456677777766544333322  24567777777777665322221     123345667777776543


Q ss_pred             chhhhhcCCCCccccCCccEEEEecCCCCccccchhhhcCCCCCcEEEEeeccCccccccccccCCcccCCCcceeeccc
Q 005639          392 HLEKICLGQLRAESFYKLKIIKVRNCDKLKNIFSFSFVRGLPQLQTLNVINCKNMKEIFTVGRENDVDCHEVDKIEFSQL  471 (686)
Q Consensus       392 ~l~~~~~~~~~~~~~~~L~~L~l~~C~~l~~l~~~~~~~~l~~L~~L~l~~c~~l~~~~~~~~~~~~~~~~~~~~~~~~L  471 (686)
                      --..+   +.....+++|+.|++.++.-...+|.  .+..+++|+.|++.+|.-...++.            ....+++|
T Consensus       368 l~~~~---p~~~~~~~~L~~L~l~~n~l~~~~p~--~~~~~~~L~~L~L~~n~l~~~~p~------------~~~~l~~L  430 (968)
T PLN00113        368 LTGEI---PEGLCSSGNLFKLILFSNSLEGEIPK--SLGACRSLRRVRLQDNSFSGELPS------------EFTKLPLV  430 (968)
T ss_pred             eEeeC---ChhHhCcCCCCEEECcCCEecccCCH--HHhCCCCCCEEECcCCEeeeECCh------------hHhcCCCC
Confidence            11111   11122345666666666543333333  445566666666666543322222            22345555


Q ss_pred             ceEecCccccccccccccccchhhhhccccccccccccccccccccccccccccccccCCcccEEeecccccceecccCc
Q 005639          472 HSLTLKFLPQLTSFYSQVKTSAASQTRLKELSTHTLPREVILEDECDTLMPFFNEKVVFPNLETLELCAISTEKIWCNQL  551 (686)
Q Consensus       472 ~~L~L~~c~~L~~l~~~~~~~~~~~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~i~~~~l~~~~~~~~  551 (686)
                      +.|+++++.--..++..    ....+.|+.+....-   ...        ..++.....++|+.|++++|.+.......+
T Consensus       431 ~~L~Ls~N~l~~~~~~~----~~~l~~L~~L~L~~n---~~~--------~~~p~~~~~~~L~~L~ls~n~l~~~~~~~~  495 (968)
T PLN00113        431 YFLDISNNNLQGRINSR----KWDMPSLQMLSLARN---KFF--------GGLPDSFGSKRLENLDLSRNQFSGAVPRKL  495 (968)
T ss_pred             CEEECcCCcccCccChh----hccCCCCcEEECcCc---eee--------eecCcccccccceEEECcCCccCCccChhh
Confidence            55555543311111100    001112222211100   000        011111235789999999997765444444


Q ss_pred             cccccCCccEEEEecCCCCccccChhHHhhcccccEEEEecccccceeecccccccccccccccccceeecccCCCcCee
Q 005639          552 AAVYSQNLTRLIVHGCEKLKYLFPSSMIRNFVQLEHLEICYCSSLESIVGKESGEEATTTFVFPKVTFLKLWNLSELKTF  631 (686)
Q Consensus       552 ~~~~l~~L~~L~l~~C~~L~~l~p~~~~~~l~~L~~L~i~~c~~L~~~~~~~~~~~~~~~~~~~~L~~L~i~~c~~L~~l  631 (686)
                      .  .+++|+.|++++| ++....|..+ .++++|++|+|++|. ++...       +.....+++|+.|++++|.-...+
T Consensus       496 ~--~l~~L~~L~Ls~N-~l~~~~p~~~-~~l~~L~~L~Ls~N~-l~~~~-------p~~~~~l~~L~~L~Ls~N~l~~~~  563 (968)
T PLN00113        496 G--SLSELMQLKLSEN-KLSGEIPDEL-SSCKKLVSLDLSHNQ-LSGQI-------PASFSEMPVLSQLDLSQNQLSGEI  563 (968)
T ss_pred             h--hhhccCEEECcCC-cceeeCChHH-cCccCCCEEECCCCc-ccccC-------ChhHhCcccCCEEECCCCcccccC
Confidence            4  6889999999996 5555445444 678999999999985 43321       112446789999999998876677


Q ss_pred             ecCCCcCCCCCccEEEEecCCCceecccccc
Q 005639          632 YPGTHTSKWPMLKKLEVYGCDKVKIFTSRFL  662 (686)
Q Consensus       632 ~~~~~~~~~~~L~~L~I~~C~~L~~lp~~~~  662 (686)
                      |....  .+++|++|++++|+-...+|..+.
T Consensus       564 p~~l~--~l~~L~~l~ls~N~l~~~~p~~~~  592 (968)
T PLN00113        564 PKNLG--NVESLVQVNISHNHLHGSLPSTGA  592 (968)
T ss_pred             ChhHh--cCcccCEEeccCCcceeeCCCcch
Confidence            76544  348999999999987778886543

>PLN03210 Resistant to P Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query686
1gwb_B281 Structure Of Glycoprotein 1b Length = 281 1e-06
1u0n_D265 The Ternary Von Willebrand Factor A1-Glycoprotein I 2e-06
1p8v_A279 Crystal Structure Of The Complex Of Platelet Recept 2e-06
3p72_A269 Structure Of Platelet Glycoprotein 1b Alpha With A 2e-06
1m0z_A290 Crystal Structure Of The Von Willebrand Factor Bind 2e-06
1m10_B290 Crystal Structure Of The Complex Of Glycoprotein Ib 2e-06
1sq0_B288 Crystal Structure Of The Complex Of The Wild-Type V 2e-06
1p9a_G290 Crystal Structure Of N-terminal Domain Of Human Pla 7e-04
1ook_G290 Crystal Structure Of The Complex Of Platelet Recept 7e-04
3pmh_G290 Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib 8e-04
>pdb|1GWB|B Chain B, Structure Of Glycoprotein 1b Length = 281 Back     alignment and structure 
Iteration: 1

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/149 (29%), Positives = 66/149 (44%), Gaps = 14/149 (9%)
Query: 161 LCLDRCALGDIAIIGNLKKLEILSLVDSNIEQLPEEMAQLTQLRLFDLSGCSKLKVIPPN 220
           L LDRC L  + + G L  L  L L  + ++ LP     L  L + D+S  ++L  +P  
Sbjct: 61  LNLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVS-FNRLTSLPLG 119
Query: 221 LLSGLSRLEDLYMGNTSVKWEFEGL--------NVGRSNASLQELKL-----LSHLTTLE 267
            L GL  L++LY+    +K    GL         +  +N +L EL       L +L TL 
Sbjct: 120 ALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNNLTELPAGLLNGLENLDTLL 179
Query: 268 IQICDAMILPKGLFSKKLERYKIFIGDEW 296
           +Q      +PKG F   L  +    G+ W
Sbjct: 180 LQENSLYTIPKGFFGSHLLPFAFLHGNPW 208
>pdb|1U0N|D Chain D, The Ternary Von Willebrand Factor A1-Glycoprotein Ibalpha- Botrocetin Complex Length = 265 Back     alignment and structure
>pdb|1P8V|A Chain A, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Alpha-thrombin At 2.6a Length = 279 Back     alignment and structure
>pdb|3P72|A Chain A, Structure Of Platelet Glycoprotein 1b Alpha With A Bound Peptide Inhibitor Length = 269 Back     alignment and structure
>pdb|1M0Z|A Chain A, Crystal Structure Of The Von Willebrand Factor Binding Domain Of Glycoprotein Ib Alpha Length = 290 Back     alignment and structure
>pdb|1M10|B Chain B, Crystal Structure Of The Complex Of Glycoprotein Ib Alpha And The Von Willebrand Factor A1 Domain Length = 290 Back     alignment and structure
>pdb|1SQ0|B Chain B, Crystal Structure Of The Complex Of The Wild-Type Von Willebrand Factor A1 Domain And Glycoprotein Ib Alpha At 2.6 Angstrom Resolution Length = 288 Back     alignment and structure
>pdb|1P9A|G Chain G, Crystal Structure Of N-terminal Domain Of Human Platelet Receptor Glycoprotein Ib-alpha At 1.7 Angstrom Resolution Length = 290 Back     alignment and structure
>pdb|1OOK|G Chain G, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Human Alpha-thrombin Length = 290 Back     alignment and structure
>pdb|3PMH|G Chain G, Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib Interaction With Two Distinct Alpha-Thrombin Sites Length = 290 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query686
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-17
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-10
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-12
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-16
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-13
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-16
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-16
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-12
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-12
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-09
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-13
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-13
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-14
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-14
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-13
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-12
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 4e-13
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-13
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-14
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-12
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-13
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 9e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-13
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-13
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-11
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-09
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-13
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-13
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-13
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-09
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-13
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-08
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 4e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-13
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-11
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 9e-10
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 4e-07
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-12
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-11
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-10
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-09
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-06
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-11
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-10
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-09
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-11
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-11
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-11
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-11
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-11
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-07
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-07
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-11
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-08
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-10
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-09
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-10
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-10
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-08
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-08
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-04
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 9e-10
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 9e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-08
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 7e-08
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-07
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-06
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 9e-07
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 3e-05
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 4e-04
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 5e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 4e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 9e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 7e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 8e-04
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
 Score = 84.1 bits (208), Expect = 5e-17
 Identities = 95/524 (18%), Positives = 169/524 (32%), Gaps = 103/524 (19%)

Query: 107 YPQLEFFCMSPRDHSIKIPNHVFAGMSNLRGLALSNMQFLSLP-SLFHLPLNLQTLCLDR 165
             QL+   +  +   + I    F  + NLR L L + +   L    F    +L  L L  
Sbjct: 47  LEQLQLLELGSQYTPLTIDKEAFRNLPNLRILDLGSSKIYFLHPDAFQGLFHLFELRLYF 106

Query: 166 CALGDIAI----IGNLKKLEILSLVDSNIEQLPEE--MAQLTQLRLFDLSGCSKLKVIPP 219
           C L D  +      NLK L  L L  + I  L       +L  L+  D S   ++ ++  
Sbjct: 107 CGLSDAVLKDGYFRNLKALTRLDLSKNQIRSLYLHPSFGKLNSLKSIDFSSN-QIFLVCE 165

Query: 220 NLLSGLS--RLEDLYMGNTSVK----WEFEGLNVGRSNASLQELKLLSHLTTLEIQICDA 273
           + L  L    L    +   S+      ++        N  L+ L +  +  T+       
Sbjct: 166 HELEPLQGKTLSFFSLAANSLYSRVSVDWGKCMNPFRNMVLEILDVSGNGWTV------- 218

Query: 274 MILPKGLFSKKLERYKIFIGDEWDWSGNYKNKRVLKLKLYTSNVDEV------IMQLKGI 327
                G FS  + + + F               ++       N+ +        +    +
Sbjct: 219 --DITGNFSNAISKSQAFSLIL--------AHHIMGAGFGFHNIKDPDQNTFAGLARSSV 268

Query: 328 EELYLDEVPGIKNVLYDLDIEGFLQLKHLHVQNNPFILFIVDSMAWVRYNAFLLLESLVL 387
             L L         ++ L+   F  LK L V N             + YN    +     
Sbjct: 269 RHLDLS-----HGFVFSLNSRVFETLKDLKVLN-------------LAYNKINKIADEAF 310

Query: 388 HNLIHLEKI-----CLGQLRAESFY---KLKIIKVRNCDKLKNIFSFSFVRGLPQLQTLN 439
           + L +L+ +      LG+L + +FY   K+  I ++    +  I   +F + L +LQTL+
Sbjct: 311 YGLDNLQVLNLSYNLLGELYSSNFYGLPKVAYIDLQKN-HIAIIQDQTF-KFLEKLQTLD 368

Query: 440 VINCKNMKEIFTVGRENDVDCHEVDKIEFSQLHSLTLKFLPQLTSFYSQVKTSAASQTRL 499
           + +   +  I  +    D+            L    L  LP++    + +     S+ RL
Sbjct: 369 LRDN-ALTTIHFIPSIPDIF-----------LSGNKLVTLPKINLTANLIHL---SENRL 413

Query: 500 KELSTHTLP------REVILEDECDTLMPFFNEKVVFPNLETLELCAISTEKIWCNQLAA 553
           + L            + +IL     +           P+LE L L          N L  
Sbjct: 414 ENLDILYFLLRVPHLQILILNQNRFSSCSGDQTPSENPSLEQLFLG--------ENMLQL 465

Query: 554 VYSQNLTRLIVHGCEKLKYL---------FPSSMIRNFVQLEHL 588
            +   L   +  G   L+ L          P  +  +   L  L
Sbjct: 466 AWETELCWDVFEGLSHLQVLYLNHNYLNSLPPGVFSHLTALRGL 509
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query686
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.97
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.97
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.97
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.97
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.96
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.96
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.96
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.95
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.95
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.95
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.95
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.95
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.95
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.94
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.94
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.94
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.94
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.94
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.93
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.93
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.93
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.93
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.92
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.92
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.92
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.91
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.91
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.91
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.89
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.87
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.87
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.86
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.86
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.85
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.85
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.85
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.85
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.85
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.84
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.83
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.83
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.83
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.82
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.82
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.82
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.82
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.81
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.8
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.8
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.8
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.79
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.79
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.79
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.78
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.78
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.77
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.77
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.77
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.76
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.74
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.73
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.73
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.73
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.73
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.73
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.73
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.72
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.72
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.71
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.71
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.7
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.69
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.69
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.67
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.67
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.66
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.66
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.65
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.65
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.64
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.64
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.64
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.64
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.64
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.63
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.63
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.62
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.62
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.62
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.6
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.6
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.59
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.58
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.57
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.57
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.56
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.56
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.55
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.53
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.53
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.52
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.51
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.5
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.49
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.49
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.48
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.48
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.47
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.46
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.46
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.44
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.43
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.42
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.41
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.41
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.38
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.35
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.34
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.34
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.32
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.31
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.3
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.23
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.22
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.22
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.18
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.13
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.11
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.88
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.86
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.83
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.79
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.73
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.55
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.48
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.39
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.37
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.32
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.19
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.15
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.1
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.03
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.01
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 97.96
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.88
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.75
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.24
4gt6_A394 Cell surface protein; leucine rich repeats, putati 96.52
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.03
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 96.02
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.91
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 94.85
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 94.64
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 94.39
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 92.93
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 92.04
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
Probab=100.00  E-value=3e-34  Score=320.77  Aligned_cols=510  Identities=17%  Similarity=0.126  Sum_probs=338.9

Q ss_pred             EEecCcccCcCchhhhcCCCCEEEecCCCCccCCC--CCCCCCCcEEEecCCccCCccChhhhhCCCCCcEEEecCCCCc
Q 005639           69 FMLRNDIQIEWPVADMLKNCPTIFLHDCKHWEVPE--GLEYPQLEFFCMSPRDHSIKIPNHVFAGMSNLRGLALSNMQFL  146 (686)
Q Consensus        69 ~~~~~~~~~~~~~~~~~~~lr~l~l~~~~~~~l~~--~~~~~~Lr~L~l~~~~~~~~~~~~~f~~l~~Lr~L~L~~~~~~  146 (686)
                      +.+.+.....+|. ..+.++++|++++|.+..++.  ...+++|++|++++|.+. .+++..|.++++||+|++++|.+.
T Consensus        16 ~~c~~~~l~~ip~-~~~~~l~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~-~i~~~~~~~l~~L~~L~Ls~n~l~   93 (606)
T 3vq2_A           16 YQCMDQKLSKVPD-DIPSSTKNIDLSFNPLKILKSYSFSNFSELQWLDLSRCEIE-TIEDKAWHGLHHLSNLILTGNPIQ   93 (606)
T ss_dssp             EECTTSCCSSCCT-TSCTTCCEEECTTSCCCEECTTTTTTCTTCCEEECTTCCCC-EECTTTTTTCTTCCEEECTTCCCC
T ss_pred             eEccCCCcccCCC-CCCCCcCEEECCCCCcCEeChhhccCCccCcEEeCCCCccc-ccCHHHhhchhhcCEeECCCCccc
Confidence            4444555555554 456889999999999987765  338999999999999877 565666899999999999999998


Q ss_pred             cC-CcccCCCCCCcEEEccCCCCCC--chhhcCCCCCcEEEccCCCCc--cccHHHhcCCCCCEEeccCCCCCcccCccc
Q 005639          147 SL-PSLFHLPLNLQTLCLDRCALGD--IAIIGNLKKLEILSLVDSNIE--QLPEEMAQLTQLRLFDLSGCSKLKVIPPNL  221 (686)
Q Consensus       147 ~l-p~~i~~l~~L~~L~l~~~~l~~--~~~i~~L~~L~~L~l~~~~l~--~lp~~i~~l~~L~~L~l~~~~~l~~~p~~~  221 (686)
                      .+ |..++++++|++|++++|.+..  +..++++++|++|++++|.+.  .+|..++++++|++|++++|. +..++...
T Consensus        94 ~~~p~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~lp~~~~~l~~L~~L~Ls~n~-l~~~~~~~  172 (606)
T 3vq2_A           94 SFSPGSFSGLTSLENLVAVETKLASLESFPIGQLITLKKLNVAHNFIHSCKLPAYFSNLTNLVHVDLSYNY-IQTITVND  172 (606)
T ss_dssp             CCCTTSSTTCTTCCEEECTTSCCCCSSSSCCTTCTTCCEEECCSSCCCCCCCCGGGGTCTTCCEEECCSSC-CCEECTTT
T ss_pred             ccChhhcCCcccCCEEEccCCccccccccccCCCCCCCEEeCCCCcccceechHhHhhcCCCCEEEccCCc-ceecChhh
Confidence            86 7889999999999999999887  477999999999999999888  578889999999999999987 77776655


Q ss_pred             ccCCCCCc----EEEcCCCccccccccccccccccchhhhccCCCCcEEEEEecCCc--ccCccc-cccCccEEEEEEcC
Q 005639          222 LSGLSRLE----DLYMGNTSVKWEFEGLNVGRSNASLQELKLLSHLTTLEIQICDAM--ILPKGL-FSKKLERYKIFIGD  294 (686)
Q Consensus       222 i~~L~~L~----~L~l~~~~~~~~~~~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~--~~~~~~-~~~~L~~L~l~~~~  294 (686)
                      ++.+++|+    +|++++|.+....+           ..+ ...+|+.|++++|...  ..+..+ ..+.++.+.+....
T Consensus       173 ~~~l~~L~~~l~~L~l~~n~l~~~~~-----------~~~-~~~~L~~L~L~~n~~~~~~~~~~~~~l~~L~~l~l~~~~  240 (606)
T 3vq2_A          173 LQFLRENPQVNLSLDMSLNPIDFIQD-----------QAF-QGIKLHELTLRGNFNSSNIMKTCLQNLAGLHVHRLILGE  240 (606)
T ss_dssp             THHHHHCTTCCCEEECTTCCCCEECT-----------TTT-TTCEEEEEEEESCCSCHHHHHHHHHTTTTCEEEEEEEEC
T ss_pred             hhhhhccccccceeeccCCCcceeCc-----------ccc-cCceeeeeeccCCccchhHHHHHhccccccccccccccc
Confidence            67666665    79998887762221           222 2236888888877643  222222 12555555554332


Q ss_pred             ccCC----------CCccc--cceEEEEecCCCchHHH--HHHhhccceeecccccCccccccccccccccccceEeecc
Q 005639          295 EWDW----------SGNYK--NKRVLKLKLYTSNVDEV--IMQLKGIEELYLDEVPGIKNVLYDLDIEGFLQLKHLHVQN  360 (686)
Q Consensus       295 ~~~~----------~~~~~--~l~~l~l~~~~~~~~~~--~~~~~~L~~L~l~~~~~~~~~~~~~~~~~l~~L~~L~l~~  360 (686)
                      ....          .....  .++.+.+.....+....  ...+++|+.|++.++.. ....   .+..+++|++|++.+
T Consensus       241 ~~~~~~l~~~~~~~~~~l~~l~l~~l~l~~~~~~~~~~~~~~~l~~L~~L~l~~~~~-~~l~---~l~~~~~L~~L~l~~  316 (606)
T 3vq2_A          241 FKDERNLEIFEPSIMEGLCDVTIDEFRLTYTNDFSDDIVKFHCLANVSAMSLAGVSI-KYLE---DVPKHFKWQSLSIIR  316 (606)
T ss_dssp             CTTSCCCSCCCGGGGTTGGGSEEEEEEECCCTTCCGGGGSCGGGTTCSEEEEESCCC-CCCC---CCCTTCCCSEEEEES
T ss_pred             cccCCcccccChHHhhhhhhccHhheeccccccccccccccccCCCCCEEEecCccc-hhhh---hccccccCCEEEccc
Confidence            1110          00011  23444443332221111  34567788888877654 2222   356688889999988


Q ss_pred             ccCceeEEecccccccccccccchhhccCCcchhhhhcCCCCccccCCccEEEEecCCCCcccc-chhhhcCCCCCcEEE
Q 005639          361 NPFILFIVDSMAWVRYNAFLLLESLVLHNLIHLEKICLGQLRAESFYKLKIIKVRNCDKLKNIF-SFSFVRGLPQLQTLN  439 (686)
Q Consensus       361 ~~~l~~l~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~~L~~L~l~~C~~l~~l~-~~~~~~~l~~L~~L~  439 (686)
                      |.. ..+|      .. .+++|+.|.+.++..+..+     ..+.+++|+.|++++| +++..+ ....+..+++|++|+
T Consensus       317 n~l-~~lp------~~-~l~~L~~L~l~~n~~~~~~-----~~~~l~~L~~L~ls~n-~l~~~~~~~~~~~~~~~L~~L~  382 (606)
T 3vq2_A          317 CQL-KQFP------TL-DLPFLKSLTLTMNKGSISF-----KKVALPSLSYLDLSRN-ALSFSGCCSYSDLGTNSLRHLD  382 (606)
T ss_dssp             CCC-SSCC------CC-CCSSCCEEEEESCSSCEEC-----CCCCCTTCCEEECCSS-CEEEEEECCHHHHCCSCCCEEE
T ss_pred             ccC-cccc------cC-CCCccceeeccCCcCccch-----hhccCCCCCEEECcCC-ccCCCcchhhhhccCCcccEeE
Confidence            874 4433      12 6788888888887544322     3456888888888885 445442 112567788888888


Q ss_pred             EeeccCccccccccccCCcccCCCcceeecccceEecCccccccccccccccchhhhhcccccccccccccccccccccc
Q 005639          440 VINCKNMKEIFTVGRENDVDCHEVDKIEFSQLHSLTLKFLPQLTSFYSQVKTSAASQTRLKELSTHTLPREVILEDECDT  519 (686)
Q Consensus       440 l~~c~~l~~~~~~~~~~~~~~~~~~~~~~~~L~~L~L~~c~~L~~l~~~~~~~~~~~~~l~~l~~~~~~~~~~~~~~~~~  519 (686)
                      +++|. +..++.            ....+++|+.|+++++.--...+...   -...+.|+.+....-   ...+     
T Consensus       383 L~~n~-l~~~~~------------~~~~l~~L~~L~l~~n~l~~~~~~~~---~~~l~~L~~L~l~~n---~l~~-----  438 (606)
T 3vq2_A          383 LSFNG-AIIMSA------------NFMGLEELQHLDFQHSTLKRVTEFSA---FLSLEKLLYLDISYT---NTKI-----  438 (606)
T ss_dssp             CCSCS-EEEECC------------CCTTCTTCCEEECTTSEEESTTTTTT---TTTCTTCCEEECTTS---CCEE-----
T ss_pred             CCCCc-cccchh------------hccCCCCCCeeECCCCccCCccChhh---hhccccCCEEECcCC---CCCc-----
Confidence            88765 444442            23457778888887764222211000   011123333322111   0000     


Q ss_pred             ccccccccccCCcccEEeecccccce-ecccCccccccCCccEEEEecCCCCccccChhHHhhcccccEEEEecccccce
Q 005639          520 LMPFFNEKVVFPNLETLELCAISTEK-IWCNQLAAVYSQNLTRLIVHGCEKLKYLFPSSMIRNFVQLEHLEICYCSSLES  598 (686)
Q Consensus       520 ~~~~~~~~~~~~~L~~L~i~~~~l~~-~~~~~~~~~~l~~L~~L~l~~C~~L~~l~p~~~~~~l~~L~~L~i~~c~~L~~  598 (686)
                        ........+++|++|++++|.++. +....+.  .+++|++|++++| ++..++| ..+..+++|++|++++| .++.
T Consensus       439 --~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~--~l~~L~~L~Ls~n-~l~~~~~-~~~~~l~~L~~L~Ls~N-~l~~  511 (606)
T 3vq2_A          439 --DFDGIFLGLTSLNTLKMAGNSFKDNTLSNVFA--NTTNLTFLDLSKC-QLEQISW-GVFDTLHRLQLLNMSHN-NLLF  511 (606)
T ss_dssp             --CCTTTTTTCTTCCEEECTTCEEGGGEECSCCT--TCTTCCEEECTTS-CCCEECT-TTTTTCTTCCEEECCSS-CCSC
T ss_pred             --cchhhhcCCCCCCEEECCCCcCCCcchHHhhc--cCCCCCEEECCCC-cCCccCh-hhhcccccCCEEECCCC-cCCC
Confidence              011224568999999999997775 3333344  6899999999997 7777745 44478999999999999 5665


Q ss_pred             eecccccccccccccccccceeecccCCCcCeeecCCCcCCCC-CccEEEEecCC
Q 005639          599 IVGKESGEEATTTFVFPKVTFLKLWNLSELKTFYPGTHTSKWP-MLKKLEVYGCD  652 (686)
Q Consensus       599 ~~~~~~~~~~~~~~~~~~L~~L~i~~c~~L~~l~~~~~~~~~~-~L~~L~I~~C~  652 (686)
                      +..       .....+++|+.|++++|. ++.+|....  .++ +|++|+++++|
T Consensus       512 ~~~-------~~~~~l~~L~~L~l~~N~-l~~~p~~~~--~l~~~L~~l~l~~N~  556 (606)
T 3vq2_A          512 LDS-------SHYNQLYSLSTLDCSFNR-IETSKGILQ--HFPKSLAFFNLTNNS  556 (606)
T ss_dssp             EEG-------GGTTTCTTCCEEECTTSC-CCCEESCGG--GSCTTCCEEECCSCC
T ss_pred             cCH-------HHccCCCcCCEEECCCCc-CcccCHhHh--hhcccCcEEEccCCC
Confidence            521       234578899999999985 888887632  345 59999998865
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 686
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-08
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 7e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.004
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 5e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 9e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.004
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

 Score = 55.4 bits (132), Expect = 1e-08
 Identities = 29/171 (16%), Positives = 60/171 (35%), Gaps = 28/171 (16%)

Query: 86  KNCPTIFLHDCKHWEVPEGLEYPQLEFFCMSPRDHSIKIPNHVFAGMSNLRGLALSNMQF 145
            N   + L+  +  ++        L    ++    S   P    +G++ L  L L   Q 
Sbjct: 219 TNLDELSLNGNQLKDIGTLASLTNLTDLDLANNQISNLAP---LSGLTKLTELKLGANQI 275

Query: 146 LSLPSLFHLPLN---------------------LQTLCLDRCALGDIAIIGNLKKLEILS 184
            ++  L  L                        L  L L    + DI+ + +L KL+ L 
Sbjct: 276 SNISPLAGLTALTNLELNENQLEDISPISNLKNLTYLTLYFNNISDISPVSSLTKLQRLF 335

Query: 185 LVDSNIEQLPEEMAQLTQLRLFDLSGCSKLKVIPPNLLSGLSRLEDLYMGN 235
             ++ +  +   +A LT +         ++  + P  L+ L+R+  L + +
Sbjct: 336 FANNKVSDVSS-LANLTNINWLSAGHN-QISDLTP--LANLTRITQLGLND 382
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query686
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.84
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.82
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.73
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.72
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.7
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.7
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.68
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.67
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.66
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.66
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.66
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.65
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.63
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.63
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.62
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.57
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.5
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.5
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.49
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.49
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.44
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.39
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.37
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.35
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.35
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.3
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.23
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.17
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.03
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.92
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.87
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.83
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.72
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.44
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.91
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.63
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.2
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.03
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.54
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.52
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.84  E-value=1.3e-19  Score=187.56  Aligned_cols=341  Identities=21%  Similarity=0.213  Sum_probs=184.7

Q ss_pred             CCCCCcEEEecCCCCccCCcccCCCCCCcEEEccCCCCCCchhhcCCCCCcEEEccCCCCccccHHHhcCCCCCEEeccC
Q 005639          131 GMSNLRGLALSNMQFLSLPSLFHLPLNLQTLCLDRCALGDIAIIGNLKKLEILSLVDSNIEQLPEEMAQLTQLRLFDLSG  210 (686)
Q Consensus       131 ~l~~Lr~L~L~~~~~~~lp~~i~~l~~L~~L~l~~~~l~~~~~i~~L~~L~~L~l~~~~l~~lp~~i~~l~~L~~L~l~~  210 (686)
                      .+.+|++|+++++.++++. +++.+++|++|++++|++++++.++++++|++|++++|.+..++ .++++++|+.|++.+
T Consensus        42 ~l~~l~~L~l~~~~I~~l~-gl~~L~nL~~L~Ls~N~l~~l~~l~~L~~L~~L~L~~n~i~~i~-~l~~l~~L~~L~~~~  119 (384)
T d2omza2          42 DLDQVTTLQADRLGIKSID-GVEYLNNLTQINFSNNQLTDITPLKNLTKLVDILMNNNQIADIT-PLANLTNLTGLTLFN  119 (384)
T ss_dssp             HHTTCCEEECCSSCCCCCT-TGGGCTTCCEEECCSSCCCCCGGGTTCTTCCEEECCSSCCCCCG-GGTTCTTCCEEECCS
T ss_pred             HhCCCCEEECCCCCCCCcc-ccccCCCCCEEeCcCCcCCCCccccCCccccccccccccccccc-ccccccccccccccc
Confidence            3456677777777666653 46666677777777766666445666666666666666666655 266666666666665


Q ss_pred             CCCCcccCcccccCCCCCcEEEcCCCccccccccccccccccchhhhccCCCCcEEEEEecCCcccCccccccCccEEEE
Q 005639          211 CSKLKVIPPNLLSGLSRLEDLYMGNTSVKWEFEGLNVGRSNASLQELKLLSHLTTLEIQICDAMILPKGLFSKKLERYKI  290 (686)
Q Consensus       211 ~~~l~~~p~~~i~~L~~L~~L~l~~~~~~~~~~~~~~~~~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~L~~L~l  290 (686)
                      +. ...++.  ......+..+....+.+..             ..........+........ ....             
T Consensus       120 ~~-~~~~~~--~~~~~~~~~~~~~~~~l~~-------------~~~~~~~~~~~~~~~~~~~-~~~~-------------  169 (384)
T d2omza2         120 NQ-ITDIDP--LKNLTNLNRLELSSNTISD-------------ISALSGLTSLQQLSFGNQV-TDLK-------------  169 (384)
T ss_dssp             SC-CCCCGG--GTTCTTCSEEEEEEEEECC-------------CGGGTTCTTCSEEEEEESC-CCCG-------------
T ss_pred             cc-cccccc--ccccccccccccccccccc-------------ccccccccccccccccccc-chhh-------------
Confidence            54 444443  3334444444433322210             0000011111111110000 0000             


Q ss_pred             EEcCccCCCCccccceEEEEecCCCchHHHHHHhhccceeecccccCccccccccccccccccceEeeccccCceeEEec
Q 005639          291 FIGDEWDWSGNYKNKRVLKLKLYTSNVDEVIMQLKGIEELYLDEVPGIKNVLYDLDIEGFLQLKHLHVQNNPFILFIVDS  370 (686)
Q Consensus       291 ~~~~~~~~~~~~~~l~~l~l~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~l~~L~~L~l~~~~~l~~l~~~  370 (686)
                             ....                      ..............    ........+++++.+.++++. ++.+   
T Consensus       170 -------~~~~----------------------~~~~~~~~~~~~~~----~~~~~~~~l~~~~~l~l~~n~-i~~~---  212 (384)
T d2omza2         170 -------PLAN----------------------LTTLERLDISSNKV----SDISVLAKLTNLESLIATNNQ-ISDI---  212 (384)
T ss_dssp             -------GGTT----------------------CTTCCEEECCSSCC----CCCGGGGGCTTCSEEECCSSC-CCCC---
T ss_pred             -------hhcc----------------------cccccccccccccc----ccccccccccccceeeccCCc-cCCC---
Confidence                   0000                      00000001101000    001123456666777666654 2211   


Q ss_pred             ccccccccccccchhhccCCcchhhhhcCCCCccccCCccEEEEecCCCCccccchhhhcCCCCCcEEEEeeccCccccc
Q 005639          371 MAWVRYNAFLLLESLVLHNLIHLEKICLGQLRAESFYKLKIIKVRNCDKLKNIFSFSFVRGLPQLQTLNVINCKNMKEIF  450 (686)
Q Consensus       371 ~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~~~~L~~L~l~~C~~l~~l~~~~~~~~l~~L~~L~l~~c~~l~~~~  450 (686)
                         ......++|++|.+.++. ++.+    .....+++|+.|++.+| .++.+++   +..+++|++|+++++. +..++
T Consensus       213 ---~~~~~~~~L~~L~l~~n~-l~~~----~~l~~l~~L~~L~l~~n-~l~~~~~---~~~~~~L~~L~l~~~~-l~~~~  279 (384)
T d2omza2         213 ---TPLGILTNLDELSLNGNQ-LKDI----GTLASLTNLTDLDLANN-QISNLAP---LSGLTKLTELKLGANQ-ISNIS  279 (384)
T ss_dssp             ---GGGGGCTTCCEEECCSSC-CCCC----GGGGGCTTCSEEECCSS-CCCCCGG---GTTCTTCSEEECCSSC-CCCCG
T ss_pred             ---CcccccCCCCEEECCCCC-CCCc----chhhcccccchhccccC-ccCCCCc---ccccccCCEeeccCcc-cCCCC
Confidence               123345667777766653 2222    12345778888888886 4666654   4567888888887654 33333


Q ss_pred             cccccCCcccCCCcceeecccceEecCccccccccccccccchhhhhccccccccccccccccccccccccccccccccC
Q 005639          451 TVGRENDVDCHEVDKIEFSQLHSLTLKFLPQLTSFYSQVKTSAASQTRLKELSTHTLPREVILEDECDTLMPFFNEKVVF  530 (686)
Q Consensus       451 ~~~~~~~~~~~~~~~~~~~~L~~L~L~~c~~L~~l~~~~~~~~~~~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~  530 (686)
                      .             ...++.++.+.+.++. ++.                                       +.....+
T Consensus       280 ~-------------~~~~~~l~~l~~~~n~-l~~---------------------------------------~~~~~~~  306 (384)
T d2omza2         280 P-------------LAGLTALTNLELNENQ-LED---------------------------------------ISPISNL  306 (384)
T ss_dssp             G-------------GTTCTTCSEEECCSSC-CSC---------------------------------------CGGGGGC
T ss_pred             c-------------cccccccccccccccc-ccc---------------------------------------ccccchh
Confidence            2             2345566666655432 111                                       1122467


Q ss_pred             CcccEEeecccccceecccCccccccCCccEEEEecCCCCccccChhHHhhcccccEEEEecccccceeecccccccccc
Q 005639          531 PNLETLELCAISTEKIWCNQLAAVYSQNLTRLIVHGCEKLKYLFPSSMIRNFVQLEHLEICYCSSLESIVGKESGEEATT  610 (686)
Q Consensus       531 ~~L~~L~i~~~~l~~~~~~~~~~~~l~~L~~L~l~~C~~L~~l~p~~~~~~l~~L~~L~i~~c~~L~~~~~~~~~~~~~~  610 (686)
                      ++++.|++++|+++.+..  ..  .+++|++|++++| +++.+ +  .+.++++|++|++++| +++.++         +
T Consensus       307 ~~l~~L~ls~n~l~~l~~--l~--~l~~L~~L~L~~n-~l~~l-~--~l~~l~~L~~L~l~~N-~l~~l~---------~  368 (384)
T d2omza2         307 KNLTYLTLYFNNISDISP--VS--SLTKLQRLFFANN-KVSDV-S--SLANLTNINWLSAGHN-QISDLT---------P  368 (384)
T ss_dssp             TTCSEEECCSSCCSCCGG--GG--GCTTCCEEECCSS-CCCCC-G--GGGGCTTCCEEECCSS-CCCBCG---------G
T ss_pred             cccCeEECCCCCCCCCcc--cc--cCCCCCEEECCCC-CCCCC-h--hHcCCCCCCEEECCCC-cCCCCh---------h
Confidence            888899999887776542  23  6889999999987 78776 2  2467899999999888 577762         2


Q ss_pred             cccccccceeeccc
Q 005639          611 TFVFPKVTFLKLWN  624 (686)
Q Consensus       611 ~~~~~~L~~L~i~~  624 (686)
                      ...+++|+.|+|++
T Consensus       369 l~~l~~L~~L~L~~  382 (384)
T d2omza2         369 LANLTRITQLGLND  382 (384)
T ss_dssp             GTTCTTCSEEECCC
T ss_pred             hccCCCCCEeeCCC
Confidence            45788999999876
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure