Citrus Sinensis ID: 005709

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-

MGENIKIGTPTITPNIKKRLQQRKVLIVLDDVDDNSKNFAGGLELFSPGSRIIITTRDKRLLDKRRVENVYEVKGLKHNSALELFCRKAFRQNNRSPDLLELSEEVAHYANGNPLALQVLGSSLYQKSKEQWKDKLRKLKLITDPNIYKVLKISYDGLNWEEKEIFLDVACFFKGEDVDFVTRVQDDPTSMHNGLNTLVEMSLITISANRLQMHDILQELGKTIILQESFKEPGKRSKLWDHKDVYQVLKKNKGTDAIEGIFFDLSKINYLHLSPQAFANMSSLTLLKFYMPECNGVPIMSSKLHLNQDLEYLPKKLRYLHWHEYPLKTLPFSFEPNYLIELNLPYSKVEQIWIGEKKAFKLKFINLYNSRYLTRLPEFSEIPNLERINLSGSELERLPATIKQFSQLRYLYLRNCNMLQSLPELPLLLSHLDASNCKRLQSLPEISSCLEELDISILEKLSKTTFPIKHGCSLMQFEFQNCWELKENKILEDSELRIQHMAIASLRLFYEKEQLYCPSILLPGSEIPKWFAFQNIGPLIALQLPEHCLINLIGFALCAVIDFKHLPSNSWDSFNINCGIYIKMNKPEDLSFNCFLASIRDAIDSDHVILGFSPLGIGGFPVGGGNHNTTVLVDFFPAKVKCCGVSPVYADPNKTEPKTFTLKFAAEIGKLDDKASKIESK

cccccEEcccccHHHHHHHHccccEEEEEccccHHHHHHHccccccccccEEEEEEccHHHHHccccccEEEcccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccccHHHHHHcccccccHHHHHHHHHHHHcccccHHHHHHEEcccccccccccEEEEEEEccccccHHHHHHHHcccccccccHHHHcccccEEEEccEEEEcHHHHHHHHHHHHccccccccccccccccHHHHHHHccccccccEEEEEEcccccEEEEEcHHHHHccccccEEEEEccccccccccccEEEccccccccccccEEEEEccccccccccccccccEEEEEccccccEEccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccEEEcccccccccccccccccccccccccccEEEEEccccccccccEEEccccccccccccccHHHHHHHHHHHHHHHHccccccccccEEEcccccccccccccccccEEEEEcccccccccEEEEEEEEEEcccccccccccEEEEEEEEEEcccccccEEEEEEccccccccccEEEEEEccccccccccccccccEEEEEEEccEEEEEEEEEEEEEcccccccccccccccccccccccccHHHHcc

cccccEEccHHHHHHHHHHHHcccEEEEEccHHHHHHHHHccccccccccEEEEEEccHHHHHHccccEEEEEccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHEEEccccccHHHHHHHHHHHHHHccccHHHHHHHHHccccHHHHHHHHHHccEEEEccccEEHHHHHHHHHHHHHHccccccccccEEEccHHHHHHHHHccccccEEEEEEEEcccccEEEccHHHHHHcccccEEEEEcccccccccccccEccccccHccccccEEEEEcccccccccccccHHHEEEEEccccccHcccccccccccccEEEccccccccccccccccccccEEEccccccEEccccHHHHHHccEEcccccccHcccccccccccEEEcccccHHcccccccccHHHHHHccccccccccccHHHcccccEEEcccccccccccccccHHHcHccccccccccccHHHcccccEEEcccccccHHEEEcccccEEEEEcccccccccccEEEEEEEEccccccccccEEEEEEEEEEcccccccEEEccccccccccccccEEEEEEcccccHcccccccccccEEEEEEEcEEEEEcEEEEEEEccccccccccccccccccccHHHcccHcccc

mgenikigtptitpNIKKRLQQRKVLIVLDdvddnsknfagglelfspgsriiittrdkrlldkrrVENVYEVKGLKHNSALELFCRKAFrqnnrspdllELSEEVAHYANGNPLALQVLGSSLYQKSKEQWKDKLRKLklitdpniYKVLKISYDGLNWEEKEIFLDVacffkgedvdfvtrvqddptsmhngLNTLVEMSLITISANRLQMHDILQELGKTIIlqesfkepgkrsklwdhKDVYQVLKknkgtdaieGIFFdlskinylhlspqAFANMSSLTLLKFympecngvpimssklhlnqdleylpkklrylhwheyplktlpfsfepnylielnlpyskveqIWIGEKKAFKLKFINLYNSryltrlpefseipnlerinlsgselerlpATIKQFSQLRYLYLRNCNmlqslpelplllshldasnckrlqslpeISSCLEELDISILEKLskttfpikhgcslMQFEFQNCWElkenkiledSELRIQHMAIASLRLFYEKEQlycpsillpgseipkwfafqnigplialqlpeHCLINLIGFALCAVidfkhlpsnswdsfnincgiyikmnkpedlsfnCFLASIrdaidsdhvilgfsplgiggfpvgggnhnttVLVDffpakvkccgvspvyadpnktepktFTLKFAAEIGklddkaskiesk

mgenikigtptitpnikkrlQQRKVLIVLddvddnsknfagglelfspgsriiittrdkrlldkrrVENVyevkglkhnsalELFCRKAFRQNNRSPDLLELSEEVAHYANGNPLALQVLGSSLYQKSKEQWKDKLrklklitdpniykVLKISYDGLNWEEKEIFLDVACFFKGEDVDFVTRVQDDPTSMHNGLNTLVEMSLITISANRLQMHDILQELGKTIILQEsfkepgkrsklwdhKDVYQVLKKNKGTDAIEGIFFDLSKINYLHLSPQAFANMSSLTLLKFYMPECNGVPIMSSKLHLNQDLEYLPKKLRYLHWHEYPLKTLPFSFEPNYLIELNLPYSKVEQIWIGEKKAFKLKFINLYNSRYLtrlpefseipnLERINLSGSELERLPATIKQFSQLRYLYLRNCNMLQSLPELPLLLSHLDASNCKRLQSLPEISSCLEELDISILEKLSKTTFPIKHGCSLMQFEFQNCWELKENKILEDSELRIQHMAIASLRLFYEKEQLYCPSILLPGSEIPKWFAFQNIGPLIALQLPEHCLINLIGFALCAVIDFKHLPSNSWDSFNINCGIYIKMNKPEDLSFNCFLASIRDAIDSDHVILGFSPLGIGGFPVGGGNHNTTVLVDFFPAKVKCCGVSpvyadpnktepktFTLKFAAeigklddkaskiesk

MGENIKIGTPTITPNIKKRLQQRKVLIVLDDVDDNSKNFAGGLELFSPGSRIIITTRDKRLLDKRRVENVYEVKGLKHNSALELFCRKAFRQNNRSPDLLELSEEVAHYANGNPLALQVLGSSLYQKSKEQWKDKLRKLKLITDPNIYKVLKISYDGLNWEEKEIFLDVACFFKGEDVDFVTRVQDDPTSMHNGLNTLVEMSLITISANRLQMHDILQELGKTIILQESFKEPGKRSKLWDHKDVYQVLKKNKGTDAIEGIFFDLSKINYLHLSPQAFANMSSLTLLKFYMPECNGVPIMSSKLHLNQDLEYLPKKLRYLHWHEYPLKTLPFSFEPNYLIELNLPYSKVEQIWIGEKKAFKLKFINLYNSRYLTRLPEFSEIPNLERINLSGSELERLPATIKQFSQLRYLYLRNCNMlqslpelplllshlDASNCKRLQSLPEISSCLEELDISILEKLSKTTFPIKHGCSLMQFEFQNCWELKENKILEDSELRIQHMAIASLRLFYEKEQLYCPSILLPGSEIPKWFAFQNIGPLIALQLPEHCLINLIGFALCAVIDFKHLPSNSWDSFNINCGIYIKMNKPEDLSFNCFLASIRDAIDSDHVILGFSPLgiggfpvgggNHNTTVLVDFFPAKVKCCGVSPVYADPNKTEPKTFTLKFAAEIGKLDDKASKIESK

************TPNIKKRLQQRKVLIVLDDVDDNSKNFAGGLELFSPGSRIIITTRDKRLLDKRRVENVYEVKGLKHNSALELFCRKAFRQNN***DLLELSEEVAHYANGNPLALQVLGSSLYQKSKEQWKDKLRKLKLITDPNIYKVLKISYDGLNWEEKEIFLDVACFFKGEDVDFVTRVQDDPTSMHNGLNTLVEMSLITISANRLQMHDILQELGKTIILQESFKEPGKRSKLWDHKDVYQVLKKNKGTDAIEGIFFDLSKINYLHLSPQAFANMSSLTLLKFYMPECNGVPIMSSKLHLNQDLEYLPKKLRYLHWHEYPLKTLPFSFEPNYLIELNLPYSKVEQIWIGEKKAFKLKFINLYNSRYLTRLPEFSEIPNLERINLSGSELERLPATIKQFSQLRYLYLRNCNMLQSLPELPLLLSHLDASNCKRLQSLPEISSCLEELDISILEKLSKTTFPIKHGCSLMQFEFQNCWELKENKILEDSELRIQHMAIASLRLFYEKEQLYCPSILLPGSEIPKWFAFQNIGPLIALQLPEHCLINLIGFALCAVIDFKHLPSNSWDSFNINCGIYIKMNKPEDLSFNCFLASIRDAIDSDHVILGFSPLGIGGFPVGGGNHNTTVLVDFFPAKVKCCGVSPVYADPN****KTFTLKFAAE**************

**ENIKIGTPTITPNIKKRLQQRKVLIVLDDVDDNSKNFAGGLELFSPGSRIIITTRDKRLLDKRRVENVYEVKGLKHNSALELFCRKAFRQNNRSPDLLELSEEVAHYANGNPLALQVLGSSLYQKSKEQWKDKLRKLKLITDPNIYKVLKISYDGLNWEEKEIFLDVACFFKGEDVDFVTRVQDDPTSMHNGLNTLVEMSLITISANRLQMHDILQELGKTIILQESFKEPGKRSKLWDHKDVYQVLKKNKGTDAIEGIFFDLSKINYLHLSPQAFANMSSLTLLKFYMPECNGVPIMSSKLHLNQDLEYLPKKLRYLHWHEYPLKTLPFSFEPNYLIELNLPYSKVEQIWIGEKKAFKLKFINLYNSRYLTRLPEFSEIPNLERINLSGSELERLPATIKQFSQLRYLYLRNCNMLQSLPELPLLLSHLDASNCKRLQSLPEISSCLEELDISILEKLSKTTFPIKHGCSLMQFEFQNCWELKENKILEDSELRIQHMAIASLRLFYEKEQLYCPSILLPGSEIPKWFAFQNIGPLIALQLPEHCLINLIGFALCAVIDFKHLPSNSWDSFNINCGIYIKMNKPEDLSFNCFLASIRDAIDSDHVILGFSPLGIGGFPVGGGNHNTTVLVDFFPAKVKCCGVSPVYADP*****************************

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		681	2.2.26 [Sep-21-2011]
O82500		1095	Putative disease resistan	no	no	0.637	0.396	0.392	3e-72
Q9FL92		1372	Probable WRKY transcripti	no	no	0.691	0.343	0.349	3e-67
Q9SZ67		1895	Probable WRKY transcripti	no	no	0.631	0.226	0.380	2e-66
Q40392		1144	TMV resistance protein N	N/A	no	0.607	0.361	0.367	4e-66
O23530		1301	Protein SUPPRESSOR OF npr	no	no	0.621	0.325	0.358	1e-64
Q9FH83		1288	Probable WRKY transcripti	no	no	0.596	0.315	0.360	3e-64
Q9FKN7		1613	Protein DA1-related 4 OS=	no	no	0.600	0.253	0.324	2e-46
Q9FLB4		874	Putative disease resistan	no	no	0.544	0.424	0.266	2e-16
Q9FKZ1		809	Probable disease resistan	no	no	0.619	0.521	0.243	9e-14
Q9LRR5		1424	Putative disease resistan	no	no	0.560	0.268	0.242	6e-13

>sp\|O82500\|Y4117_ARATH Putative disease resistance protein At4g11170 OS=Arabidopsis thaliana GN=At4g11170 PE=2 SV=1	Back alignment and function desciption

 Score =  273 bits (698), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 178/454 (39%), Positives = 265/454 (58%), Gaps = 20/454 (4%)

Query: 16  IKKRLQQRKVLIVLDDVD--DNSKNFAGGLELFSPGSRIIITTRDKRLLDKRRVENVYEV 73
           I++RL+ +KVLI+LDDVD  +  K  A   + F   SRI++TT++K+LL    + ++Y+V
Sbjct: 282 IEERLKSQKVLIILDDVDNIEQLKALAKENQWFGNKSRIVVTTQNKQLLVSHDINHMYQV 341

Query: 74  KGLKHNSALELFCRKAFRQNNRSPDLLELSEEVAHYANGNPLALQVLGSSLYQKSKEQWK 133
                  AL +FC+ AF+Q++ S DL  L+ E    A   PLAL+VLGS +  K KE+W+
Sbjct: 342 AYPSKQEALTIFCQHAFKQSSPSDDLKHLAIEFTTLAGHLPLALRVLGSFMRGKGKEEWE 401

Query: 134 DKLRKLKLITDPNIYKVLKISYDGLNWEEKEIFLDVACFFKGEDVDFVTR--VQDDPTSM 191
             L  LK   D  + KVLK+ YDGL+  EK++FL +AC F G+  +++ +  + ++ T +
Sbjct: 402 FSLPTLKSRLDGEVEKVLKVGYDGLHDHEKDLFLHIACIFSGQHENYLKQMIIANNDTYV 461

Query: 192 HNGLNTLVEMSLITISAN-RLQMHDILQELGKTIILQESFKEPGKRSKLWDHKDVYQVLK 250
             GL  L + SLI    N R++MH +L++LGK ++ ++S  EPGKR  L + K+   VL 
Sbjct: 462 SFGLQVLADKSLIQKFENGRIEMHSLLRQLGKEVVRKQSIYEPGKRQFLMNAKETCGVLS 521

Query: 251 KNKGTDAIEGIFFDLSKI-NYLHLSPQAFANMSSLTLLKFYMPECNGVPI---MSSKLHL 306
            N GT  + GI  D+ +I   L++S + F  M +L  LKFYM      PI   M  KL L
Sbjct: 522 NNTGTGTVLGISLDMCEIKEELYISEKTFEEMRNLVYLKFYMSS----PIDDKMKVKLQL 577

Query: 307 NQD-LEYLPKKLRYLHWHEYPLKTLPFSFEPNYLIELNLPYSKVEQIWIGEKKAFKLKFI 365
            ++ L YLP +LR LHW  YPL+  P SF P  L+ELN+ +SK++++W G +    L+ +
Sbjct: 578 PEEGLSYLP-QLRLLHWDAYPLEFFPSSFRPECLVELNMSHSKLKKLWSGVQPLRNLRTM 636

Query: 366 NLYNSRYLTRLPEFSEIPNLERINLSGSE-LERLPATIKQFSQLRYLYLRNCNMLQSLP- 423
           NL +SR L  LP   E   L R++L   E L  LP++IK    L  L +  C  L+ +P 
Sbjct: 637 NLNSSRNLEILPNLMEATKLNRLDLGWCESLVELPSSIKNLQHLILLEMSCCKKLEIIPT 696

Query: 424 --ELPLLLSHLDASNCKRLQSLPEISSCLEELDI 455
              LP  L  L    C RLQ+ PEIS+ +  L++
Sbjct: 697 NINLP-SLEVLHFRYCTRLQTFPEISTNIRLLNL 729

Arabidopsis thaliana (taxid: 3702)

>sp\|Q9FL92\|WRK16_ARATH Probable WRKY transcription factor 16 OS=Arabidopsis thaliana GN=WRKY16 PE=2 SV=1	Back alignment and function description

>sp\|Q9SZ67\|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1	Back alignment and function description

>sp\|Q40392\|TMVRN_NICGU TMV resistance protein N OS=Nicotiana glutinosa GN=N PE=1 SV=1	Back alignment and function description

>sp\|O23530\|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3	Back alignment and function description

>sp\|Q9FH83\|WRK52_ARATH Probable WRKY transcription factor 52 OS=Arabidopsis thaliana GN=WRKY52 PE=2 SV=3	Back alignment and function description

>sp\|Q9FKN7\|DAR4_ARATH Protein DA1-related 4 OS=Arabidopsis thaliana GN=DAR4 PE=1 SV=2	Back alignment and function description

>sp\|Q9FLB4\|DRL31_ARATH Putative disease resistance protein At5g05400 OS=Arabidopsis thaliana GN=At5g05400 PE=2 SV=1	Back alignment and function description

>sp\|Q9FKZ1\|DRL42_ARATH Probable disease resistance protein At5g66900 OS=Arabidopsis thaliana GN=At5g66900 PE=3 SV=1	Back alignment and function description

>sp\|Q9LRR5\|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		681
255564976		944	TMV resistance protein N, putative [Rici	0.907	0.654	0.412	1e-117
255573549		908	ATP binding protein, putative [Ricinus c	0.797	0.598	0.390	1e-100
296090597		1201	unnamed protein product [Vitis vinifera]	0.700	0.397	0.441	2e-97
224127917		1470	tir-nbs-lrr resistance protein [Populus	0.693	0.321	0.419	3e-97
255561496		876	TMV resistance protein N, putative [Rici	0.837	0.650	0.365	3e-97
359493489		1092	PREDICTED: TMV resistance protein N-like	0.624	0.389	0.456	4e-97
255544956		1403	leucine-rich repeat containing protein,	0.663	0.322	0.451	8e-97
225460354		1174	PREDICTED: TMV resistance protein N-like	0.672	0.390	0.430	2e-96
224127750		1018	tir-nbs-lrr resistance protein [Populus	0.662	0.443	0.446	8e-96
147768286		1206	hypothetical protein VITISV_033530 [Viti	0.690	0.389	0.416	9e-96

>gi\|255564976\|ref\|XP_002523481.1\| TMV resistance protein N, putative [Ricinus communis] gi\|223537309\|gb\|EEF38940.1\| TMV resistance protein N, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  429 bits (1102), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 277/671 (41%), Positives = 391/671 (58%), Gaps = 53/671 (7%)

Query: 17  KKRLQQRKVLIVLDDVDD--NSKNFAGGLELFSPGSRIIITTRDKRLLDKRRVENVYEVK 74
           K RL+ RKVLIVLDDV++    +N AG    F PGSRII+T+RDK +L K + + +Y+++
Sbjct: 285 KSRLKHRKVLIVLDDVNNLRQLENLAGEHNWFGPGSRIILTSRDKDVL-KNKTDAIYKIE 343

Query: 75  GLKHNSALELFCRKAFRQNNRSPDLLELSEEVAHYANGNPLALQVLGSSLYQKSKEQWKD 134
            L H+ AL+LF   AFRQ     D ++LS+ V +YA GNPL L+VLGS LYQ++ ++W+ 
Sbjct: 344 DLDHHEALQLFSLNAFRQECPKADYMKLSKRVINYAKGNPLGLKVLGSFLYQRNIKEWES 403

Query: 135 KLRKLKLITDPNIYKVLKISYDGLNWEEKEIFLDVACFFKGEDVDFVTRVQDDPT-SMHN 193
            L KL+  T+  I  VLK+SYDGL+ EEK+IFLDVACFF GED DFVTR+ +    S   
Sbjct: 404 ALHKLERSTNKEIQNVLKVSYDGLDDEEKDIFLDVACFFNGEDRDFVTRILNGCGFSADI 463

Query: 194 GLNTLVEMSLITISANRLQMHDILQELGKTIILQESFKEPGKRSKLWDHKDVYQVLKKNK 253
            ++ LV  SL+TIS N L +H++LQ++G  I+ QES KEPG+RS+L   +DV  VL KN 
Sbjct: 464 AISVLVSKSLLTISNNTLAIHNLLQQMGWGIVRQESTKEPGRRSRLCTSEDVVHVLSKNT 523

Query: 254 GTDAIEGIFFDLSKINYLHLSPQAFANMSSLTLLKFYMPECNGVPI-MSSKLHLNQDLEY 312
           GT+AIEGI+ D+SK   ++LSP+AF  M +L LLKF+    +  PI M SK++L + LE 
Sbjct: 524 GTEAIEGIYLDMSKSRKVYLSPKAFERMHNLRLLKFHH---SFSPIAMYSKVYLPEGLES 580

Query: 313 LPKKLRYLHWHEYPLKTLPFSFEPNYLIELNLPYSKVEQIWIGEKKAFKLKFINLYNSRY 372
           LP KL  LHW+ YPLK+LPF+F   YL+EL++P+S V+ +W G++   KL  INL +S++
Sbjct: 581 LPDKLSCLHWNGYPLKSLPFNFCAEYLVELSMPHSHVKFLWEGDQCLKKLNSINLSDSQH 640

Query: 373 LTRLPEFSEIPNLERINLSGS-ELERLPATIKQFSQLRYLYLRNCNMLQSLPELPLL--L 429
           L RLP+FSE  NLE INL G   L ++P++I   ++L  L L++C  L+S+P L  L  L
Sbjct: 641 LIRLPDFSEALNLEYINLEGCISLAQVPSSIGYLTKLDILNLKDCKELRSIPSLIDLQSL 700

Query: 430 SHLDASNCKRLQSLPEISSCLEE--LDISILEKLSKTTFPIKHGCSLMQFEFQNCWELKE 487
             L+ S C  L    +    +EE  LD + +E+L  +   I+    L  +  +NC  L +
Sbjct: 701 RKLNLSGCSNLNHCQDFPRNIEELCLDGTAIEELPAS---IEDLSELTFWSMENCKRLDQ 757

Query: 488 NK---ILEDSELRIQHMAIASLRLFYEKEQLYCPSILLPGSEIPKWFAFQNIGPLIALQL 544
           N    I  D+   IQ  A A+         L   S   PG+EIP W  ++  G  I ++L
Sbjct: 758 NSCCLIAADAHKTIQRTATAA-----GIHSLPSVSFGFPGTEIPDWLLYKETGSSITVKL 812

Query: 545 PEHCLIN---LIGFALCAVIDFKHLPSNSWDSFNINCGIYIKMNKPEDLSFNCFLASIR- 600
             +   N    +GFA+C V+ F H      ++  + C    K N  +    NCFL  +  
Sbjct: 813 HPNWHRNPSRFLGFAVCCVVKFTHFI--DINNIYVICECNFKTNHDDHHVVNCFLQGLNN 870

Query: 601 -----DAIDSDHVILGFSPLGI------GGFPVGGGNHNTTVLVDFFPA----------K 639
                D + S HV +G+   GI      G +P G   H   V   F+            K
Sbjct: 871 GKDESDLVKSQHVYIGYD-FGIYLRAVKGTYP-GRLYHYEEVTFKFYAKKMVGHTVAWRK 928

Query: 640 VKCCGVSPVYA 650
           V  CGV  +YA
Sbjct: 929 VDKCGVHLLYA 939

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|255573549\|ref\|XP_002527699.1\| ATP binding protein, putative [Ricinus communis] gi\|223532930\|gb\|EEF34698.1\| ATP binding protein, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|296090597\|emb\|CBI40966.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224127917\|ref\|XP_002329209.1\| tir-nbs-lrr resistance protein [Populus trichocarpa] gi\|222870990\|gb\|EEF08121.1\| tir-nbs-lrr resistance protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|255561496\|ref\|XP_002521758.1\| TMV resistance protein N, putative [Ricinus communis] gi\|223538971\|gb\|EEF40568.1\| TMV resistance protein N, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|359493489\|ref\|XP_002264004.2\| PREDICTED: TMV resistance protein N-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255544956\|ref\|XP_002513539.1\| leucine-rich repeat containing protein, putative [Ricinus communis] gi\|223547447\|gb\|EEF48942.1\| leucine-rich repeat containing protein, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|225460354\|ref\|XP_002263146.1\| PREDICTED: TMV resistance protein N-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224127750\|ref\|XP_002329168.1\| tir-nbs-lrr resistance protein [Populus trichocarpa] gi\|222870949\|gb\|EEF08080.1\| tir-nbs-lrr resistance protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|147768286\|emb\|CAN64759.1\| hypothetical protein VITISV_033530 [Vitis vinifera]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		681
TAIR\|locus:2162439		1008	AT5G22690 [Arabidopsis thalian	0.920	0.622	0.315	1.4e-80
TAIR\|locus:2175991		1294	AT5G17680 [Arabidopsis thalian	0.684	0.360	0.372	7e-77
TAIR\|locus:2118106		1219	AT4G12010 [Arabidopsis thalian	0.773	0.432	0.353	3.6e-76
TAIR\|locus:2146243		900	AT5G18360 [Arabidopsis thalian	0.681	0.515	0.369	5.7e-75
TAIR\|locus:2115870		1234	AT4G08450 [Arabidopsis thalian	0.656	0.362	0.366	1.7e-74
TAIR\|locus:2039405		1109	AT2G16870 [Arabidopsis thalian	0.678	0.416	0.351	1.7e-73
TAIR\|locus:2160487		1085	AT5G41550 [Arabidopsis thalian	0.637	0.4	0.348	2.9e-73
TAIR\|locus:2155189		980	AT5G49140 [Arabidopsis thalian	0.637	0.442	0.376	5.9e-73
TAIR\|locus:2160472		1038	AT5G41540 [Arabidopsis thalian	0.678	0.445	0.354	1e-70
TAIR\|locus:2175070		1114	AT5G41740 [Arabidopsis thalian	0.654	0.400	0.349	1e-70

TAIR\|locus:2162439 AT5G22690 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 785 (281.4 bits), Expect = 1.4e-80, Sum P(2) = 1.4e-80
 Identities = 206/652 (31%), Positives = 329/652 (50%)

Query:    16 IKKRLQQRKVLIVLDDVDDNS--KNFAGGLELFSPGSRIIITTRDKRLLDKRRVENVYEV 73
             + +RL+  KVLI +DD+DD       A     F  GSRII+ T+DK+      +   YEV
Sbjct:   287 VGERLKHMKVLIFIDDLDDQVVLDALASKPHWFGCGSRIIVITKDKQFFRAHGIGLFYEV 346

Query:    74 KGLKHNS-ALELFCRKAFRQNNRSPDLLELSEEVAHYANGNPLALQVLGSSLYQKSKEQW 132
              GL  +  ALE+F + AFRQN+  P   EL+ EV+  +   PLAL VLGS L  + KE W
Sbjct:   347 -GLPSDKLALEMFSQSAFRQNSPPPGFTELASEVSKRSGNLPLALNVLGSHLRGRDKEDW 405

Query:   133 KDKLRKLKLITDPNIYKVLKISYDGL-NWEEKEIFLDVACFFKGEDVDFVTRV-QDDPTS 190
              D L +L+   D  I K+L++ YD L N ++K IF  +AC F G ++ ++  +  D    
Sbjct:   406 IDMLPRLRKGLDGKIEKILRVGYDELSNKDDKAIFRLIACLFNGAEISYIKLLLADSNLG 465

Query:   191 MHNGLNTLVEMSLITISANRLQMHDILQELGKTIILQESFKEPGKRSKLWDHKDVYQVLK 250
             +  GL  LV+ SLI I  + ++MH +LQE+G+ I+ ++S  EPG+R  L D  D+  VL 
Sbjct:   466 VTIGLKNLVDKSLIRIGCDTVEMHSMLQEMGREIVREQSIYEPGEREFLVDSTDILDVLN 525

Query:   251 KNKGTDAIEGIFFDLSKINYLHLSPQAFANMSSLTLLKFYMPECNGVPIMSSKLHLNQDL 310
              N GT  + GI FD+S+I  LH+  +AF  M +L  L+FY     G     ++LHL +  
Sbjct:   526 DNTGTKKVLGISFDMSEIEELHIHKRAFKRMPNLRFLRFYKKL--GKQSKEARLHLQEGF 583

Query:   311 E-YLPKKLRYLHWHEYPLKTLPFSFEPNYLIELNLPYSKVEQIWIGEKKAFKLKFINLYN 369
             + + P KL+ L W +YP++ +P +F   YL+ L + +SK+E++W G +    L+ + L+ 
Sbjct:   584 DKFFPPKLKLLSWDDYPMRRMPSNFHAGYLVVLRMQHSKLEKLWQGVQPLTCLREMQLWG 643

Query:   370 SRYLTRLPEFSEIPNLERINLSG-SELERLPATIKQFSQLRYLYLRNCNMXXX--XXXXX 426
             S+ L  +P+ S   NLE + L+  S L  LP++IK  ++L  L ++ C            
Sbjct:   644 SKKLKEIPDLSLATNLETLYLNDCSSLVELPSSIKNLNKLWDLGMKGCEKLELLPTDINL 703

Query:   427 XXXXXXDASNCKRLQSLPEISSCLEELDISILEKLSKTTFPIKHGCSLMQFEFQNCWELK 486
                   D   C RL+S P+ISS + EL ++    + +  + I+    L +   + C +LK
Sbjct:   704 KSLYRLDLGRCSRLKSFPDISSNISELYLN-RTAIEEVPWWIQKFSRLKRLRMRECKKLK 762

Query:   487 -----ENKILEDSELRIQHMAIASLRLFYEKEQLYCPSILLPGSEIPKWFAFQNIGPLIA 541
                   +K+     L   +    +      ++Q     ++ PG ++P +F +Q  G  +A
Sbjct:   763 CISPNISKLKHLEMLDFSNCIATTEEEALVQQQSVLKYLIFPGGQVPLYFTYQATGSSLA 822

Query:   542 LQLPEH---CLINLIGFALCAVIDFKHLPSNSWD-SFNINCGIYIKMNKPEDLSFNCFLA 597
             + L  H       L+GF  C V+D + + S  +     + C +  K +   D S +C  A
Sbjct:   823 IPLSLHQSSLSQQLLGFRACVVLDAESMSSELYVIDIKVCCRLSGKRSNLFD-SADCRDA 881

Query:   598 SIRDAIDSDHVILGFS-PLXXXXXXXXXXNHNTTVLVDFFPAKVKCCGVSPV 648
                  +DS  VI     PL          N N  V+ +F    +  C ++ V
Sbjct:   882 FFTPQMDSHLVIFDCCFPLNQDNVRLAELN-NDKVVTEFHFTSISRCKITGV 932

GO:0005622 "intracellular" evidence=IEA

GO:0005737 "cytoplasm" evidence=ISM

GO:0006952 "defense response" evidence=IEA;ISS

GO:0007165 "signal transduction" evidence=IEA

GO:0043531 "ADP binding" evidence=IEA

TAIR\|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2118106 AT4G12010 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2146243 AT5G18360 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2115870 AT4G08450 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2039405 AT2G16870 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2160487 AT5G41550 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2155189 AT5G49140 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2160472 AT5G41540 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2175070 AT5G41740 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00021873001	SubName- Full=Chromosome chr18 scaffold_24, whole genome shotgun sequence; (890 aa)
		(Vitis vinifera)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		681
PLN03210		1153	PLN03210, PLN03210, Resistant to P	3e-93
pfam00931		285	pfam00931, NB-ARC, NB-ARC domain	7e-26
PLN03210		1153	PLN03210, PLN03210, Resistant to P	6e-12
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	2e-04
COG4886		394	COG4886, COG4886, Leucine-rich repeat (LRR) protei	0.002
pfam13855		60	pfam13855, LRR_8, Leucine rich repeat	0.004

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

 Score =  312 bits (801), Expect = 3e-93
 Identities = 206/563 (36%), Positives = 307/563 (54%), Gaps = 32/563 (5%)

Query: 16  IKKRLQQRKVLIVLDDVDDNS--KNFAGGLELFSPGSRIIITTRDKRLLDKRRVENVYEV 73
           +++RL+ RKVLI +DD+DD       AG  + F  GSRII+ T+DK  L    ++++YEV
Sbjct: 289 MEERLKHRKVLIFIDDLDDQDVLDALAGQTQWFGSGSRIIVITKDKHFLRAHGIDHIYEV 348

Query: 74  KGLKHNSALELFCRKAFRQNNRSPDLLELSEEVAHYANGNPLALQVLGSSLYQKSKEQWK 133
               +  ALE+FCR AF++N+     +EL+ EVA  A   PL L VLGS L  + KE W 
Sbjct: 349 CLPSNELALEMFCRSAFKKNSPPDGFMELASEVALRAGNLPLGLNVLGSYLRGRDKEDWM 408

Query: 134 DKLRKLKLITDPNIYKVLKISYDGLN-WEEKEIFLDVACFFKGEDV-DFVTRVQDDPTSM 191
           D L +L+   D  I K L++SYDGLN  ++K IF  +AC F GE V D    + +    +
Sbjct: 409 DMLPRLRNGLDGKIEKTLRVSYDGLNNKKDKAIFRHIACLFNGEKVNDIKLLLANSDLDV 468

Query: 192 HNGLNTLVEMSLITISANRLQMHDILQELGKTIILQESFKEPGKRSKLWDHKDVYQVLKK 251
           + GL  LV+ SLI +  + ++MH +LQE+GK I+  +S  EPG+R  L D KD+  VL+ 
Sbjct: 469 NIGLKNLVDKSLIHVREDIVEMHSLLQEMGKEIVRAQS-NEPGEREFLVDAKDICDVLED 527

Query: 252 NKGTDAIEGIFFDLSKINYLHLSPQAFANMSSLTLLKFYMPECNGVPIMSSKLHLNQDLE 311
           N GT  + GI  D+ +I+ LH+   AF  M +L  LKFY  + +       + HL +  +
Sbjct: 528 NTGTKKVLGITLDIDEIDELHIHENAFKGMRNLLFLKFYTKKWDQKK--EVRWHLPEGFD 585

Query: 312 YLPKKLRYLHWHEYPLKTLPFSFEPNYLIELNLPYSKVEQIWIGEKKAFKLKFINLYNSR 371
           YLP KLR L W +YPL+ +P +F P  L++L +  SK+E++W G      L+ I+L  S+
Sbjct: 586 YLPPKLRLLRWDKYPLRCMPSNFRPENLVKLQMQGSKLEKLWDGVHSLTGLRNIDLRGSK 645

Query: 372 YLTRLPEFSEIPNLERINLSG-SELERLPATIKQFSQLRYLYLRNCNMLQSLPELPLL-- 428
            L  +P+ S   NLE + LS  S L  LP++I+  ++L  L +  C  L+ LP    L  
Sbjct: 646 NLKEIPDLSMATNLETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCENLEILPTGINLKS 705

Query: 429 LSHLDASNCKRLQSLPEISSCLEELDISILEKLSKTTFPIKHGCSLMQFEFQNCWELKEN 488
           L  L+ S C RL+S P+IS+ +  LD+    + +   FP      L   +     E+K  
Sbjct: 706 LYRLNLSGCSRLKSFPDISTNISWLDLD---ETAIEEFP--SNLRLENLDELILCEMKSE 760

Query: 489 KILEDSELRIQHMAIAS---LRLFYEKEQLYCPSILLPGSEIPKWFAFQNIGPLIALQLP 545
           K+ E  +     M + S    RLF        PS++    E+P   + QN+  L  L++ 
Sbjct: 761 KLWERVQPLTPLMTMLSPSLTRLFLSD----IPSLV----ELPS--SIQNLHKLEHLEI- 809

Query: 546 EHCLINLIGFALCAVIDFKHLPS 568
           E+C INL    L   I+ + L S
Sbjct: 810 ENC-INLE--TLPTGINLESLES 829

syringae 6; Provisional. Length = 1153

>gnl\|CDD\|216202 pfam00931, NB-ARC, NB-ARC domain	Back alignment and domain information

>gnl\|CDD\|215633 PLN03210, PLN03210, Resistant to P	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>gnl\|CDD\|206026 pfam13855, LRR_8, Leucine rich repeat	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		681
PLN03210		1153	Resistant to P. syringae 6; Provisional	100.0
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	100.0
PF00931		287	NB-ARC: NB-ARC domain; InterPro: IPR002182 This is	99.93
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.84
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.78
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.78
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.71
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.7
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.69
PLN03210		1153	Resistant to P. syringae 6; Provisional	99.67
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.63
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.62
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.62
KOG0472		565	consensus Leucine-rich repeat protein [Function un	99.6
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	99.56
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.55
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	99.54
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.49
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.44
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	99.38
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.18
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	99.11
KOG4237		498	consensus Extracellular matrix protein slit, conta	99.06
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	98.96
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	98.91
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	98.9
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.88
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	98.76
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.74
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.71
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	98.68
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.68
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.64
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.63
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	98.31
PRK04841		903	transcriptional regulator MalT; Provisional	98.23
PLN03150		623	hypothetical protein; Provisional	98.19
PRK15386		426	type III secretion protein GogB; Provisional	98.19
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.15
PLN03150		623	hypothetical protein; Provisional	98.14
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.12
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.12
PRK15386		426	type III secretion protein GogB; Provisional	98.09
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	98.06
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	97.89
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	97.88
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.63
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.6
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.58
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	97.57
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.53
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.51
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	97.25
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	97.2
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	97.1
KOG2982		418	consensus Uncharacterized conserved protein [Funct	96.94
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	96.83
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	96.71
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	96.33
KOG2982		418	consensus Uncharacterized conserved protein [Funct	96.24
COG3903		414	Predicted ATPase [General function prediction only	95.78
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	95.66
TIGR03015		269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	95.65
PRK06893		229	DNA replication initiation factor; Validated	95.56
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	95.53
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	95.35
TIGR00635		305	ruvB Holliday junction DNA helicase, RuvB subunit.	95.27
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	95.26
PF05729		166	NACHT: NACHT domain	95.09
PRK00080		328	ruvB Holliday junction DNA helicase RuvB; Reviewed	94.8
COG2909		894	MalT ATP-dependent transcriptional regulator [Tran	94.66
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	94.48
KOG2123		388	consensus Uncharacterized conserved protein [Funct	94.37
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	93.77
PF01637		234	Arch_ATPase: Archaeal ATPase; InterPro: IPR011579	93.38
COG3899		849	Predicted ATPase [General function prediction only	93.31
KOG2123		388	consensus Uncharacterized conserved protein [Funct	93.11
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	93.08
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	92.91
PRK07471		365	DNA polymerase III subunit delta'; Validated	92.78
KOG4341		483	consensus F-box protein containing LRR [General fu	92.48
PRK00411		394	cdc6 cell division control protein 6; Reviewed	92.3
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	91.47
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	91.46
TIGR02928		365	orc1/cdc6 family replication initiation protein. M	90.64
KOG4341		483	consensus F-box protein containing LRR [General fu	90.0
PF14516		331	AAA_35: AAA-like domain	88.08
KOG0473		326	consensus Leucine-rich repeat protein [Function un	87.67
smart00370		26	LRR Leucine-rich repeats, outliers.	87.35
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	87.35
PRK05564		313	DNA polymerase III subunit delta'; Validated	87.14
TIGR00678		188	holB DNA polymerase III, delta' subunit. At positi	86.51
KOG0473		326	consensus Leucine-rich repeat protein [Function un	86.28
smart00370		26	LRR Leucine-rich repeats, outliers.	86.11
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	86.11
PRK09112		351	DNA polymerase III subunit delta'; Validated	85.83
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	85.79
PRK09087		226	hypothetical protein; Validated	85.74
PF13173		128	AAA_14: AAA domain	85.6
PRK13342		413	recombination factor protein RarA; Reviewed	84.5
PF07725		20	LRR_3: Leucine Rich Repeat; InterPro: IPR011713 Le	83.41
smart00364		26	LRR_BAC Leucine-rich repeats, bacterial type.	81.81
PRK08727		233	hypothetical protein; Validated	81.52
PRK05707		328	DNA polymerase III subunit delta'; Validated	80.83
PRK14963		504	DNA polymerase III subunits gamma and tau; Provisi	80.58

>PLN03210 Resistant to P	Back alignment and domain information

Probab=100.00  E-value=1.4e-81  Score=759.78  Aligned_cols=631  Identities=32%  Similarity=0.514  Sum_probs=513.7

Q ss_pred             HHHHHHhCCCeEEEEEECcChh--HHHhhcCCCCCCCCcEEEEEeCCchhhhccCCceEEEcCCCCHHHHHHHHHHHhcc
Q 005709           14 PNIKKRLQQRKVLIVLDDVDDN--SKNFAGGLELFSPGSRIIITTRDKRLLDKRRVENVYEVKGLKHNSALELFCRKAFR   91 (681)
Q Consensus        14 ~~i~~~L~~kr~LiVLDdv~~~--~~~l~~~~~~~~~gSrIivTTR~~~v~~~~~~~~~~~l~~L~~~e~~~Lf~~~af~   91 (681)
                      ..++++|++||+||||||||+.  |+.+.+...|+++|||||||||+++++..++++.+|+|+.|+++|||+||+++||+
T Consensus       287 ~~~~~~L~~krvLLVLDdv~~~~~l~~L~~~~~~~~~GsrIIiTTrd~~vl~~~~~~~~~~v~~l~~~ea~~LF~~~Af~  366 (1153)
T PLN03210        287 GAMEERLKHRKVLIFIDDLDDQDVLDALAGQTQWFGSGSRIIVITKDKHFLRAHGIDHIYEVCLPSNELALEMFCRSAFK  366 (1153)
T ss_pred             HHHHHHHhCCeEEEEEeCCCCHHHHHHHHhhCccCCCCcEEEEEeCcHHHHHhcCCCeEEEecCCCHHHHHHHHHHHhcC
Confidence            5688999999999999999998  99999988999999999999999999998888899999999999999999999999


Q ss_pred             CCCCChhHHHHHHHHHHHcCCChhHHHHHHhhhcCCCHHHHHHHHHHhhhcCChhHHHHHHHHhcCCCH-HHHHHHhhhc
Q 005709           92 QNNRSPDLLELSEEVAHYANGNPLALQVLGSSLYQKSKEQWKDKLRKLKLITDPNIYKVLKISYDGLNW-EEKEIFLDVA  170 (681)
Q Consensus        92 ~~~~~~~~~~~~~~i~~~c~GlPLai~~~g~~L~~k~~~~w~~~l~~l~~~~~~~i~~~l~~sy~~L~~-~~k~cfl~~a  170 (681)
                      +..+++++.+++++|+++|+|+||||+++|++|++++.++|+.++++++..++.+|..+|++||++|++ .+|.||++||
T Consensus       367 ~~~~~~~~~~l~~~iv~~c~GLPLAl~vlgs~L~~k~~~~W~~~l~~L~~~~~~~I~~~L~~SYd~L~~~~~k~~Fl~ia  446 (1153)
T PLN03210        367 KNSPPDGFMELASEVALRAGNLPLGLNVLGSYLRGRDKEDWMDMLPRLRNGLDGKIEKTLRVSYDGLNNKKDKAIFRHIA  446 (1153)
T ss_pred             CCCCcHHHHHHHHHHHHHhCCCcHHHHHHHHHHcCCCHHHHHHHHHHHHhCccHHHHHHHHHhhhccCccchhhhhheeh
Confidence            887778899999999999999999999999999999999999999999998888999999999999986 5899999999


Q ss_pred             ccCCCCCHHHHHHhhcCC-CchhhhHHHHhhccceeEeCCeEeehHHHHHHHHHHhhhccccCCCceeecccCchhhHHh
Q 005709          171 CFFKGEDVDFVTRVQDDP-TSMHNGLNTLVEMSLITISANRLQMHDILQELGKTIILQESFKEPGKRSKLWDHKDVYQVL  249 (681)
Q Consensus       171 ~Fp~~~~~~~~~~i~~~~-~~~~~~~~~L~~~sli~~~~~~~~mHdll~~~~~~i~~~e~~~~~~~~~~l~~~~~~~~vl  249 (681)
                      |||++.+++.+..++.+. ..++.+++.|+++|||++..++++|||++|+||++++++++ .+|++++++|+++++++++
T Consensus       447 ~ff~~~~~~~v~~~l~~~~~~~~~~l~~L~~ksLi~~~~~~~~MHdLl~~~~r~i~~~~~-~~~~~r~~l~~~~di~~vl  525 (1153)
T PLN03210        447 CLFNGEKVNDIKLLLANSDLDVNIGLKNLVDKSLIHVREDIVEMHSLLQEMGKEIVRAQS-NEPGEREFLVDAKDICDVL  525 (1153)
T ss_pred             hhcCCCCHHHHHHHHHhcCCCchhChHHHHhcCCEEEcCCeEEhhhHHHHHHHHHHHhhc-CCCCcceeEeCHHHHHHHH
Confidence            999999999988876655 77888999999999999998999999999999999999997 7899999999999999999


Q ss_pred             hcCcCCCcEEEEEeecCCCcccccCHHHhcCCCCCceEEEeCCCCCCCcccccccccCccccccccCccEEEecCCCCCC
Q 005709          250 KKNKGTDAIEGIFFDLSKINYLHLSPQAFANMSSLTLLKFYMPECNGVPIMSSKLHLNQDLEYLPKKLRYLHWHEYPLKT  329 (681)
Q Consensus       250 ~~~~~~~~v~~l~l~~~~~~~~~~~~~~f~~l~~L~~L~l~~n~~~~~~~~~~~~~l~~~l~~l~~~L~~L~l~~~~l~~  329 (681)
                      ..++|+.++++|++|.+......+.+.+|.+|++|++|.++.+.+..  ......++|.++..+|.+|++|+|.+|+++.
T Consensus       526 ~~~~g~~~v~~i~l~~~~~~~~~i~~~aF~~m~~L~~L~~~~~~~~~--~~~~~~~lp~~~~~lp~~Lr~L~~~~~~l~~  603 (1153)
T PLN03210        526 EDNTGTKKVLGITLDIDEIDELHIHENAFKGMRNLLFLKFYTKKWDQ--KKEVRWHLPEGFDYLPPKLRLLRWDKYPLRC  603 (1153)
T ss_pred             HhCcccceeeEEEeccCccceeeecHHHHhcCccccEEEEecccccc--cccceeecCcchhhcCcccEEEEecCCCCCC
Confidence            99999999999999999999899999999999999999998764321  1112467899999999999999999999999


Q ss_pred             CCCCCCCCCceEEEcCCCCcccccccccccccccccceecc---cCCcccCCCCCCCCCcEEEcc-cCCCcccCccccCC
Q 005709          330 LPFSFEPNYLIELNLPYSKVEQIWIGEKKAFKLKFINLYNS---RYLTRLPEFSEIPNLERINLS-GSELERLPATIKQF  405 (681)
Q Consensus       330 lp~~~~l~~L~~L~L~~n~l~~lp~~~~~l~~L~~L~~L~l---~~l~~lp~~~~l~~L~~L~L~-~n~l~~lp~~i~~L  405 (681)
                      +|..|.+.+|++|+|++|+++.+|.++..   +++|+.|++   +.++.+|+++.+++|++|+|+ |+.+..+|.+++++
T Consensus       604 lP~~f~~~~L~~L~L~~s~l~~L~~~~~~---l~~Lk~L~Ls~~~~l~~ip~ls~l~~Le~L~L~~c~~L~~lp~si~~L  680 (1153)
T PLN03210        604 MPSNFRPENLVKLQMQGSKLEKLWDGVHS---LTGLRNIDLRGSKNLKEIPDLSMATNLETLKLSDCSSLVELPSSIQYL  680 (1153)
T ss_pred             CCCcCCccCCcEEECcCcccccccccccc---CCCCCEEECCCCCCcCcCCccccCCcccEEEecCCCCccccchhhhcc
Confidence            99999999999999999999999999988   999999999   468899999999999999999 78899999999999


Q ss_pred             CccceeccccccccCcCCCC--CCCCCEEeccCCCCCcccCCCCCCccEEecccccccc---------------------
Q 005709          406 SQLRYLYLRNCNMLQSLPEL--PLLLSHLDASNCKRLQSLPEISSCLEELDISILEKLS---------------------  462 (681)
Q Consensus       406 ~~L~~L~L~~c~~l~~lp~~--l~~L~~L~l~~c~~l~~lp~~~~~L~~L~l~~n~l~~---------------------  462 (681)
                      ++|+.|++++|+.++.+|..  +++|+.|++++|..++.+|....+|++|++++|.+..                     
T Consensus       681 ~~L~~L~L~~c~~L~~Lp~~i~l~sL~~L~Lsgc~~L~~~p~~~~nL~~L~L~~n~i~~lP~~~~l~~L~~L~l~~~~~~  760 (1153)
T PLN03210        681 NKLEDLDMSRCENLEILPTGINLKSLYRLNLSGCSRLKSFPDISTNISWLDLDETAIEEFPSNLRLENLDELILCEMKSE  760 (1153)
T ss_pred             CCCCEEeCCCCCCcCccCCcCCCCCCCEEeCCCCCCccccccccCCcCeeecCCCccccccccccccccccccccccchh
Confidence            99999999999999999985  7889999999998887777655555555555554433                     


Q ss_pred             ---------------------------------cccccccCCCCCcEEEccCCc---------------cccccc-----
Q 005709          463 ---------------------------------KTTFPIKHGCSLMQFEFQNCW---------------ELKENK-----  489 (681)
Q Consensus       463 ---------------------------------~~~~~l~~l~~L~~L~l~~c~---------------~L~l~~-----  489 (681)
                                                       +|.+ ++++++|+.|++++|.               .|++++     
T Consensus       761 ~l~~~~~~l~~~~~~~~~sL~~L~Ls~n~~l~~lP~s-i~~L~~L~~L~Ls~C~~L~~LP~~~~L~sL~~L~Ls~c~~L~  839 (1153)
T PLN03210        761 KLWERVQPLTPLMTMLSPSLTRLFLSDIPSLVELPSS-IQNLHKLEHLEIENCINLETLPTGINLESLESLDLSGCSRLR  839 (1153)
T ss_pred             hccccccccchhhhhccccchheeCCCCCCccccChh-hhCCCCCCEEECCCCCCcCeeCCCCCccccCEEECCCCCccc
Confidence                                             3333 5566677777777664               122333     


Q ss_pred             ----------------cccCh--HHHHHhhHHHHHH----------------------------HHHh-----h------
Q 005709          490 ----------------ILEDS--ELRIQHMAIASLR----------------------------LFYE-----K------  512 (681)
Q Consensus       490 ----------------~~l~~--~~i~~l~~L~~L~----------------------------~~~~-----~------  512 (681)
                                      |.+..  .++..+++|+.|+                            ..+.     .      
T Consensus       840 ~~p~~~~nL~~L~Ls~n~i~~iP~si~~l~~L~~L~L~~C~~L~~l~~~~~~L~~L~~L~l~~C~~L~~~~l~~~~~~~~  919 (1153)
T PLN03210        840 TFPDISTNISDLNLSRTGIEEVPWWIEKFSNLSFLDMNGCNNLQRVSLNISKLKHLETVDFSDCGALTEASWNGSPSEVA  919 (1153)
T ss_pred             cccccccccCEeECCCCCCccChHHHhcCCCCCEEECCCCCCcCccCcccccccCCCeeecCCCcccccccCCCCchhhh
Confidence                            22211  2233333322221                            0000     0      


Q ss_pred             ---------------------ccC----------CCCeEEccCCCCCccccccccCCeEE-EeCCCcCcC-CcceEEEEE
Q 005709          513 ---------------------EQL----------YCPSILLPGSEIPKWFAFQNIGPLIA-LQLPEHCLI-NLIGFALCA  559 (681)
Q Consensus       513 ---------------------~~~----------~~~~~~l~G~~iP~w~~~~~~g~~~~-i~l~~~~~~-~~~gf~~c~  559 (681)
                                           ..+          ....+++||.++|+||.|++.|++++ |.+|+.|+. .|.||++|+
T Consensus       920 ~~~~n~~~~~p~~~~l~f~nC~~L~~~a~l~~~~~~~~~~l~g~evp~~f~hr~~g~sl~~i~l~~~~~~~~~~~f~~c~  999 (1153)
T PLN03210        920 MATDNIHSKLPSTVCINFINCFNLDQEALLQQQSIFKQLILSGEEVPSYFTHRTTGASLTNIPLLHISPCQPFFRFRACA  999 (1153)
T ss_pred             hhcccccccCCchhccccccccCCCchhhhcccccceEEECCCccCchhccCCcccceeeeeccCCcccCCCccceEEEE
Confidence                                 000          01157899999999999999999998 999999998 899999999


Q ss_pred             EeecCCCCCCCCCCeeeEEEEEEecCCCCCccceeeeccCCCCCCCCeEEEEecCCCcCCC-CCCCCCCCcEEEEEE--e
Q 005709          560 VIDFKHLPSNSWDSFNINCGIYIKMNKPEDLSFNCFLASIRDAIDSDHVILGFSPLGIGGF-PVGGGNHNTTVLVDF--F  636 (681)
Q Consensus       560 v~~~~~~~~~~~~~~~~~c~~~~~~~~~~~~~~~~~~~~~~~~~~sdh~~l~~~~~~~~~~-~~~~~~~~~~~~~~f--~  636 (681)
                      |+++..... ....+.+.|.|++++.+++.....+..+.+.....++|++++......... ....+..++|++++|  .
T Consensus      1000 v~~~~~~~~-~~~~~~~~~~c~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~~ 1078 (1153)
T PLN03210       1000 VVDSESFFI-ISVSFDIQVCCRFIDRLGNHFDSPYQPHVFSVTKKGSHLVIFDCCFPLNEDNAPLAELNYDHVDIQFRLT 1078 (1153)
T ss_pred             EEecCcccc-CCCceeEEEEEEEECCCCCccccCCCceeEeeeccccceEEecccccccccccchhccCCceeeEEEEEe
Confidence            999876542 334788999999998877654321111111112234444443322111111 111233466666666  2


Q ss_pred             ----ccEEEeeeeEEEecCC
Q 005709          637 ----PAKVKCCGVSPVYADP  652 (681)
Q Consensus       637 ----~~~vk~cGv~lvy~~~  652 (681)
                          .++||+||||++|+.+
T Consensus      1079 ~~~~~~~~~~cg~~~~~~~~ 1098 (1153)
T PLN03210       1079 NKNSQLKLKGCGIRLSEDDS 1098 (1153)
T ss_pred             cCCCCeEEEeeeEEEeccCC
Confidence                3589999999999766

syringae 6; Provisional

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals []	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>PRK04841 transcriptional regulator MalT; Provisional	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG3903 Predicted ATPase [General function prediction only]	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>PF05729 NACHT: NACHT domain	Back alignment and domain information

>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed	Back alignment and domain information

>COG2909 MalT ATP-dependent transcriptional regulator [Transcription]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP	Back alignment and domain information

>COG3899 Predicted ATPase [General function prediction only]	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>PRK07471 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>PRK00411 cdc6 cell division control protein 6; Reviewed	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>TIGR02928 orc1/cdc6 family replication initiation protein	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>PF14516 AAA_35: AAA-like domain	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>PRK05564 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR00678 holB DNA polymerase III, delta' subunit	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>PRK09112 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>PRK09087 hypothetical protein; Validated	Back alignment and domain information

>PF13173 AAA_14: AAA domain	Back alignment and domain information

>PRK13342 recombination factor protein RarA; Reviewed	Back alignment and domain information

>PF07725 LRR_3: Leucine Rich Repeat; InterPro: IPR011713 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>smart00364 LRR_BAC Leucine-rich repeats, bacterial type	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>PRK05707 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK14963 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		681
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-34
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-11
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-05
2a5y_B		549	CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis	8e-27
1z6t_A		591	APAF-1, apoptotic protease activating factor 1; ca	4e-23
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	5e-19
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	5e-16
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	1e-10
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	3e-08
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	4e-08
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	7e-16
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	2e-15
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	5e-13
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	7e-14
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	6e-10
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	3e-09
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	1e-04
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	9e-13
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	3e-12
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	2e-10
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	3e-10
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	7e-12
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	8e-08
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	1e-11
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	7e-08
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	2e-11
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	1e-06
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	5e-06
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	4e-05
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	4e-04
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	3e-11
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	2e-09
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	9e-09
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	4e-08
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	9e-11
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	3e-09
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	4e-07
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	2e-06
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	2e-10
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	4e-09
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	1e-07
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	3e-06
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	2e-05
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	4e-10
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	3e-08
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	9e-08
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	1e-05
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	4e-10
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	3e-09
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	6e-08
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	2e-07
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	7e-10
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	1e-07
1o6v_A		466	Internalin A; bacterial infection, extracellular r	2e-09
1o6v_A		466	Internalin A; bacterial infection, extracellular r	3e-09
1o6v_A		466	Internalin A; bacterial infection, extracellular r	4e-04
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	2e-09
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	3e-08
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	2e-07
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	2e-09
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	1e-07
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	3e-09
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	8e-07
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	5e-06
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	3e-09
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	2e-07
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	1e-05
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	4e-09
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	9e-09
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	5e-05
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	5e-09
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	5e-09
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	6e-06
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	4e-04
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	7e-09
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	1e-08
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	8e-08
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	1e-05
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	8e-09
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	8e-05
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	7e-04
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	9e-04
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	1e-08
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	2e-08
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	6e-05
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	2e-04
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	2e-08
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	1e-06
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	8e-06
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	6e-04
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	3e-08
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	2e-07
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	3e-06
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	3e-08
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	9e-06
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	1e-05
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	4e-08
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	7e-07
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	7e-06
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	6e-08
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	8e-07
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	7e-04
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	2e-07
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	4e-07
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	3e-06
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	3e-05
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	6e-05
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	6e-07
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	8e-06
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	2e-05
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	7e-07
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	8e-07
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	9e-07
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	3e-05
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	2e-06
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	2e-04
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	2e-06
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	1e-05
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	6e-06
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	7e-06
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	2e-05
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	7e-06
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	1e-05
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	5e-05
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	5e-04
3e6j_A		229	Variable lymphocyte receptor diversity region; var	1e-05
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	3e-05
3m19_A		251	Variable lymphocyte receptor A diversity region; a	4e-05
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	5e-05
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	8e-05
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	9e-05
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	1e-04
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	3e-04
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	4e-04
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	5e-04
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	4e-04
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	4e-04
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	6e-04
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	6e-04
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	8e-04

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

 Score =  139 bits (352), Expect = 2e-34
 Identities = 74/421 (17%), Positives = 141/421 (33%), Gaps = 99/421 (23%)

Query: 3   ENIKIGTPTITPNIKKRLQQR---KVLIVLDDVDDNSKNFAGGLELFSPGSRIIITTRDK 59
            NIK+   +I   +++ L+ +     L+VL +V +           F+   +I++TTR K
Sbjct: 221 SNIKLRIHSIQAELRRLLKSKPYENCLLVLLNVQNAKA-----WNAFNLSCKILLTTRFK 275

Query: 60  RLLDKRRVENVYEV------KGLKHNSALELFCRKAFRQNNRSPDLLELSEEVAHYANGN 113
           ++ D         +        L  +    L  +      +  P   +L  EV      N
Sbjct: 276 QVTDFLSAATTTHISLDHHSMTLTPDEVKSLLLKYL----DCRPQ--DLPREV---LTTN 326

Query: 114 PLALQVLGSSLYQKSKEQWKDKLRKLKLITDPNIYKVLKISYDGLNWEE-KEIFLDVACF 172
           P  L ++  S+ +     W       K +    +  +++ S + L   E +++F  ++ F
Sbjct: 327 PRRLSIIAESI-RDGLATWD----NWKHVNCDKLTTIIESSLNVLEPAEYRKMFDRLSVF 381

Query: 173 FKGEDVDFVTRV---------QDDPTSMHNGLNTLVEMSLITISAN--RLQMHDILQELG 221
                    T +         + D   +   +N L + SL+        + +  I  EL 
Sbjct: 382 --PPSAHIPTILLSLIWFDVIKSDVMVV---VNKLHKYSLVEKQPKESTISIPSIYLEL- 435

Query: 222 KTIILQESFKEPGKRSKLWDHKDVYQVLKK----NKGTDAIEGIFFDLSKINYLHLSPQA 277
                 +   E      + DH   Y + K     +     ++  F+  S I + HL    
Sbjct: 436 ----KVKLENEYALHRSIVDH---YNIPKTFDSDDLIPPYLDQYFY--SHIGH-HLKNIE 485

Query: 278 FANMSSLTLLKFYMPECNGVPIMSSKLHLNQDLEYLPKKLRYLHWHEYPLKTLPFSFEPN 337
                +L    F              + L  D  +L +K+R    H+        S   N
Sbjct: 486 HPERMTL----F------------RMVFL--DFRFLEQKIR----HDSTAWNASGSI-LN 522

Query: 338 YLIELNLPYSKVEQIWIGEKKAFKLKFINLYNSRYLTRLPEFSEIPNLERINLSGSELER 397
            L +L   Y      +I +              R +  + +F  +P +E  NL  S+   
Sbjct: 523 TLQQLKF-YKP----YICDNDP--------KYERLVNAILDF--LPKIEE-NLICSKYTD 566

Query: 398 L 398
           L
Sbjct: 567 L 567

PyMOL of 1vt4

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549	Back alignment and structure

>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591	Back alignment and structure

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		681
2a5y_B		549	CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis	99.97
3sfz_A		1249	APAF-1, apoptotic peptidase activating factor 1; a	99.93
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	99.91
1z6t_A		591	APAF-1, apoptotic protease activating factor 1; ca	99.89
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.88
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.86
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.84
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.83
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	99.83
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.82
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.82
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.82
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.82
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.82
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	99.81
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.8
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.8
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.8
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.8
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.79
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.79
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.79
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.79
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.78
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.78
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.78
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.78
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.77
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.77
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.77
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.77
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.77
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.76
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.76
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.76
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.76
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.76
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.76
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.76
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.75
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.75
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.75
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.75
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.75
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.75
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.74
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.74
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.74
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	99.74
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.74
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.73
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.73
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.73
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.73
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.73
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.73
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.72
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.72
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.72
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.72
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.72
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.72
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.71
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.71
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.71
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	99.7
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.7
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.7
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.7
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.69
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.68
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	99.68
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.68
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.68
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.67
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.67
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.66
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.66
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.66
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.65
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.65
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.65
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.64
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.64
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.62
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.61
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.61
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.59
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.59
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.57
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.56
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.55
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.54
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.54
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	99.54
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.52
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.51
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.51
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.5
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.5
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.5
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.49
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.49
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.48
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.47
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.47
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.46
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.46
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.46
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.43
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.42
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.42
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.42
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.41
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.41
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	99.4
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.4
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.39
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.33
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.33
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.32
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.3
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.29
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.29
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.28
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.26
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.25
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.24
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.23
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.23
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	99.18
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.17
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.14
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	99.13
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	99.04
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	99.03
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.02
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	98.99
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	98.95
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	98.94
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	98.9
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	98.89
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	98.8
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	98.78
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	98.74
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	98.69
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.65
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.48
2fna_A		357	Conserved hypothetical protein; structural genomic	98.36
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	98.29
2qen_A		350	Walker-type ATPase; unknown function; HET: ADP; 2.	98.27
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	98.19
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	97.94
1w5s_A		412	Origin recognition complex subunit 2 ORC2; replica	97.9
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	97.81
2qby_B		384	CDC6 homolog 3, cell division control protein 6 ho	97.44
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	97.43
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	97.37
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	97.35
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	97.34
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	97.25
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.22
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	97.17
1njg_A		250	DNA polymerase III subunit gamma; rossman-like fol	97.15
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	96.99
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	96.98
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	96.71
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	96.67
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	96.34
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	96.12
2qby_A		386	CDC6 homolog 1, cell division control protein 6 ho	96.11
2v1u_A		387	Cell division control protein 6 homolog; DNA repli	95.89
2chg_A		226	Replication factor C small subunit; DNA-binding pr	95.76
1sxj_B		323	Activator 1 37 kDa subunit; clamp loader, processi	95.0
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	94.51
1hqc_A		324	RUVB; extended AAA-ATPase domain, complex with nuc	93.51
1fnn_A		389	CDC6P, cell division control protein 6; ORC1, AAA	93.39
1iqp_A		327	RFCS; clamp loader, extended AAA-ATPase domain, co	92.68
1jr3_A		373	DNA polymerase III subunit gamma; processivity, pr	89.05
2chq_A		319	Replication factor C small subunit; DNA-binding pr	88.91
1d2n_A		272	N-ethylmaleimide-sensitive fusion protein; hexamer	85.25
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	82.67
3bos_A		242	Putative DNA replication factor; P-loop containing	82.37
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	81.26
1a5t_A		334	Delta prime, HOLB; zinc finger, DNA replication; 2	80.81

>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A*	Back alignment and structure

Probab=99.97  E-value=4.8e-31  Score=297.09  Aligned_cols=211  Identities=17%  Similarity=0.165  Sum_probs=173.6

Q ss_pred             chHHHHHHhCCC-eEEEEEECcChh--HHHhhcCCCCCCCCcEEEEEeCCchhhhccC-CceEEEcCCCCHHHHHHHHHH
Q 005709           12 ITPNIKKRLQQR-KVLIVLDDVDDN--SKNFAGGLELFSPGSRIIITTRDKRLLDKRR-VENVYEVKGLKHNSALELFCR   87 (681)
Q Consensus        12 ~~~~i~~~L~~k-r~LiVLDdv~~~--~~~l~~~~~~~~~gSrIivTTR~~~v~~~~~-~~~~~~l~~L~~~e~~~Lf~~   87 (681)
                      +...+++.|+++ ||||||||||+.  + .+..     .+||+||||||++.|+..++ ...+|+|++|+.+|||+||.+
T Consensus       231 l~~~l~~~L~~~kr~LlVLDdv~~~~~~-~~~~-----~~gs~ilvTTR~~~v~~~~~~~~~~~~l~~L~~~ea~~Lf~~  304 (549)
T 2a5y_B          231 LKRMICNALIDRPNTLFVFDDVVQEETI-RWAQ-----ELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEA  304 (549)
T ss_dssp             HHHHHHHHHTTSTTEEEEEEEECCHHHH-HHHH-----HTTCEEEEEESBGGGGGGCCSCEEEEECCCCCHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCCcEEEEEECCCCchhh-cccc-----cCCCEEEEEcCCHHHHHHcCCCCeEEECCCCCHHHHHHHHHH
Confidence            378999999996 999999999997  4 2221     28999999999999999886 456899999999999999999


Q ss_pred             HhccCCCCChhHHHHHHHHHHHcCCChhHHHHHHhhhcCCCHHHHHHHHH-HhhhcCChhHHHHHHHHhcCCCHHHHHHH
Q 005709           88 KAFRQNNRSPDLLELSEEVAHYANGNPLALQVLGSSLYQKSKEQWKDKLR-KLKLITDPNIYKVLKISYDGLNWEEKEIF  166 (681)
Q Consensus        88 ~af~~~~~~~~~~~~~~~i~~~c~GlPLai~~~g~~L~~k~~~~w~~~l~-~l~~~~~~~i~~~l~~sy~~L~~~~k~cf  166 (681)
                      +||+... .+.+.+++.+|+++|+|+||||+++|+.|+.++ ++|...+. .++.....++..++.+||++||+++|.||
T Consensus       305 ~a~~~~~-~~~~~~~~~~I~~~c~GlPLAl~~~g~~l~~~~-w~~~~~l~~~l~~~~~~~i~~~l~~Sy~~L~~~lk~~f  382 (549)
T 2a5y_B          305 YGMPMPV-GEKEEDVLNKTIELSSGNPATLMMFFKSCEPKT-FEKMAQLNNKLESRGLVGVECITPYSYKSLAMALQRCV  382 (549)
T ss_dssp             TSCCCC---CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSSS-HHHHHHHHHHHHHHCSSTTCCCSSSSSSSHHHHHHHHH
T ss_pred             HhcCCCC-chhHHHHHHHHHHHhCCChHHHHHHHHHhccch-HHHHHHhHHHhhcccHHHHHHHHhcccccccHHHHHHH
Confidence            9987643 467889999999999999999999999998875 33333333 23333566788999999999999999999


Q ss_pred             h-----------hhcccCCCCCHHHHHHhhc--CCCc----------hhhhHHHHhhccceeEe----CCeEeehHHHHH
Q 005709          167 L-----------DVACFFKGEDVDFVTRVQD--DPTS----------MHNGLNTLVEMSLITIS----ANRLQMHDILQE  219 (681)
Q Consensus       167 l-----------~~a~Fp~~~~~~~~~~i~~--~~~~----------~~~~~~~L~~~sli~~~----~~~~~mHdll~~  219 (681)
                      +           |||+||+++.++...|+++  |+..          ...++++|+++||++..    ..+|+|||+||+
T Consensus       383 ~~Ls~~er~l~~~ls~fp~~~~i~i~~w~a~~~G~i~~~~~~~~~~~~~~~l~~L~~rsLl~~~~~~~~~~~~mHdlv~~  462 (549)
T 2a5y_B          383 EVLSDEDRSALAFAVVMPPGVDIPVKLWSCVIPVDICSNEEEQLDDEVADRLKRLSKRGALLSGKRMPVLTFKIDHIIHM  462 (549)
T ss_dssp             HTSCHHHHHHTTGGGSSCTTCCEEHHHHHHHSCC-------CCCTHHHHHHHHHTTTBSSCSEEECSSSCEEECCHHHHH
T ss_pred             hccchhhhhHhhheeeeCCCCeeeeeeeeeeccceeccCCCCCCHHHHHHHHHHHHHcCCeeEecCCCceEEEeChHHHH
Confidence            9           9999999999997778888  6522          12379999999999986    247999999999


Q ss_pred             HHHHHhhhccc
Q 005709          220 LGKTIILQESF  230 (681)
Q Consensus       220 ~~~~i~~~e~~  230 (681)
                      ||++++.++++
T Consensus       463 ~a~~~~~~~~~  473 (549)
T 2a5y_B          463 FLKHVVDAQTI  473 (549)
T ss_dssp             HHHTTSCTHHH
T ss_pred             HHHHHHHHHHH
Confidence            99999887753

PyMOL of 2a5y

>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A*	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A*	Back alignment and structure

>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens}	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi}	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A*	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A*	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}	Back alignment and structure

>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix}	Back alignment and structure

>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus}	Back alignment and structure

>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C*	Back alignment and structure

>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20	Back alignment and structure

>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B*	Back alignment and structure

>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A	Back alignment and structure

>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A*	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		681
d2a5yb3		277	c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor	4e-25
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	2e-09
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	2e-07
d1jl5a_		353	c.10.2.6 (A:) Leucine rich effector protein YopM {	0.004
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	3e-07
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	4e-05
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	9e-07
d2omxa2		199	c.10.2.1 (A:37-235) Internalin B {Listeria monocyt	5e-05
d1xwdc1		242	c.10.2.7 (C:18-259) Follicle-stimulating hormone r	8e-05
d1h6ua2		227	c.10.2.1 (A:36-262) Internalin H {Listeria monocyt	4e-04
d2astb2		284	c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1	5e-04
d1h6ta2		210	c.10.2.1 (A:31-240) Internalin B {Listeria monocyt	6e-04
d1ogqa_		313	c.10.2.8 (A:) Polygalacturonase inhibiting protein	7e-04
d1a9na_		162	c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom	0.003
d1p9ag_		266	c.10.2.7 (G:) von Willebrand factor binding domain	0.003

>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

 Score =  103 bits (257), Expect = 4e-25
 Identities = 25/144 (17%), Positives = 45/144 (31%), Gaps = 6/144 (4%)

Query: 16  IKKRLQQRKVLIVLDDVDDNSKNFAGGLELFSPGSRIIITTRDKRLLDKRRVE-NVYEVK 74
               + +   L V DDV                  R ++TTRD  + +         EV 
Sbjct: 128 CNALIDRPNTLFVFDDVVQEETIR----WAQELRLRCLVTTRDVEISNAASQTCEFIEVT 183

Query: 75  GLKHNSALELFCRKAFRQNNRSPDLLELSEEVAHYANGNPLALQVLGSSLYQKSKEQWKD 134
            L+ +   +                 ++  +    ++GNP  L +   S   K+ E+   
Sbjct: 184 SLEIDECYDFLEAYGMPMPV-GEKEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQ 242

Query: 135 KLRKLKLITDPNIYKVLKISYDGL 158
              KL+      +  +   SY  L
Sbjct: 243 LNNKLESRGLVGVECITPYSYKSL 266

PyMOL of d2a5yb3

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		681
d2a5yb3		277	CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI	99.92
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.71
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.71
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.67
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.66
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.62
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.61
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.57
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.56
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.55
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.55
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.54
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.51
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.49
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.46
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.45
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.41
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.37
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.37
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.36
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	99.34
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	99.32
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.29
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.25
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.23
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.2
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.19
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	98.99
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	98.98
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	98.94
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	98.91
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.71
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.69
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	98.45
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	98.38
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	98.29
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.63
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.36
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	96.91
d2fnaa2		283	Archaeal ATPase SSO1545 {Sulfolobus solfataricus [	94.07
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	93.37
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	92.76
d1a5ta2		207	delta prime subunit of DNA polymerase III, N-domai	88.81
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	88.71
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	88.46
d1njfa_		239	delta prime subunit of DNA polymerase III, N-domai	84.14

>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]

Probab=99.92  E-value=4.9e-26  Score=230.66  Aligned_cols=149  Identities=17%  Similarity=0.145  Sum_probs=132.4

Q ss_pred             HHHHHHhCCCeEEEEEECcChh--HHHhhcCCCCCCCCcEEEEEeCCchhhhccCCc-eEEEcCCCCHHHHHHHHHHHhc
Q 005709           14 PNIKKRLQQRKVLIVLDDVDDN--SKNFAGGLELFSPGSRIIITTRDKRLLDKRRVE-NVYEVKGLKHNSALELFCRKAF   90 (681)
Q Consensus        14 ~~i~~~L~~kr~LiVLDdv~~~--~~~l~~~~~~~~~gSrIivTTR~~~v~~~~~~~-~~~~l~~L~~~e~~~Lf~~~af   90 (681)
                      ..+++.|.++|+||||||||+.  |+.+.      ..|||||||||+++|+..+... +.|+|++|+.+|||+||+++||
T Consensus       126 ~~~~~~L~~kr~LlVLDDv~~~~~~~~~~------~~~srilvTTR~~~v~~~~~~~~~~~~l~~L~~~ea~~Lf~~~~~  199 (277)
T d2a5yb3         126 MICNALIDRPNTLFVFDDVVQEETIRWAQ------ELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYDFLEAYGM  199 (277)
T ss_dssp             HHHHHHTTSTTEEEEEEEECCHHHHHHHH------HTTCEEEEEESBGGGGGGCCSCEEEEECCCCCHHHHHHHHHHTSC
T ss_pred             HHHHHHhccCCeeEecchhhHHhhhhhhc------ccCceEEEEeehHHHHHhcCCCCceEECCCCCHHHHHHHHHHHhC
Confidence            4577889999999999999998  76553      3689999999999999887654 6899999999999999999998


Q ss_pred             cCCCCChhHHHHHHHHHHHcCCChhHHHHHHhhhcCCCHHHHHHHHHHhhhcCChhHHHHHHHHhcCCCHHHHHHHhhh
Q 005709           91 RQNNRSPDLLELSEEVAHYANGNPLALQVLGSSLYQKSKEQWKDKLRKLKLITDPNIYKVLKISYDGLNWEEKEIFLDV  169 (681)
Q Consensus        91 ~~~~~~~~~~~~~~~i~~~c~GlPLai~~~g~~L~~k~~~~w~~~l~~l~~~~~~~i~~~l~~sy~~L~~~~k~cfl~~  169 (681)
                      ....+ +..++++++|+++|+|+||||+++|+.|+.++.++|.+..+++......++..++.+||++||+++|.||-++
T Consensus       200 ~~~~~-~~~~~~~~~iv~~c~GlPLAl~~ig~~l~~k~~~~~~~~~~~L~~~~~~~v~~il~~sY~~L~~~lk~c~~~l  277 (277)
T d2a5yb3         200 PMPVG-EKEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLESRGLVGVECITPYSYKSLAMALQRCVEVL  277 (277)
T ss_dssp             CCC---CHHHHHHHHHHHHHTTCHHHHHHHHTTCCSSSHHHHHHHHHHHHHHCSSTTCCCSSSSSSSHHHHHHHHHHTS
T ss_pred             CccCc-hhhHHHHHHHHHHhCCCHHHHHHHHHHhccCCHHHHHHHHHHHhcCcHHHHHHHHHHHHhcccHHHHHHHHhC
Confidence            76544 4568899999999999999999999999999999999999999888888899999999999999999999763

PyMOL of d2a5yb3

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure