Citrus Sinensis ID: 005739

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680

MVEVAEVENLDFKWGKKRGIGGKKKDVQFYQSFTYDGVEYTLYDCVYLYKEGDAEPHVGKLIKIWENADKAKKVKLLWFFRPSDISNFLGNVQTLENELILACGEGVGLTNINPLEAIAGKCNVVCTSKDARNPQPSDEELQISDFIFCRTFDVGLRKVLDKIDEKIAGIEVKFIFNRQGYQNSSVALKLDSNKKEVSKNATISDETVISAQQNIPESVSTKQEGGFIDTSVKQGVEASLIRQNSSLLDNVDLESGGKAKSGEGLEDISINSSNLRSKVKENEHTKVLTTKQKSSFAERPVSSVDSKAWLVGMKSSLGEKVSSIGGAQQGEIVRTIKPGITFGDKIASSSKVGFEKSKAKSSKALETKEEVKSFKDPNELYNGPSNKAKFDSSRKVFDDKIKNRVQKLGLDSNVHGPKPTLATIADEDKSKTKRAVAKDPHGIDKGPCKKPKLDEELLKPTSGKLVEASSLQPSIVENKSNKQIVEVTRRPSLDRSKWFKELPWEERIRVAHEHGTLVVLENLDPSYTSTVVEDLVWHAFKENCSAKMIPRVAFASPYFGQSFVIFKTREVAELVVTKLEEGCLLLSNGRPLLGSIGTPCFTGKQSKFVGHLALDKLKFQMQREMREAVSTSHCSQPNSLEYDMAIEWSLLQERLDCAWKKLYEQQELELKKLKVKLKSK

ccccccccccccEEcccccccccccccEEEEEEEEccEEEEEccEEEEEEcccccccEEEEEEEEEccccccEEEEEEEEccccccccccccccccccEEEEcccccccccccccccEEcEEEEEEcccccccccccccccccccEEEEEEEEccccEEHHHHHHHHHccEEEEEEccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccEEEEccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHHccccccccccccccccccccEEEEEEcHHHHHHHHHHHHccEEEEEcccEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc

ccccccccccEEEEccccccccccccEEEEEEEEEccEEEEEccEEEEEcccccccEEEEEEEEEEcccccEEEEEEEEEcHHHHHHHcccccccccEEEEEccccccccccccHHHHccccEEEEEcccccccccccHHHccccEEEEEEEEcccEEEccccHHHHcccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccEEEccccccHHHHHcccccEEEEcccccccHcccHcccccccHHccccccccccEcccccccccEEEEEccccccccccccccccccccHHHcccccccccccEEcccccccccccccccEEEEccccEcccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccHcHHHccccccccccccccccccccccccccEEEEcccccccHHHHcccccHHHHHHHHHHcccEEEEEcccccccHHHHHHHHHHHHHHcccEEEccccccccccccEEEEEEccHHHHHHHHHHHcccEEEEEcccEEEEEcccccccccccccEEEEEHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc

MVEVAEVenldfkwgkkrgiggkkkDVQFYQSFtydgveytlYDCVYlykegdaephvGKLIKIWENADKAKKVKLLWffrpsdisnfLGNVQTLENELILACgegvgltninpleaiagkcnvvctskdarnpqpsdeelqisdfifCRTFDVGLRKVLDKIDEKIAGIEVKFIFNrqgyqnssvalkldsnkkevsknatisdETVISaqqnipesvstkqeggfidtSVKQGVEASLIRqnsslldnvdlesggkaksgegledisinssnlrskvkenehtkVLTTkqkssfaerpvssvdskAWLVGMKSslgekvssiggaqqgeivrtikpgitfgdkiassskvgfekskaksskaletkeevksfkdpnelyngpsnkakfdssrKVFDDKIKNRVQklgldsnvhgpkptlatiadedksktkravakdphgidkgpckkpkldeellkptsgklveasslqpsivenksnkqivevtrrpsldrskwfkelpWEERIRVAHEHGTLVVlenldpsytsTVVEDLVWHAFKEncsakmiprvafaspyfgqsfVIFKTREVAELVVTKLEEGCLLlsngrpllgsigtpcftgkqskfvghLALDKLKFQMQREMREavstshcsqpnsleYDMAIEWSLLQERLDCAWKKLYEQQELELKKLKVKLKSK

mvevaevenldfkwgkkrgiggkkkdvqFYQSFTYDGVEYTLYDCVYLYKEGDAEPHVGKLIKIWENADKAKKVKLLWFFRPSDISNFLGNVQTLENELILACGEGVGLTNINPLEAIAGKCNVVCTSKDARnpqpsdeelqisdFIFCRTFDVGLRKVLDKIDEKIAGIEVKFifnrqgyqnssvalkldsnkkevsknatisdetvisaqqnipesvstkqeggFIDTSVKQGVEASLIrqnsslldnvdlesggkaksgegledisinssnlrskvkenehtkvlttkqkssfaerpvssvdskAWLVGMKSSLGEKvssiggaqqgeivrtikpgitfgdkiassskvgfekskaksskaletkeevksfkdpnelyngpsnkakfdssrKVFDDKIKNRvqklgldsnvhgpkptlatiadedksktkravakdphgidkgpckkpkldEELLKPTSGKlveasslqpsivenksnkqivevtrrpsldrskwfkelpweERIRVAHEHGTLVVLENLDPSYTSTVVEDLVWHAFKENCSAKMIPRVAFASPYFGQSFVIFKTREVAELVVTKLEEGCLLLSNGRPLLGSIGTPCFTGKQSKFVGHLALDKLKFQMQREMREAvstshcsqpnsLEYDMAIEWSLLQERLDCAWKKLYEQQElelkklkvklksk

MVEVAEVENLDFkwgkkrgiggkkkDVQFYQSFTYDGVEYTLYDCVYLYKEGDAEPHVGKLIKIWENADKAKKVKLLWFFRPSDISNFLGNVQTLENELILACGEGVGLTNINPLEAIAGKCNVVCTSKDARNPQPSDEELQISDFIFCRTFDVGLRKVLDKIDEKIAGIEVKFIFNRQGYQNSSVALKLDSNKKEVSKNATISDETVISAQQNIPESVSTKQEGGFIDTSVKQGVEASLIRQNSSLLDNVDLESGGKAKSGEGLEDISINSSNLRSKVKENEHTKVLTTKQKSSFAERPVSSVDSKAWLVGMKSSLGEKVSSIGGAQQGEIVRTIKPGITFGDKIASSSKVGFekskaksskaletkeeVKSFKDPNELYNGPSNKAKFDSSRKVFDDKIKNRVQKLGLDSNVHGPKPTLATIADEDKSKTKRAVAKDPHGIDKGPCkkpkldeellkpTSGKLVEASSLQPSIVENKSNKQIVEVTRRPSLDRSKWFKELPWEERIRVAHEHGTLVVLENLDPSYTSTVVEDLVWHAFKENCSAKMIPRVAFASPYFGQSFVIFKTREVAELVVTKLEEGCLLLSNGRPLLGSIGTPCFTGKQSKFVGHLALDKLKFQMQREMREAVSTSHCSQPNSLEYDMAIEWSLLQERLDCAWkklyeqqelelkklkvklksk

*******ENLDFKWGKKRGIGGKKKDVQFYQSFTYDGVEYTLYDCVYLYKEGDAEPHVGKLIKIWENADKAKKVKLLWFFRPSDISNFLGNVQTLENELILACGEGVGLTNINPLEAIAGKCNVVCT*************LQISDFIFCRTFDVGLRKVLDKIDEKIAGIEVKFIFNRQGYQN*****************************************************************************************************************************WLVG*****************GEIVRTIKPGITFG*******************************************************************************************************************************************************RSKWFKELPWEERIRVAHEHGTLVVLENLDPSYTSTVVEDLVWHAFKENCSAKMIPRVAFASPYFGQSFVIFKTREVAELVVTKLEEGCLLLSNGRPLLGSIGTPCFTGKQSKFVGHLALDKLKFQM*****************SLEYDMAIEWSLLQERLDCAWKKLYEQQEL************

**************************VQFYQSFTYDGVEYTLYDCVYLYKEGDAEPHVGKLIKIWENADKAKKVKLLWFFRPSDISNFLGNVQTLENELILACGEGVGLTNINPLEAIAGKCNVVCTS***************SDFIFCRTFDVGLRKVLDKIDEKIAGIEVKFIFNR*************************************************************************************************************************************************************************************************************************************************************************************************************************************WEERIRVAHEHGTLVVLENLDPSYTSTVVEDLVWHAFKENCSAKMIPRVAFASPYFGQSFVIFKTREVAELVVTKLEEGCLLLSNGRPLLGSIGTPCFTGKQSKFVGHLALDKL*****************SQPNSLEYDMAIEWSLLQERLDCAWKK************KV*L***

MVEVAEVENLDFKWGKKRGIGGKKKDVQFYQSFTYDGVEYTLYDCVYLYKEGDAEPHVGKLIKIWENADKAKKVKLLWFFRPSDISNFLGNVQTLENELILACGEGVGLTNINPLEAIAGKCNVVCTSKDARNPQPSDEELQISDFIFCRTFDVGLRKVLDKIDEKIAGIEVKFIFNRQGYQNSSVALKLD********NATISDETVISAQQNIPESVSTKQEGGFIDTSVKQGVEASLIRQNSSLLDNVDLESGGKAKSGEGLEDISINSSNLRSKVKENEHTKVLTTK***********SVDSKAWLVGMKSSLGEKVSSIGGAQQGEIVRTIKPGITFGDKIASS***********************SFKDPNELYNGPSNKAKFDSSRKVFDDKIKNRVQKLGLDSNVHGPKPTLATIADE**************GIDKGPCKKPKLDEELLKPTSGKLVEASSLQPSIVENKSNKQIVEVTRRPSLDRSKWFKELPWEERIRVAHEHGTLVVLENLDPSYTSTVVEDLVWHAFKENCSAKMIPRVAFASPYFGQSFVIFKTREVAELVVTKLEEGCLLLSNGRPLLGSIGTPCFTGKQSKFVGHLALDKLKFQMQ*************QPNSLEYDMAIEWSLLQERLDCAWKKLYEQQELELKKLKVKLKSK

********NLDFKWGKKRGIGGKKKDVQFYQSFTYDGVEYTLYDCVYLYKEGDAEPHVGKLIKIWENADKAKKVKLLWFFRPSDISNFLGNVQTLENELILACGEGVGLTNINPLEAIAGKCNVVCTSKDARNPQPSDEELQISDFIFCRTFDVGLRKVLDKIDEKIAGIEVKFIFNRQG************************************************************************************LEDISINSSNLRSKV*ENEHTKVLTT****************************EK*********GEIVR**KPGITF*****************************KSFKDPNELYNGPSNKAKFDSSRKVFDDKIKNRVQKL***********************************************************************SNKQIVEVTRRPSLDRSKWFKELPWEERIRVAHEHGTLVVLENLDPSYTSTVVEDLVWHAFKENCSAKMIPRVAFASPYFGQSFVIFKTREVAELVVTKLEEGCLLLSNGRPLLGSIGTPCFTGKQSKFVGHLALDKLKFQMQREMREAVSTSHCSQPNSLEYDMAIEWSLLQERLDCAWKKLYEQQELELKKLKVKL***

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		680
255551070		730	hypothetical protein RCOM_0803370 [Ricin	0.964	0.898	0.453	1e-165
449437312		600	PREDICTED: uncharacterized protein LOC10	0.876	0.993	0.480	1e-155
449509146		600	PREDICTED: uncharacterized protein LOC10	0.876	0.993	0.479	1e-155
357466625		672	hypothetical protein MTR_3g109470 [Medic	0.945	0.956	0.455	1e-147
296081917		628	unnamed protein product [Vitis vinifera]	0.838	0.907	0.428	1e-138
224089068		545	predicted protein [Populus trichocarpa]	0.645	0.805	0.482	1e-102
297811263		695	hypothetical protein ARALYDRAFT_487983 [	0.888	0.869	0.381	1e-102
334187617		757	bromo-adjacent homology (BAH) domain-con	0.926	0.832	0.381	1e-101
7573404		691	putative protein [Arabidopsis thaliana]	0.888	0.874	0.385	1e-98
224141801		542	predicted protein [Populus trichocarpa]	0.476	0.597	0.527	1e-86

>gi\|255551070\|ref\|XP_002516583.1\| hypothetical protein RCOM_0803370 [Ricinus communis] gi\|223544403\|gb\|EEF45924.1\| hypothetical protein RCOM_0803370 [Ricinus communis]	Back alignment and taxonomy information

 Score =  589 bits (1518), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 338/746 (45%), Positives = 449/746 (60%), Gaps = 90/746 (12%)

Query: 1   MVEVAEVENLDFKWGKKRGIGGKKKDVQFYQSFTYDGVEYTLYDCVYLYKEGDAEPHVGK 60
           M++  E EN++FKWG KRG+GG+KKDVQFY+SFT+DGVEY LYD VY+Y + + EP++GK
Sbjct: 1   MIQAKEDENIEFKWGNKRGVGGRKKDVQFYESFTFDGVEYMLYDSVYMYADIETEPYIGK 60

Query: 61  LIKIWENADKAKKVKLLWFFRPSDISNFLGNVQTLENELILACGEGVGLTNINPLEAIAG 120
           +IKIWEN+DK K+VK+LWFFRP +ISN+L   +T +NEL LA G+GVGL N+NPLEAIAG
Sbjct: 61  IIKIWENSDKTKRVKILWFFRPCEISNYLEANETSKNELFLASGDGVGLANVNPLEAIAG 120

Query: 121 KCNVVCTSKDARNPQPSDEELQISDFIFCRTFDVGLRKVLDKIDEKIAGIEVKFIFNRQG 180
           KCNV+C SKD+RNPQPS+EELQ++DFIF R FDVG   +LDKID+KIA ++VKF+ N+  
Sbjct: 121 KCNVICISKDSRNPQPSNEELQMADFIFFRIFDVGRHVILDKIDDKIAQVDVKFLLNKVN 180

Query: 181 YQNSSVALKLDSNKKEVSKNATI-SDETVISAQQN-IPESVSTKQEGGFIDTSVKQGVEA 238
            Q S V  + DS KKE+S NA + +D T +S++ N + E ++ K +   ID   K+  ++
Sbjct: 181 SQKSHVVPERDSIKKEISGNAIVAADGTTLSSEMNAMVERINLKTDDSSIDPLSKEDADS 240

Query: 239 --------SLIRQNSSLLDNVDLESGGKAKSGEGLEDISINSSNLRSKVKENEHTKVLTT 290
                   S + Q  +   + +L+   K    +G  D S   +   SKVK+N     L  
Sbjct: 241 IVLLPNQRSSVGQKPASFSSDELDEIAKIDHAQG--DFSGGKTISHSKVKDNSELITLDV 298

Query: 291 KQKSSFAERPVSSV--------------------------------DSKAWLVGMKSSLG 318
           KQKSS  E+P S++                                D K  LV  +SSLG
Sbjct: 299 KQKSSLGEKPTSNIVGKLAGEATISDPHKDTASDKIRSRTEDEEIADPKPLLVRQRSSLG 358

Query: 319 EKVSS-----IGGAQQGE-------IVRTIKPGITFG--DKIASSSKVG----------- 353
           EK +S     I   ++ E       I R+I   I     DK+  SS+             
Sbjct: 359 EKHASKELDRIDKNKKQESMSNDKIISRSIGDPIRPSKIDKLGGSSEASGGNKEKIVHKL 418

Query: 354 FEKSKAKSSKALETKEE--VKSFKDPNELYNGPSNKAKFDSSRKVFDDKIKNRVQKLGLD 411
              SK    KA E   E  VK+ +D     N      K D S K  D K  +R       
Sbjct: 419 IPDSKRCEGKASEVHAEVKVKALEDSCRFANRALKNDKLDGSFKHCDAKAVDRT------ 472

Query: 412 SNVHGPKPTLATIADEDKSKTKRAVAKDPHGIDKGPCKKPKLDEELLKPTSGKLVEASSL 471
                     AT   E    +KR + KDP+  +    KK KLDE+L K  +GKL   S  
Sbjct: 473 ----------ATTTGE---ISKRKLVKDPNETEILSFKKRKLDEKLTKFANGKLPRESPR 519

Query: 472 QPSIVENKSNKQIVEVTRRPSLDRSKWFKELPWEERIRVAHEHGTLVVLENLDPSYTSTV 531
           + S   + ++ +I+EVTRRP  D+ KWFK LPWEERI+ AH  G +V+L+NLDPS+T   
Sbjct: 520 EVSNDVSNTDSKILEVTRRPEADKIKWFKGLPWEERIKAAHAEGRIVLLQNLDPSFTGLE 579

Query: 532 VEDLVWHAFKENCSAKMIPRVAFASPYFGQSFVIFKTREVAELVVTKLEEGCLLLSNGRP 591
           VED+VWHA K++C+AKMIP  AF+SP+ GQ+F IFKTRE AE  VTKL+EGCL+ S GRP
Sbjct: 580 VEDIVWHALKQSCTAKMIPCTAFSSPHSGQAFAIFKTREAAETAVTKLDEGCLMTSYGRP 639

Query: 592 LLGSIGTPCFTGKQSKFVGHLALDKLKFQMQREMREAVSTSHCSQPNSLEYDMAIEWSLL 651
           L+GSI    F GK S + GH+++DK + QMQR MREAVSTSHCSQPN++EYDMA+EW  L
Sbjct: 640 LVGSIAKLSFPGKPSTYFGHMSIDKTRHQMQRVMREAVSTSHCSQPNTIEYDMALEWCFL 699

Query: 652 QERLDCAWKKLYEQQELELKKLKVKL 677
           QE+ +  W+ LY+Q   EL+KL+  L
Sbjct: 700 QEQTNQEWELLYKQHGKELRKLESTL 725

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|449437312\|ref\|XP_004136436.1\| PREDICTED: uncharacterized protein LOC101208860 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449509146\|ref\|XP_004163508.1\| PREDICTED: uncharacterized protein LOC101231100 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|357466625\|ref\|XP_003603597.1\| hypothetical protein MTR_3g109470 [Medicago truncatula] gi\|355492645\|gb\|AES73848.1\| hypothetical protein MTR_3g109470 [Medicago truncatula]	Back alignment and taxonomy information

>gi\|296081917\|emb\|CBI20922.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224089068\|ref\|XP_002308622.1\| predicted protein [Populus trichocarpa] gi\|222854598\|gb\|EEE92145.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|297811263\|ref\|XP_002873515.1\| hypothetical protein ARALYDRAFT_487983 [Arabidopsis lyrata subsp. lyrata] gi\|297319352\|gb\|EFH49774.1\| hypothetical protein ARALYDRAFT_487983 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|334187617\|ref\|NP_196708.5\| bromo-adjacent homology (BAH) domain-containing protein [Arabidopsis thaliana] gi\|332004300\|gb\|AED91683.1\| bromo-adjacent homology (BAH) domain-containing protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|7573404\|emb\|CAB87707.1\| putative protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|224141801\|ref\|XP_002324251.1\| predicted protein [Populus trichocarpa] gi\|222865685\|gb\|EEF02816.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

No hits with e-value below 0.001 by BLAST

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		680
cd04715		159	cd04715, BAH_Orc1p_like, BAH, or Bromo Adjacent Ho	1e-69
cd04370		123	cd04370, BAH, BAH, or Bromo Adjacent Homology doma	1e-18
pfam01426		120	pfam01426, BAH, BAH domain	2e-13
smart00439		121	smart00439, BAH, Bromo adjacent homology domain	3e-10
cd04714		121	cd04714, BAH_BAHCC1, BAH, or Bromo Adjacent Homolo	6e-08
cd04717		121	cd04717, BAH_polybromo, BAH, or Bromo Adjacent Hom	9e-08
cd04713		146	cd04713, BAH_plant_3, BAH, or Bromo Adjacent Homol	9e-08
cd04710		135	cd04710, BAH_fungalPHD, BAH, or Bromo Adjacent Hom	0.001

>gnl\|CDD\|240066 cd04715, BAH_Orc1p_like, BAH, or Bromo Adjacent Homology domain, as present in the Schizosaccharomyces pombe homolog of Saccharomyces cerevisiae Orc1p and similar proteins	Back alignment and domain information

 Score =  223 bits (571), Expect = 1e-69
 Identities = 97/160 (60%), Positives = 118/160 (73%), Gaps = 4/160 (2%)

Query: 11  DFKWGKKRGIGGKKKDVQFYQSFTYDGVEYTLYDCVYLYKEGDAEPHVGKLIKIWENADK 70
           +FKWG KRG GGKKKD QFY+SFTYDGVEY LYD VY++  GD+EP++GK+IKI+E A  
Sbjct: 1   EFKWGVKRGEGGKKKDGQFYRSFTYDGVEYRLYDDVYVH-NGDSEPYIGKIIKIYETAID 59

Query: 71  --AKKVKLLWFFRPSDISNFL-GNVQTLENELILACGEGVGLTNINPLEAIAGKCNVVCT 127
              KKVK++WFFRPS+I   L G  +   NE+ LACG G GL NIN LE+I GKCNVVC 
Sbjct: 60  SGKKKVKVIWFFRPSEIRMELKGEPKRHINEVFLACGRGEGLANINLLESIIGKCNVVCI 119

Query: 128 SKDARNPQPSDEELQISDFIFCRTFDVGLRKVLDKIDEKI 167
           S+D RNPQPSD     +DF+F   FDVG   ++DK D+KI
Sbjct: 120 SEDFRNPQPSDGIPTSADFLFPCNFDVGRCVIVDKYDDKI 159

Orc1 is part of the Yeast Sir1-origin recognition complex, the Orc1p BAH doman functions in epigenetic silencing. BAH domains are found in a variety of proteins playing roles in transcriptional silencing and the remodeling of chromatin. It is assumed that in most or all of these instances the BAH domain mediates protein-protein interactions. Length = 159

>gnl\|CDD\|239835 cd04370, BAH, BAH, or Bromo Adjacent Homology domain (also called ELM1 and BAM for Bromo Adjacent Motif)	Back alignment and domain information

>gnl\|CDD\|216495 pfam01426, BAH, BAH domain	Back alignment and domain information

>gnl\|CDD\|214664 smart00439, BAH, Bromo adjacent homology domain	Back alignment and domain information

>gnl\|CDD\|240065 cd04714, BAH_BAHCC1, BAH, or Bromo Adjacent Homology domain, as present in mammalian BAHCC1 and similar proteins	Back alignment and domain information

>gnl\|CDD\|240068 cd04717, BAH_polybromo, BAH, or Bromo Adjacent Homology domain, as present in polybromo and yeast RSC1/2	Back alignment and domain information

>gnl\|CDD\|240064 cd04713, BAH_plant_3, BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function	Back alignment and domain information

>gnl\|CDD\|240061 cd04710, BAH_fungalPHD, BAH, or Bromo Adjacent Homology domain, as present in fungal proteins containing PHD domains	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		680
cd04715		159	BAH_Orc1p_like BAH, or Bromo Adjacent Homology dom	100.0
cd04713		146	BAH_plant_3 BAH, or Bromo Adjacent Homology domain	99.96
cd04716		122	BAH_plantDCM_I BAH, or Bromo Adjacent Homology dom	99.95
cd04714		121	BAH_BAHCC1 BAH, or Bromo Adjacent Homology domain,	99.92
cd04717		121	BAH_polybromo BAH, or Bromo Adjacent Homology doma	99.92
cd04370		123	BAH BAH, or Bromo Adjacent Homology domain (also c	99.91
cd04760		124	BAH_Dnmt1_I BAH, or Bromo Adjacent Homology domain	99.91
cd04721		130	BAH_plant_1 BAH, or Bromo Adjacent Homology domain	99.9
smart00439		120	BAH Bromo adjacent homology domain.	99.9
PF01426		119	BAH: BAH domain; InterPro: IPR001025 The BAH (brom	99.89
cd04710		135	BAH_fungalPHD BAH, or Bromo Adjacent Homology doma	99.86
cd04709		164	BAH_MTA BAH, or Bromo Adjacent Homology domain, as	99.86
cd04712		130	BAH_DCM_I BAH, or Bromo Adjacent Homology domain,	99.82
cd04708		202	BAH_plantDCM_II BAH, or Bromo Adjacent Homology do	99.82
cd04720		179	BAH_Orc1p_Yeast BAH, or Bromo Adjacent Homology do	99.81
cd04719		128	BAH_Orc1p_animal BAH, or Bromo Adjacent Homology d	99.71
cd04718		148	BAH_plant_2 BAH, or Bromo Adjacent Homology domain	99.63
KOG1886		464	consensus BAH domain proteins [Transcription]	99.6
cd04711		137	BAH_Dnmt1_II BAH, or Bromo Adjacent Homology domai	99.43
KOG1827		629	consensus Chromatin remodeling complex RSC, subuni	99.13
PF00076		70	RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or	98.19
PLN03134		144	glycine-rich RNA-binding protein 4; Provisional	97.48
KOG3554		693	consensus Histone deacetylase complex, MTA1 compon	97.27
smart00362		72	RRM_2 RNA recognition motif.	97.2
cd00590		74	RRM RRM (RNA recognition motif), also known as RBD	97.04
smart00360		71	RRM RNA recognition motif.	96.99
TIGR01628		562	PABP-1234 polyadenylate binding protein, human typ	96.66
TIGR01659		346	sex-lethal sex-lethal family splicing factor. This	96.52
TIGR01659		346	sex-lethal sex-lethal family splicing factor. This	96.48
TIGR01648		578	hnRNP-R-Q heterogeneous nuclear ribonucleoprotein	96.16
TIGR01648		578	hnRNP-R-Q heterogeneous nuclear ribonucleoprotein	95.89
TIGR01661		352	ELAV_HUD_SF ELAV/HuD family splicing factor. These	95.89
KOG0533		243	consensus RRM motif-containing protein [RNA proces	95.72
TIGR01642		509	U2AF_lg U2 snRNP auxilliary factor, large subunit,	95.64
TIGR01661		352	ELAV_HUD_SF ELAV/HuD family splicing factor. These	95.48
TIGR01622		457	SF-CC1 splicing factor, CC1-like family. A homolog	95.45
TIGR01642		509	U2AF_lg U2 snRNP auxilliary factor, large subunit,	95.13
TIGR01649		481	hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor	95.12
PF14259		70	RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or	95.06
TIGR01649		481	hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor	94.8
PLN03120		260	nucleic acid binding protein; Provisional	94.78
TIGR01628		562	PABP-1234 polyadenylate binding protein, human typ	94.61
smart00361		70	RRM_1 RNA recognition motif.	94.56
TIGR01645		612	half-pint poly-U binding splicing factor, half-pin	94.38
PF13893		56	RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or	94.16
TIGR01622		457	SF-CC1 splicing factor, CC1-like family. A homolog	93.97
COG0724		306	RNA-binding proteins (RRM domain) [General functio	93.33
KOG0117		506	consensus Heterogeneous nuclear ribonucleoprotein	92.46
PLN03121		243	nucleic acid binding protein; Provisional	92.3
TIGR01645		612	half-pint poly-U binding splicing factor, half-pin	91.54
KOG0131		203	consensus Splicing factor 3b, subunit 4 [RNA proce	87.83
KOG0110		725	consensus RNA-binding protein (RRM superfamily) [G	86.13
KOG4206		221	consensus Spliceosomal protein snRNP-U1A/U2B [RNA	84.46
KOG0123		369	consensus Polyadenylate-binding protein (RRM super	83.16
KOG0123		369	consensus Polyadenylate-binding protein (RRM super	82.5
COG5076		371	Transcription factor involved in chromatin remodel	80.1

>cd04715 BAH_Orc1p_like BAH, or Bromo Adjacent Homology domain, as present in the Schizosaccharomyces pombe homolog of Saccharomyces cerevisiae Orc1p and similar proteins	Back alignment and domain information

Probab=100.00  E-value=4.4e-41  Score=319.72  Aligned_cols=156  Identities=60%  Similarity=0.991  Sum_probs=145.3

Q ss_pred             eeeeccccCCCCCCCcceeEEEEEECCEEEEeCceEEEeeCCCCCCeEEEEEEEEeeCC--CceEEEEEeecChhccccc
Q 005739           11 DFKWGKKRGIGGKKKDVQFYQSFTYDGVEYTLYDCVYLYKEGDAEPHVGKLIKIWENAD--KAKKVKLLWFFRPSDISNF   88 (680)
Q Consensus        11 ~fKWGkkrGvgGKkkd~~fYeSft~dG~tYrLGDCVyVkseg~~ePYIGRIvemWE~~D--Gek~VkVqWFyRPEEI~~~   88 (680)
                      +||||+++|.|||+++++||+|+.++|.+|+|||||||++++ .+||||+|++||++.+  |.++|+|+|||||+||...
T Consensus         1 ~~~~~~~~g~~~~~~~~~~Y~s~~~~g~~y~lGD~Vlv~s~~-~~~yIgkI~~iwe~~~~~g~~~~~v~WfyRp~E~~~~   79 (159)
T cd04715           1 EFKWGVKRGEGGKKKDGQFYRSFTYDGVEYRLYDDVYVHNGD-SEPYIGKIIKIYETAIDSGKKKVKVIWFFRPSEIRME   79 (159)
T ss_pred             CcccceecccccccCCceEEEEEEECCEEEeCCCEEEEeCCC-CCCEEEEEEEEEEcCCcCCceEEEEEeeeCHHHhccc
Confidence            599999999999999999999999999999999999999855 7999999999999876  8999999999999998754


Q ss_pred             CCC-ccCCCCceEEecCCCCcccccCccceeecceEEEecCCCcCCCCCCCccCCCCcEEEEeeeeCcceEEEehhhhhh
Q 005739           89 LGN-VQTLENELILACGEGVGLTNINPLEAIAGKCNVVCTSKDARNPQPSDEELQISDFIFCRTFDVGLRKVLDKIDEKI  167 (680)
Q Consensus        89 lg~-~~~~pNELFLSsgeg~g~~DdNPLe~I~GKC~VVsiskD~rn~rPS~~ei~~aDFYf~R~YDv~t~RivD~f~dkI  167 (680)
                      +.+ ..+++||||||+|.+.++.|+|||+||+|||+|++++++.++++||+..++.++|+|+|.||++.+..++.|+|+|
T Consensus        80 ~~~~~~~~~nEvFlS~~~d~~~~~~n~l~sI~gKC~Vl~~~ey~~~~~~s~~~~~~~~~~f~~~f~~~~~~~~~~~~d~~  159 (159)
T cd04715          80 LKGEPKRHINEVFLACGRGEGLANINLLESIIGKCNVVCISEDFRNPQPSDGIPTSADFLFPCNFDVGRCVIVDKYDDKI  159 (159)
T ss_pred             cccCcccCCCcEEEecCcCccccccCcHHHccceeEEEEehHhhhCCCCcCCccccCcceeeeEEEecCceecccccCCC
Confidence            433 3688999999999888889999999999999999999999999999999999999999999999999999999987

>cd04713 BAH_plant_3 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function	Back alignment and domain information

>cd04716 BAH_plantDCM_I BAH, or Bromo Adjacent Homology domain, first copy present in DNA (Cytosine-5)-methyltransferases (DCM) from plants	Back alignment and domain information

>cd04714 BAH_BAHCC1 BAH, or Bromo Adjacent Homology domain, as present in mammalian BAHCC1 and similar proteins	Back alignment and domain information

>cd04717 BAH_polybromo BAH, or Bromo Adjacent Homology domain, as present in polybromo and yeast RSC1/2	Back alignment and domain information

>cd04370 BAH BAH, or Bromo Adjacent Homology domain (also called ELM1 and BAM for Bromo Adjacent Motif)	Back alignment and domain information

>cd04760 BAH_Dnmt1_I BAH, or Bromo Adjacent Homology domain, first copy present in DNA (Cytosine-5)-methyltransferases from Bilateria, Dnmt1 and similar proteins	Back alignment and domain information

>cd04721 BAH_plant_1 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function	Back alignment and domain information

>smart00439 BAH Bromo adjacent homology domain	Back alignment and domain information

>PF01426 BAH: BAH domain; InterPro: IPR001025 The BAH (bromo-adjacent homology) family contains proteins such as eukaryotic DNA (cytosine-5) methyltransferases IPR001525 from INTERPRO, the origin recognition complex 1 (Orc1) proteins, as well as several proteins involved in transcriptional regulation	Back alignment and domain information

>cd04710 BAH_fungalPHD BAH, or Bromo Adjacent Homology domain, as present in fungal proteins containing PHD domains	Back alignment and domain information

>cd04709 BAH_MTA BAH, or Bromo Adjacent Homology domain, as present in MTA1 and similar proteins	Back alignment and domain information

>cd04712 BAH_DCM_I BAH, or Bromo Adjacent Homology domain, as present in DNA (Cytosine-5)-methyltransferases (DCM) 1	Back alignment and domain information

>cd04708 BAH_plantDCM_II BAH, or Bromo Adjacent Homology domain, second copy present in DNA (Cytosine-5)-methyltransferases (DCM) from plants	Back alignment and domain information

>cd04720 BAH_Orc1p_Yeast BAH, or Bromo Adjacent Homology domain, as present in Orc1p, which again is part of the Saccharomyces cerevisiae Sir1-origin recognition complex, and as present in Sir3p	Back alignment and domain information

>cd04719 BAH_Orc1p_animal BAH, or Bromo Adjacent Homology domain, as present in animal homologs of Saccharomyces cerevisiae Orc1p	Back alignment and domain information

>cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function	Back alignment and domain information

>KOG1886 consensus BAH domain proteins [Transcription]	Back alignment and domain information

>cd04711 BAH_Dnmt1_II BAH, or Bromo Adjacent Homology domain, second copy present in DNA (Cytosine-5)-methyltransferases from Bilateria, Dnmt1 and similar proteins	Back alignment and domain information

>KOG1827 consensus Chromatin remodeling complex RSC, subunit RSC1/Polybromo and related proteins [Chromatin structure and dynamics; Transcription]	Back alignment and domain information

>PF00076 RRM_1: RNA recognition motif	Back alignment and domain information

>PLN03134 glycine-rich RNA-binding protein 4; Provisional	Back alignment and domain information

>KOG3554 consensus Histone deacetylase complex, MTA1 component [Chromatin structure and dynamics]	Back alignment and domain information

>smart00362 RRM_2 RNA recognition motif	Back alignment and domain information

>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability	Back alignment and domain information

>smart00360 RRM RNA recognition motif	Back alignment and domain information

>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family	Back alignment and domain information

>TIGR01659 sex-lethal sex-lethal family splicing factor	Back alignment and domain information

>TIGR01659 sex-lethal sex-lethal family splicing factor	Back alignment and domain information

>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family	Back alignment and domain information

>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family	Back alignment and domain information

>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor	Back alignment and domain information

>KOG0533 consensus RRM motif-containing protein [RNA processing and modification]	Back alignment and domain information

>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor	Back alignment and domain information

>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor	Back alignment and domain information

>TIGR01622 SF-CC1 splicing factor, CC1-like family	Back alignment and domain information

>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor	Back alignment and domain information

>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family	Back alignment and domain information

>PF14259 RRM_6: RNA recognition motif (a	Back alignment and domain information

>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family	Back alignment and domain information

>PLN03120 nucleic acid binding protein; Provisional	Back alignment and domain information

>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family	Back alignment and domain information

>smart00361 RRM_1 RNA recognition motif	Back alignment and domain information

>TIGR01645 half-pint poly-U binding splicing factor, half-pint family	Back alignment and domain information

>PF13893 RRM_5: RNA recognition motif	Back alignment and domain information

>TIGR01622 SF-CC1 splicing factor, CC1-like family	Back alignment and domain information

>COG0724 RNA-binding proteins (RRM domain) [General function prediction only]	Back alignment and domain information

>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification]	Back alignment and domain information

>PLN03121 nucleic acid binding protein; Provisional	Back alignment and domain information

>TIGR01645 half-pint poly-U binding splicing factor, half-pint family	Back alignment and domain information

>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification]	Back alignment and domain information

>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only]	Back alignment and domain information

>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification]	Back alignment and domain information

>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		680
1w4s_A		174	Polybromo, polybromo 1 protein; BAH, bromo-associa	2e-24
4dov_A		163	ORC1, origin recognition complex subunit 1; DNA re	1e-17
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	7e-14
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	6e-04
3swr_A		1002	DNA (cytosine-5)-methyltransferase 1; epigenetics,	4e-11
3swr_A		1002	DNA (cytosine-5)-methyltransferase 1; epigenetics,	1e-05
3av4_A		1330	DNA (cytosine-5)-methyltransferase 1; CXXC-type zi	1e-09
3av4_A		1330	DNA (cytosine-5)-methyltransferase 1; CXXC-type zi	4e-06

>4dov_A ORC1, origin recognition complex subunit 1; DNA replication, replication; 1.70A {Mus musculus} PDB: 4dow_A* Length = 163	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

 Score = 74.5 bits (182), Expect = 7e-14
 Identities = 80/600 (13%), Positives = 171/600 (28%), Gaps = 177/600 (29%)

Query: 143 ISDFI--FCRTFDVGLRKVLDKIDEKIAGIEVKFIFNRQGYQNSSVALKLDSNKKEVSKN 200
           +S F   F   FD   + V D     ++  E+  I                 +K  VS  
Sbjct: 22  LSVFEDAFVDNFDC--KDVQDMPKSILSKEEIDHIIM---------------SKDAVSGT 64

Query: 201 ATISDETVISAQQNIPESVSTKQEGGFIDTSVKQGVEASLIRQNSS-LLDNVDLESGGKA 259
             +   T++S Q+ +                V++ VE  L R N   L+  +  E     
Sbjct: 65  LRLFW-TLLSKQEEM----------------VQKFVEEVL-RINYKFLMSPIKTEQ---- 102

Query: 260 KSGEGLEDISINSSNLRSKVKENEHTKVLTTKQKSSFAERPVS-------------SVDS 306
                         ++ +++   +  ++    Q   FA+  VS              +  
Sbjct: 103 -----------RQPSMMTRMYIEQRDRLYNDNQV--FAKYNVSRLQPYLKLRQALLELRP 149

Query: 307 KAWLV--GM----KSSLGEKVSSIGGAQQGEIVRTIKPGITFGDKI--ASSSKVGFEKSK 358
              ++  G+    K+ +             ++  + K       KI   +       ++ 
Sbjct: 150 AKNVLIDGVLGSGKTWVA-----------LDVCLSYKVQCKMDFKIFWLNLKNCNSPETV 198

Query: 359 AKSSKALETKEEVKSFKDPNELYNGPSNKAKFDSSRKVFDDKIKNRVQK---LGLDSNVH 415
            +  + L  + +       +   N         S +      +K++  +   L L  NV 
Sbjct: 199 LEMLQKLLYQIDPNWTSRSDHSSNIKLR---IHSIQAELRRLLKSKPYENCLLVLL-NVQ 254

Query: 416 GPK---------PTLAT-----IADEDKSKTKRAVAKDPHGIDKGPCKKPKLDEELLKPT 461
             K           L T     + D   + T   ++ D H          ++   LLK  
Sbjct: 255 NAKAWNAFNLSCKILLTTRFKQVTDFLSAATTTHISLDHH---SMTLTPDEVKSLLLKYL 311

Query: 462 SGKL----VEASSLQPSIVENKSNKQIVEVTRRPSLDRSKWFKELPWEERIRVAHEHGTL 517
             +      E  +  P  +       I E  R   L     +K +  ++   +       
Sbjct: 312 DCRPQDLPREVLTTNPRRL-----SIIAESIRDG-LATWDNWKHVNCDKLTTIIE----- 360

Query: 518 VVLENLDPSYTSTVVEDLVWHAFKENCSAKMIPRVAFASPYFGQSFVIF---KTREVAEL 574
             L  L+P+    + + L    F  +  A  IP              +      +    +
Sbjct: 361 SSLNVLEPAEYRKMFDRLS--VFPPS--AH-IPT---------ILLSLIWFDVIKSDVMV 406

Query: 575 VVTKLEEGCLLLSNGRPLLGSIGTPCFTGKQSKFVGH-LALDKL-----KFQMQREMREA 628
           VV KL +  L+    +    SI                + L+       ++ + R + + 
Sbjct: 407 VVNKLHKYSLVEKQPKESTISI--------------PSIYLELKVKLENEYALHRSIVDH 452

Query: 629 VSTSHCSQPNSL---EYDMAIEW-------SLLQERLDCAWKKLYEQQELELKKLKVKLK 678
            +       + L     D            ++        ++ ++    L+ + L+ K++
Sbjct: 453 YNIPKTFDSDDLIPPYLDQYFYSHIGHHLKNIEHPERMTLFRMVF----LDFRFLEQKIR 508

PyMOL of 1vt4

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

 Score = 42.1 bits (98), Expect = 6e-04
 Identities = 68/487 (13%), Positives = 152/487 (31%), Gaps = 152/487 (31%)

Query: 45  CVYLYKEGDAEPHVGKLIKIWENADKAKKVKLLWFFRPSDISNFLGNVQTLENELILACG 104
              +     +       IK+  ++ +A+  +LL               +  EN L++   
Sbjct: 206 LYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLL-------------KSKPYENCLLV--- 249

Query: 105 EGVGLTNI-NP--LEAIAGKCNVVCTSKDARNPQPSDEELQISDFI-FCRTFDVGLRKVL 160
               L N+ N     A    C ++ T++            Q++DF+    T  + L    
Sbjct: 250 ----LLNVQNAKAWNAFNLSCKILLTTRFK----------QVTDFLSAATTTHISLDHHS 295

Query: 161 DKIDEKIAGIEVKFIFNRQGYQNSSVALKLDSNKKEVSKNATISDETVISAQQNIPESVS 220
             +       EVK +              LD   +++ +    ++   +S    I ES+ 
Sbjct: 296 MTLTPD----EVKSLL----------LKYLDCRPQDLPREVLTTNPRRLSI---IAESIR 338

Query: 221 TKQEGGFIDTS----------VKQGVEASLIRQNSSLLDNVDLESGGKAKSGEGLEDISI 270
                  + T           +   +E+SL     ++L+  +          +  + +S+
Sbjct: 339 -----DGLATWDNWKHVNCDKLTTIIESSL-----NVLEPAEYR--------KMFDRLSV 380

Query: 271 --NSSNLRSKV--------KENEHTKVLTTKQKSSFAERPVSSVDSKAWLVGMKSSLGEK 320
              S+++ + +         +++   V+    K S  E+       K           E 
Sbjct: 381 FPPSAHIPTILLSLIWFDVIKSDVMVVVNKLHKYSLVEK-----QPK-----------ES 424

Query: 321 VSSIGGAQQGEIVRTIKPGITFGDKIASSSKVGFEKS---KAKSSKALETKEEVKSFKDP 377
             SI             P I    K+   ++    +S        K  ++ + +  + D 
Sbjct: 425 TISI-------------PSIYLELKVKLENEYALHRSIVDHYNIPKTFDSDDLIPPYLD- 470

Query: 378 NELYN-------GPSNKAKFDSSRKVF-DDK-IKNRVQKLGLDSNVHGPKPTLATIADED 428
              Y+          +  +    R VF D + ++ +++      N       L T+    
Sbjct: 471 QYFYSHIGHHLKNIEHPERMTLFRMVFLDFRFLEQKIRHDSTAWN--ASGSILNTLQQLK 528

Query: 429 KSKTKRAVAKDPHGIDKGPCKK----------PKLDEELLKPTSGKLVEASSLQP-SIVE 477
             K        P+  D  P  +          PK++E L+      L+  + +     + 
Sbjct: 529 FYK--------PYICDNDPKYERLVNAILDFLPKIEENLICSKYTDLLRIALMAEDEAIF 580

Query: 478 NKSNKQI 484
            +++KQ+
Sbjct: 581 EEAHKQV 587

PyMOL of 1vt4

>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Length = 1002	Back alignment and structure

>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A* Length = 1002	Back alignment and structure

>3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Length = 1330	Back alignment and structure

>3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A* Length = 1330	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		680
1w4s_A		174	Polybromo, polybromo 1 protein; BAH, bromo-associa	99.95
3av4_A		1330	DNA (cytosine-5)-methyltransferase 1; CXXC-type zi	99.88
3swr_A		1002	DNA (cytosine-5)-methyltransferase 1; epigenetics,	99.88
4ft4_B		784	DNA (cytosine-5)-methyltransferase 1; chromodomain	99.86
3swr_A		1002	DNA (cytosine-5)-methyltransferase 1; epigenetics,	99.71
4dov_A		163	ORC1, origin recognition complex subunit 1; DNA re	99.7
3av4_A		1330	DNA (cytosine-5)-methyltransferase 1; CXXC-type zi	99.69
3sde_A		261	Paraspeckle component 1; RRM, anti parallel right	99.36
2fl7_A		232	Regulatory protein SIR3; ORC, silencing, chromatin	98.82
1m4z_A		238	Origin recognition complex subunit 1; DNA replicat	98.78
4fxv_A		99	ELAV-like protein 1; RNA recognition motif, putati	98.39
1x4g_A		109	Nucleolysin TIAR; structural genomics, RRM domain,	98.22
4a8x_A		88	RNA-binding protein with serine-rich domain 1; tra	98.06
2dis_A		109	Unnamed protein product; structural genomics, RRM	98.05
1nu4_A		97	U1A RNA binding domain; RNA recognition motif, U1	98.02
1x5t_A		96	Splicing factor 3B subunit 4; structure genomics,	98.0
2lxi_A		91	RNA-binding protein 10; NMR {Homo sapiens}	97.98
2d9p_A		103	Polyadenylate-binding protein 3; RRM domain, struc	97.96
3ucg_A		89	Polyadenylate-binding protein 2; ferredoxin-like,	97.95
3r27_A		100	HnRNP L, heterogeneous nuclear ribonucleoprotein L	97.95
2dhg_A		104	TRNA selenocysteine associated protein (SECP43); R	97.95
2dnz_A		95	Probable RNA-binding protein 23; RNA recognition m	97.94
2la4_A		101	Nuclear and cytoplasmic polyadenylated RNA-bindin	97.94
2cqi_A		103	Nucleolysin TIAR; RNA recognition motif, RRM, RNA	97.92
2cph_A		107	RNA binding motif protein 19; RNA recognition moti	97.9
2dgx_A		96	KIAA0430 protein; RRM domain, structural genomics,	97.89
2dgo_A		115	Cytotoxic granule-associated RNA binding protein 1	97.86
2ywk_A		95	Putative RNA-binding protein 11; RRM-domain, struc	97.86
2dgp_A		106	Bruno-like 4, RNA binding protein; RRM domain, str	97.85
3ulh_A		107	THO complex subunit 4; nuclear protein, RNA bindin	97.84
2kt5_A		124	RNA and export factor-binding protein 2; chaperone	97.83
2jvr_A		111	Nucleolar protein 3; RNA recognition motif, nucleu	97.83
3ex7_B		126	RNA-binding protein 8A; protein-RNA complex, mRNA	97.83
2do4_A		100	Squamous cell carcinoma antigen recognized by T- c	97.83
1sjq_A		105	Polypyrimidine tract-binding protein 1; babbab mot	97.82
2cq3_A		103	RNA-binding protein 9; RRM domain, structural geno	97.82
1x4h_A		111	RNA-binding protein 28; structural genomics, RRM d	97.8
2cqb_A		102	Peptidyl-prolyl CIS-trans isomerase E; RNA recogni	97.76
1x4a_A		109	Splicing factor, arginine/serine-rich 1 (splicing	97.76
2dgu_A		103	Heterogeneous nuclear ribonucleoprotein Q; RRM dom	97.76
2cpx_A		115	Hypothetical protein FLJ11016; RRM domain, structu	97.75
1x5s_A		102	Cold-inducible RNA-binding protein; structure geno	97.75
2dnp_A		90	RNA-binding protein 14; RRM domain, RBD, structura	97.73
1x4c_A		108	Splicing factor, arginine/serine-rich 1; structura	97.73
2dgv_A		92	HnRNP M, heterogeneous nuclear ribonucleoprotein M	97.73
2cq1_A		101	PTB-like protein L; RRM domain, structural genomic	97.72
2kn4_A		158	Immunoglobulin G-binding protein G, splicing FACT	97.72
3mdf_A		85	Peptidyl-prolyl CIS-trans isomerase E; RRM domain,	97.71
2dgt_A		92	RNA-binding protein 30; RRM domain, structural gen	97.7
2do0_A		114	HnRNP M, heterogeneous nuclear ribonucleoprotein M	97.69
2cpz_A		115	CUG triplet repeat RNA-binding protein 1; RRM doma	97.69
1whw_A		99	Hypothetical protein riken cDNA 1200009A02; RNA re	97.68
2fc9_A		101	NCL protein; structure genomics, RRM_1 domain, str	97.68
2cpf_A		98	RNA binding motif protein 19; RNA recognition moti	97.68
2fy1_A		116	RNA-binding motif protein, Y chromosome, family 1	97.68
1x5o_A		114	RNA binding motif, single-stranded interacting pro	97.68
2e44_A		96	Insulin-like growth factor 2 mRNA binding protein	97.67
1oo0_B		110	CG8781-PA, drosophila Y14; RNA recognition motif,	97.66
1p27_B		106	RNA-binding protein 8A; nuclear protein, mRNA spli	97.66
3p5t_L		90	Cleavage and polyadenylation specificity factor S;	97.66
2cpe_A		113	RNA-binding protein EWS; RNA recognition motif, RR	97.66
1h2v_Z		156	20 kDa nuclear CAP binding protein; CAP-binding-co	97.66
3md1_A		83	Nuclear and cytoplasmic polyadenylated RNA-bindin	97.65
2e5j_A		97	Methenyltetrahydrofolate synthetase domain contain	97.64
2dgw_A		91	Probable RNA-binding protein 19; RRM domain, struc	97.64
2hvz_A		101	Splicing factor, arginine/serine-rich 7; RRM, RNA	97.64
2a3j_A		127	U1 small nuclear ribonucleoprotein A; computationa	97.64
2dnm_A		103	SRP46 splicing factor; RRM domain, RBD, structural	97.64
2cpd_A		99	Apobec-1 stimulating protein; RNA recognition moti	97.64
2cqc_A		95	Arginine/serine-rich splicing factor 10; RNA recog	97.62
2fc8_A		102	NCL protein; structure genomics, RRM_1 domain, str	97.62
2dnh_A		105	Bruno-like 5, RNA binding protein; RRM domain, RBD	97.62
1fje_B		175	Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin	97.6
2ad9_A		119	Polypyrimidine tract-binding protein 1; RBD, RRM,	97.6
2f3j_A		177	RNA and export factor binding protein 2; RRM domai	97.6
2jvo_A		108	Nucleolar protein 3; nucleus, phosphorylation, rib	97.6
1wex_A		104	Hypothetical protein (riken cDNA 2810036L13); stru	97.6
2diu_A		96	KIAA0430 protein; structural genomics, RRM domain,	97.59
1why_A		97	Hypothetical protein riken cDNA 1810017N16; RNA re	97.58
2e5h_A		94	Zinc finger CCHC-type and RNA-binding motif- conta	97.58
2jwn_A		124	Embryonic polyadenylate-binding protein 2-B; epabp	97.58
1p1t_A		104	Cleavage stimulation factor, 64 kDa subunit; RNA r	97.57
3bs9_A		87	Nucleolysin TIA-1 isoform P40; RNA recognition mot	97.56
2cpi_A		111	CCR4-NOT transcription complex subunit 4; RNA reco	97.56
2dnq_A		90	RNA-binding protein 4B; RRM domain,RBD, structural	97.56
3lqv_A		115	PRE-mRNA branch site protein P14; cysless mutant,	97.55
2kxn_B		129	Transformer-2 protein homolog beta; SR protein, RR	97.55
2x1f_A		96	MRNA 3'-END-processing protein RNA15; transcriptio	97.55
2err_A		109	Ataxin-2-binding protein 1; protein-RNA complex, R	97.55
2ki2_A		90	SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA	97.54
1fjc_A		96	Nucleolin RBD2, protein C23; RNP, RRM, RNA binding	97.54
2hzc_A		87	Splicing factor U2AF 65 kDa subunit; RNA splicing,	97.54
1whx_A		111	Hypothetical protein riken cDNA 1200009A02; RNA re	97.54
2dng_A		103	Eukaryotic translation initiation factor 4H; RRM d	97.53
2dgs_A		99	DAZ-associated protein 1; RRM domain, structural g	97.53
1fj7_A		101	Nucleolin RBD1, protein C23; RNP, RRM, RNA binding	97.51
1wi8_A		104	EIF-4B, eukaryotic translation initiation factor 4	97.51
1wf1_A		110	RNA-binding protein RALY; structural genomics, RRM	97.51
2cq0_A		103	Eukaryotic translation initiation factor 3 subunit	97.51
1fje_B		175	Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin	97.5
2qfj_A		216	FBP-interacting repressor; protein-DNA complex; HE	97.5
2i2y_A		150	Fusion protein consists of immunoglobin G- binding	97.49
2mss_A		75	Protein (musashi1); RNA-binding domain, RNA bindin	97.49
1x5u_A		105	Splicing factor 3B subunit 4 (spliceosome associat	97.48
2ytc_A		85	PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s	97.48
2khc_A		118	Testis-specific RNP-type RNA binding protein; RRM,	97.48
2div_A		99	TRNA selenocysteine associated protein; structural	97.47
2lkz_A		95	RNA-binding protein 5; RRM; NMR {Homo sapiens}	97.46
2krb_A		81	Eukaryotic translation initiation factor 3 subunit	97.45
2cpj_A		99	Non-POU domain-containing octamer-binding protein;	97.45
2cqh_A		93	IGF-II mRNA-binding protein 2 isoform A; RNA recog	97.45
2adc_A		229	Polypyrimidine tract-binding protein 1; RBD, RRM,	97.45
2lea_A		135	Serine/arginine-rich splicing factor 2; SR protein	97.43
1x4f_A		112	Matrin 3; structural genomics, RRM domain, NPPSFA,	97.43
2j76_E		100	EIF-4B, EIF4B, eukaryotic translation initiation f	97.42
3md3_A		166	Nuclear and cytoplasmic polyadenylated RNA-bindin	97.42
4f25_A		115	Polyadenylate-binding protein 1; RRM fold, transla	97.42
2cqd_A		116	RNA-binding region containing protein 1; RNA recog	97.42
2jrs_A		108	RNA-binding protein 39; RNA binding motif of RBM39	97.41
1qm9_A		198	Polypyrimidine tract-binding protein; ribonucleopr	97.39
3nmr_A		175	Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl	97.39
1wg1_A		88	KIAA1579 protein, homolog EXC-7; RBD, structural g	97.38
1x5p_A		97	Negative elongation factor E; structure genomics,	97.38
1x4d_A		102	Matrin 3; structural genomics, RRM domain, NPPSFA,	97.37
2pe8_A		105	Splicing factor 45; RRM, protein binding; 2.00A {H	97.36
1u6f_A		139	Tcubp1, RNA-binding protein UBP1; trypanosome, mRN	97.35
1rk8_A		165	CG8781-PA, CG8781-PA protein; mRNA processing, RRM	97.34
2xnq_A		97	Nuclear polyadenylated RNA-binding protein 3; tran	97.33
2ghp_A		292	U4/U6 snRNA-associated splicing factor PRP24; RNA	97.33
2dit_A		112	HIV TAT specific factor 1 variant; structural geno	97.33
2cqp_A		98	RNA-binding protein 12; RNA recognition motif, RRM	97.32
2cq4_A		114	RNA binding motif protein 23; RRM domain, structur	97.3
2ek1_A		95	RNA-binding protein 12; RNA recognition motif, dim	97.29
1fxl_A		167	Paraneoplastic encephalomyelitis antigen HUD; prot	97.28
1uaw_A		77	Mouse-musashi-1; RNP-type structure, RNA binding p	97.27
2ghp_A		292	U4/U6 snRNA-associated splicing factor PRP24; RNA	97.25
3n9u_C		156	Cleavage and polyadenylation specificity factor S;	97.24
2dh8_A		105	DAZ-associated protein 1; RRM domain, structural g	97.24
2g4b_A		172	Splicing factor U2AF 65 kDa subunit; protein-RNA c	97.24
2ku7_A		140	MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio	97.23
2la6_A		99	RNA-binding protein FUS; structural genomics, nort	97.23
2cpy_A		114	RNA-binding protein 12; RRM domain, structural gen	97.23
3s8s_A		110	Histone-lysine N-methyltransferase SETD1A; chromat	97.21
1b7f_A		168	Protein (SXL-lethal protein), RNA (5'-R(PGPUP*UP	97.19
1qm9_A		198	Polypyrimidine tract-binding protein; ribonucleopr	97.18
3tyt_A		205	Heterogeneous nuclear ribonucleoprotein L; ferredo	97.17
2rs2_A		109	Musashi-1, RNA-binding protein musashi homolog 1;	97.17
2nlw_A		105	Eukaryotic translation initiation factor 3 subunit	97.17
2kvi_A		96	Nuclear polyadenylated RNA-binding protein 3; RNA-	97.17
2wbr_A		89	GW182, gawky, LD47780P; DNA-binding protein, RRM,	97.16
3md3_A		166	Nuclear and cytoplasmic polyadenylated RNA-bindin	97.16
3s7r_A		87	Heterogeneous nuclear ribonucleoprotein A/B; ferre	97.1
1wel_A		124	RNA-binding protein 12; structural genomics, NPPSF	97.09
2yh0_A		198	Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli	97.09
2adc_A		229	Polypyrimidine tract-binding protein 1; RBD, RRM,	97.09
2yh0_A		198	Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli	97.08
3beg_B		115	Splicing factor, arginine/serine-rich 1; kinase, S	97.08
3smz_A		284	Protein raver-1, ribonucleoprotein PTB-binding 1;	97.07
3egn_A		143	RNA-binding protein 40; RNA recognition motif (RRM	97.06
1iqt_A		75	AUF1, heterogeneous nuclear ribonucleoprotein D0;	97.06
2cjk_A		167	Nuclear polyadenylated RNA-binding protein 4; HRP1	97.03
1x4b_A		116	Heterogeneous nuclear ribonucleoproteins A2/B1; st	97.02
3smz_A		284	Protein raver-1, ribonucleoprotein PTB-binding 1;	97.01
2qfj_A		216	FBP-interacting repressor; protein-DNA complex; HE	96.99
1x4e_A		85	RNA binding motif, single-stranded interacting pro	96.98
3ns6_A		100	Eukaryotic translation initiation factor 3 subuni;	96.98
2dnn_A		109	RNA-binding protein 12; RRM domain, RBD, structura	96.97
3nmr_A		175	Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl	96.96
4f02_A		213	Polyadenylate-binding protein 1; mRNA, eukaryotic	96.93
3sde_A		261	Paraspeckle component 1; RRM, anti parallel right	96.92
2g4b_A		172	Splicing factor U2AF 65 kDa subunit; protein-RNA c	96.9
2cqg_A		103	TDP-43, TAR DNA-binding protein-43; RNA recognitio	96.9
1s79_A		103	Lupus LA protein; RRM, alpha/beta, RNA binding pro	96.87
3q2s_C		229	Cleavage and polyadenylation specificity factor S;	96.86
3ue2_A		118	Poly(U)-binding-splicing factor PUF60; RNA recogni	96.85
3pgw_A		282	U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c	96.85
3pgw_A		282	U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c	96.83
2lmi_A		107	GRSF-1, G-rich sequence factor 1; G-rich RNA seque	96.79
1b7f_A		168	Protein (SXL-lethal protein), RNA (5'-R(PGPUP*UP	96.78
2bz2_A		121	Negative elongation factor E; NELF E, RNA recognit	96.78
3pgw_S		437	U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM	96.77
1sjr_A		164	Polypyrimidine tract-binding protein 1; extended b	96.73
3v4m_A		105	Splicing factor U2AF 65 kDa subunit; canonical RNA	96.71
2hgl_A		136	HNRPF protein, heterogeneous nuclear ribonucleopro	96.7
1wf0_A		88	TDP-43, TAR DNA-binding protein-43; structural gen	96.64
3tyt_A		205	Heterogeneous nuclear ribonucleoprotein L; ferredo	96.64
1wez_A		102	HnRNP H', FTP-3, heterogeneous nuclear ribonucleop	96.58
2xs2_A		102	Deleted in azoospermia-like; RNA binding protein-R	96.57
2db1_A		118	Heterogeneous nuclear ribonucleoprotein F; RRM dom	96.56
2dnl_A		114	Cytoplasmic polyadenylation element binding protei	96.56
2e5i_A		124	Heterogeneous nuclear ribonucleoprotein L-like; RR	96.56
1l3k_A		196	Heterogeneous nuclear ribonucleoprotein A1; nuclea	96.51
2hgm_A		126	HNRPF protein, heterogeneous nuclear ribonucleopro	96.51
1wg5_A		104	Heterogeneous nuclear ribonucleoprotein H; structu	96.5
2cjk_A		167	Nuclear polyadenylated RNA-binding protein 4; HRP1	96.5
1jmt_A		104	Splicing factor U2AF 35 kDa subunit; RRM, RNA spli	96.46
1l3k_A		196	Heterogeneous nuclear ribonucleoprotein A1; nuclea	96.46
4f02_A		213	Polyadenylate-binding protein 1; mRNA, eukaryotic	96.39
2e5g_A		94	U6 snRNA-specific terminal uridylyltransferase 1;	96.38
2m2b_A		131	RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio	96.33
2hgn_A		139	Heterogeneous nuclear ribonucleoprotein F; RNA rec	96.29
2lcw_A		116	RNA-binding protein FUS; RRM, nucleic acid binding	95.25
2cq2_A		114	Hypothetical protein LOC91801; RRM domain, structu	96.14
1fxl_A		167	Paraneoplastic encephalomyelitis antigen HUD; prot	96.06
3d2w_A		89	TAR DNA-binding protein 43; DP-43 proteinopathy, T	96.01
3s6e_A		114	RNA-binding protein 39; ferredoxin-like, structura	95.97
3u1l_A		240	PRE-mRNA-splicing factor CWC2; CSMP, zinc finger;	95.93
2dha_A		123	FLJ20171 protein; RRM domain, structural genomics,	95.89
2voo_A		193	Lupus LA protein; RNA-binding protein, RNA recogni	95.55
1owx_A		121	Lupus LA protein, SS-B, LA; RRM, transcription; NM	95.25
3zzy_A		130	Polypyrimidine tract-binding protein 1; protein bi	95.11
2d9o_A		100	DNAJ (HSP40) homolog, subfamily C, member 17; RRM	94.43
3dxb_A		222	Thioredoxin N-terminally fused to PUF60(UHM); spli	92.32
3tht_A		345	Alkylated DNA repair protein ALKB homolog 8; struc	90.83
2dnr_A		91	Synaptojanin-1; RRM domain, RBD, structural genomi	86.76
1ufw_A		95	Synaptojanin 2; RNP domain, structural genomics, r	81.05

>3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A*	Back alignment and structure

>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A*	Back alignment and structure

>4ft4_B DNA (cytosine-5)-methyltransferase 1; chromodomain, BAH domain, DNA methyltransferase domain, H3K9 binding, methylation, transferase; HET: DNA MLY SAH; 2.70A {Zea mays} PDB: 4ft2_A* 4fsx_A*	Back alignment and structure

>3swr_A DNA (cytosine-5)-methyltransferase 1; epigenetics, DNA methyltransferase fold, maintenance methyla transferase; HET: DNA SFG MES; 2.49A {Homo sapiens} PDB: 3pta_A* 3pt6_A* 3pt9_A* 4da4_A*	Back alignment and structure

>4dov_A ORC1, origin recognition complex subunit 1; DNA replication, replication; 1.70A {Mus musculus} PDB: 4dow_A*	Back alignment and structure

>3av4_A DNA (cytosine-5)-methyltransferase 1; CXXC-type zinc finger/C5-methyltransferase family; HET: DNA; 2.75A {Mus musculus} PDB: 3av5_A* 3av6_A*	Back alignment and structure

>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B	Back alignment and structure

>2fl7_A Regulatory protein SIR3; ORC, silencing, chromatin, transcription; 1.85A {Saccharomyces cerevisiae} PDB: 2fvu_A 3tu4_K*	Back alignment and structure

>1m4z_A Origin recognition complex subunit 1; DNA replication, transcriptional silencing, chromatin, BAH D gene regulation; 2.20A {Saccharomyces cerevisiae} SCOP: b.34.12.1 PDB: 1zhi_A 1zbx_A	Back alignment and structure

>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens}	Back alignment and structure

>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens}	Back alignment and structure

>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ...	Back alignment and structure

>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2lxi_A RNA-binding protein 10; NMR {Homo sapiens}	Back alignment and structure

>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A	Back alignment and structure

>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens}	Back alignment and structure

>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A	Back alignment and structure

>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens}	Back alignment and structure

>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A	Back alignment and structure

>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A	Back alignment and structure

>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus}	Back alignment and structure

>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A	Back alignment and structure

>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D*	Back alignment and structure

>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A	Back alignment and structure

>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A	Back alignment and structure

>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP}	Back alignment and structure

>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A*	Back alignment and structure

>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A	Back alignment and structure

>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens}	Back alignment and structure

>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D*	Back alignment and structure

>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C	Back alignment and structure

>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X	Back alignment and structure

>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0	Back alignment and structure

>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens}	Back alignment and structure

>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens}	Back alignment and structure

>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A	Back alignment and structure

>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A	Back alignment and structure

>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus}	Back alignment and structure

>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A	Back alignment and structure

>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis}	Back alignment and structure

>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens}	Back alignment and structure

>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B	Back alignment and structure

>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A	Back alignment and structure

>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B	Back alignment and structure

>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori}	Back alignment and structure

>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1	Back alignment and structure

>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A	Back alignment and structure

>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1	Back alignment and structure

>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A	Back alignment and structure

>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A	Back alignment and structure

>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A	Back alignment and structure

>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A	Back alignment and structure

>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A	Back alignment and structure

>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster}	Back alignment and structure

>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens}	Back alignment and structure

>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens}	Back alignment and structure

>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A	Back alignment and structure

>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A	Back alignment and structure

>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens}	Back alignment and structure

>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae}	Back alignment and structure

>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A	Back alignment and structure

>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens}	Back alignment and structure

>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1	Back alignment and structure

>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A	Back alignment and structure

>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A	Back alignment and structure

>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A	Back alignment and structure

>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1	Back alignment and structure

>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A	Back alignment and structure

>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A	Back alignment and structure

>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A	Back alignment and structure

>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A	Back alignment and structure

>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A	Back alignment and structure

>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1	Back alignment and structure

>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A	Back alignment and structure

>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens}	Back alignment and structure

>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A	Back alignment and structure

>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens}	Back alignment and structure

>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens}	Back alignment and structure

>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens}	Back alignment and structure

>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(PGPUPUPGPUPUPUPUPUPUPUPU)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A	Back alignment and structure

>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1	Back alignment and structure

>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A	Back alignment and structure

>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus}	Back alignment and structure

>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens}	Back alignment and structure

>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster}	Back alignment and structure

>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae}	Back alignment and structure

>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A	Back alignment and structure

>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A	Back alignment and structure

>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A	Back alignment and structure

>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A	Back alignment and structure

>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A	Back alignment and structure

>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E	Back alignment and structure

>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens}	Back alignment and structure

>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A	Back alignment and structure

>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C	Back alignment and structure

>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E	Back alignment and structure

>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A	Back alignment and structure

>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A	Back alignment and structure

>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A	Back alignment and structure

>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A*	Back alignment and structure

>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B	Back alignment and structure

>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A	Back alignment and structure

>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C	Back alignment and structure

>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A	Back alignment and structure

>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A	Back alignment and structure

>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A	Back alignment and structure

>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens}	Back alignment and structure

>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(PGPUPUPGPUPUPUPUPUPUPUPU)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A	Back alignment and structure

>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A*	Back alignment and structure

>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A	Back alignment and structure

>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A	Back alignment and structure

>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A	Back alignment and structure

>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A	Back alignment and structure

>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A	Back alignment and structure

>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}	Back alignment and structure

>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A	Back alignment and structure

>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A	Back alignment and structure

>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C	Back alignment and structure

>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3	Back alignment and structure

>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A	Back alignment and structure

>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A*	Back alignment and structure

>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens}	Back alignment and structure

>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A	Back alignment and structure

>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens}	Back alignment and structure

>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A	Back alignment and structure

>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus}	Back alignment and structure

>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A	Back alignment and structure

>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A	Back alignment and structure

>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A	Back alignment and structure

>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A	Back alignment and structure

>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157}	Back alignment and structure

>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A*	Back alignment and structure

>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		680
d1m4za_		217	b.34.12.1 (A:) Origin-recognition complex protein	6e-06

>d1m4za_ b.34.12.1 (A:) Origin-recognition complex protein 120kDa subunit, Orc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 217	Back information, alignment and structure


class: All beta proteins
fold: SH3-like barrel
superfamily: BAH domain
family: BAH domain
domain: Origin-recognition complex protein 120kDa subunit, Orc1p
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 45.7 bits (108), Expect = 6e-06
 Identities = 23/161 (14%), Positives = 39/161 (24%), Gaps = 33/161 (20%)

Query: 16  KKRGIGGKKKDVQFYQSFTYDGVEYTLYDCVYLYKEGDAEPHVGKL-------------- 61
           K+    G K +   Y   + DG++    D V ++ E      V  +              
Sbjct: 31  KRLRRRGAKTEH--YLKRSSDGIKLGRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVEL 88

Query: 62  ---------IKIWENADKAKKVKLLWFFRPSDISNFLGNVQTLENELILACGEGVGLTNI 112
                            +          RP +  N L +    +NEL L           
Sbjct: 89  WALTYLRWFEVNPLAHYRQFNPDANILNRPLNYYNKLFSETANKNELYLT-----AELAE 143

Query: 113 NPLEAIAGKCNVVCTSKDARNPQPSDEELQISDFIFCRTFD 153
             L       NV             + + +  DF      +
Sbjct: 144 LQLFNFIRVANV--MDGSKWEVLKGNVDPE-RDFTVRYICE 181

PyMOL of d1m4za_

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		680
d1m4za_		217	Origin-recognition complex protein 120kDa subunit,	99.66
d2disa1		96	Hypothetical protein FLJ20273 {Human (Homo sapiens	98.26
d1x4ga1		96	Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960	98.07
d1x5sa1		90	Cold-inducible RNA-binding protein {Human (Homo sa	98.05
d1fxla1		82	Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9	98.04
d1x5ta1		83	Splicing factor 3B subunit 4 {Human (Homo sapiens)	98.03
d2adca1		109	Polypyrimidine tract-binding protein {Human (Homo	98.02
d1no8a_		78	Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1	97.96
d2cq1a1		88	Polypyrimidine tract-binding protein 2, PTBP2 {Hum	97.96
d2ghpa1		81	U4/U6 snRNA-associated-splicing factor PRP24 {Bake	97.95
d2cq0a1		90	Eukaryotic translation initiation factor 3 subunit	97.94
d1b7fa1		82	Sex-lethal protein {Drosophila melanogaster [TaxId	97.89
d1rk8a_		88	RNA-binding protein 8 {Fruit fly (Drosophila melan	97.89
d2cpha1		94	Probable RNA-binding protein 19, Rbm19 {Mouse (Mus	97.84
d2cqia1		90	Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960	97.83
d1fxla2		85	Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9	97.83
d2cpea1		101	RNA-binding protein EWS {Human (Homo sapiens) [Tax	97.77
d1b7fa2		85	Sex-lethal protein {Drosophila melanogaster [TaxId	97.77
d2cqha1		80	IGF-II mRNA-binding protein 2 isoform A {Human (Ho	97.77
d1cvja2		89	Poly(A)-binding protein {Human (Homo sapiens) [Tax	97.75
d1whxa_		111	Probable RNA-binding protein 19, Rbm19 {Mouse (Mus	97.75
d2ghpa3		86	U4/U6 snRNA-associated-splicing factor PRP24 {Bake	97.73
d2b0ga1		83	Splicesomal U1A protein {Drosophila melanogaster [	97.73
d3begb1		87	Splicing factor, arginine/serine-rich 1, SFRS1 {Hu	97.72
d2u2fa_		85	Splicing factor U2AF 65 KDa subunit {Human (Homo s	97.71
d1weya_		104	Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090	97.7
d2cpia1		89	E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc	97.69
d2cqpa1		86	RNA-binding protein 12 {Mouse (Mus musculus) [TaxI	97.67
d1fjca_		96	Nucleolin {Golden hamster (Mesocricetus auratus) [	97.67
d1nu4a_		91	Splicesomal U1A protein {Human (Homo sapiens) [Tax	97.66
d1h2vz_		93	CBP20, 20KDa nuclear cap-binding protein {Human (H	97.66
d2cpja1		86	Non-POU domain-containing octamer-binding protein,	97.66
d2cqba1		89	Peptidyl-prolyl cis-trans isomerase E, N-terminal	97.65
d2cpza1		102	CUG triplet repeat RNA-binding protein 1 {Human (H	97.65
d1x4ha1		98	RNA-binding protein 28 {Mouse (Mus musculus) [TaxI	97.61
d1cvja1		80	Poly(A)-binding protein {Human (Homo sapiens) [Tax	97.59
d2adca2		88	Polypyrimidine tract-binding protein {Human (Homo	97.57
d1x4fa1		99	Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}	97.56
d2cpxa1		102	RNA-binding protein 41, RBM41 {Human (Homo sapiens	97.56
d1x4ea1		72	RNA-binding motif, single-stranded-interacting pro	97.56
d1whwa_		99	Probable RNA-binding protein 19, Rbm19 {Mouse (Mus	97.55
d2cq3a1		93	RNA-binding protein 9 {Human (Homo sapiens) [TaxId	97.54
d2cpda1		86	APOBEC1 stimulating protein {Human (Homo sapiens)	97.54
d1wg4a_		98	Splicing factor, arginine/serine-rich 9 (SFRS9) {M	97.53
d1x4da1		89	Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}	97.51
d1x5ua1		93	Splicing factor 3B subunit 4 {Human (Homo sapiens)	97.51
d2cqga1		90	TAR DNA-binding protein 43, TDP-43 {Human (Homo sa	97.51
d2f9da1		114	Pre-mRNA branch site protein p14 {Human (Homo sapi	97.48
d1wexa_		104	Heterogeneous nuclear ribonucleoprotein L-like {Mo	97.47
d2cpfa1		85	Probable RNA-binding protein 19, Rbm19 {Mouse (Mus	97.46
d2dita1		99	HIV Tat-specific factor 1 {Human (Homo sapiens) [T	97.46
d2msta_		75	Neural RNA-binding protein Musashi-1 {Mouse (Mus m	97.45
d2cqda1		103	RNA-binding region containing protein 1 {Human (Ho	97.44
d1x4ba1		103	Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu	97.43
d1wi6a1		75	Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M	97.41
d1whya_		97	Putative RNA-binding protein 15B, Rbm15b {Mouse (M	97.41
d1wi8a_		104	Eukaryotic translation initiation factor 4B {Human	97.4
d2cqca1		83	Arginine/serine-rich splicing factor 10 {Human (Ho	97.39
d2bz2a1		79	Negative elongation factor E, NELF-E {Human (Homo	97.38
d1l3ka2		79	Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human	97.35
d1p1ta_		104	Cleavage stimulation factor, 64 kda subunit {Human	97.34
d1x4aa1		95	Splicing factor, arginine/serine-rich 1, SFRS1 {Hu	97.32
d1wf2a_		98	Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu	97.31
d1wela1		112	RNA-binding protein 12 {Human (Homo sapiens) [TaxI	97.26
d1wg1a_		88	Probable RNA-binding protein KIAA1579 {Human (Homo	97.24
d1x5oa1		101	RNA-binding motif, single-stranded-interacting pro	97.24
d2cpya1		103	RNA-binding protein 12 {Human (Homo sapiens) [TaxI	97.21
d2ghpa2		75	U4/U6 snRNA-associated-splicing factor PRP24 {Bake	97.15
d1fjeb1		91	Nucleolin {Golden hamster (Mesocricetus auratus) [	97.12
d1weza_		102	Heterogeneous nuclear ribonucleoprotein H' {Human	97.11
d1uawa_		77	Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]}	97.05
d1hd0a_		75	Heterogeneous nuclear ribonucleoprotein d0 {Human	97.05
d2cq4a1		101	RNA binding protein 23 {Human (Homo sapiens) [TaxI	96.86
d1u6fa1		139	RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId	96.83
d1wg5a_		104	Heterogeneous nuclear ribonucleoprotein H' {Human	96.82
d1l3ka1		84	Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human	96.78
d1zh5a2		85	Lupus LA protein {Human (Homo sapiens) [TaxId: 960	96.72
d1u1qa_		183	Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human	96.61
d2adba1		108	Polypyrimidine tract-binding protein {Human (Homo	96.53
d1o0pa_		104	Splicing factor U2AF 65 KDa subunit {Human (Homo s	96.45
d1wf0a_		88	TAR DNA-binding protein 43, TDP-43 {Human (Homo sa	96.38
d1u2fa_		90	Splicing factor U2AF 65 KDa subunit {Human (Homo s	96.25
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_		104	U2	95.94
d2cq2a1		101	Alkylation repair AlkB homolog 8, ALKBH8 {Human (H	95.84
d1x0fa1		75	Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s	95.58
d1wwha1		81	Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090	93.21
d1owxa_		113	Lupus LA protein {Human (Homo sapiens) [TaxId: 960	93.1
d1u1qa_		183	Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human	92.96

>d1m4za_ b.34.12.1 (A:) Origin-recognition complex protein 120kDa subunit, Orc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

class: All beta proteins
fold: SH3-like barrel
superfamily: BAH domain
family: BAH domain
domain: Origin-recognition complex protein 120kDa subunit, Orc1p
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.66  E-value=1.7e-18  Score=168.65  Aligned_cols=137  Identities=20%  Similarity=0.067  Sum_probs=96.4

Q ss_pred             cccCCCCCCCcceeEEEEEECCEEEEeCceEEEeeCCCCCCeEEEEEEEEeeCCC-----------------------ce
Q 005739           16 KKRGIGGKKKDVQFYQSFTYDGVEYTLYDCVYLYKEGDAEPHVGKLIKIWENADK-----------------------AK   72 (680)
Q Consensus        16 kkrGvgGKkkd~~fYeSft~dG~tYrLGDCVyVkseg~~ePYIGRIvemWE~~DG-----------------------ek   72 (680)
                      ++|+..+.++. .+|-....||.+|++||+|||++++..+++||+|.+|=.+..+                       ++
T Consensus        30 ~rrrrr~~~~~-~~~~~r~~D~~e~~~GD~Vlvk~~~~~~~~v~iI~ei~~~~~~~~~e~~~~~~lr~~e~~~~~~~~~~  108 (217)
T d1m4za_          30 QKRLRRRGAKT-EHYLKRSSDGIKLGRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLAHYRQF  108 (217)
T ss_dssp             ----------C-EEEEEETTTCCEECTTCEEEEEETTTTEEEEEEEEEEEEETTTTEEEEEEEEEECGGGSCHHHHHHHH
T ss_pred             ccccccCCCCC-cEEEEEecCCeEEecCCEEEEeCCCCCCceEEEEeeeccCcccchheeeeecccchhhhccchhhhhc
Confidence            44544444444 7788888899999999999999988778899999998665433                       35


Q ss_pred             EEEEEeecChhcccccCCCccCCCCceEEecCCCCcccccCccceeecceEEEecCCCcCCCCCCCccCCCCcEEEEeee
Q 005739           73 KVKLLWFFRPSDISNFLGNVQTLENELILACGEGVGLTNINPLEAIAGKCNVVCTSKDARNPQPSDEELQISDFIFCRTF  152 (680)
Q Consensus        73 ~VkVqWFyRPEEI~~~lg~~~~~pNELFLSsgeg~g~~DdNPLe~I~GKC~VVsiskD~rn~rPS~~ei~~aDFYf~R~Y  152 (680)
                      +++++||++|+|...--.+....+|||||+.     +.|++|+++|.|||+|++..+.. .. ++ ......+|||++.|
T Consensus       109 ~~~~~w~~~p~e~~~~k~r~~~~~~ElflT~-----~~d~i~~~~I~~k~~V~s~~ef~-~~-~~-~~~~~~~F~cr~~~  180 (217)
T d1m4za_         109 NPDANILNRPLNYYNKLFSETANKNELYLTA-----ELAELQLFNFIRVANVMDGSKWE-VL-KG-NVDPERDFTVRYIC  180 (217)
T ss_dssp             CHHHHHSCCCHHHHHHHHHHHSCTTEEEEEE-----EEEEECGGGEEEEEEEECHHHHH-HH-GG-GCCTTTEEEEEEEC
T ss_pred             ccceeeecCchhhhhhccccccCcceeEecC-----ccceeehhheeeeEEEecHHHhc-ch-hh-ccCCCCeEEEEEEE
Confidence            5566777777774221112357889999998     58999999999999999754321 11 11 12245689999999


Q ss_pred             eCcceEEEe
Q 005739          153 DVGLRKVLD  161 (680)
Q Consensus       153 Dv~t~RivD  161 (680)
                      |+...+|++
T Consensus       181 D~~~~~f~~  189 (217)
T d1m4za_         181 EPTGEKFVD  189 (217)
T ss_dssp             CTTSCCCEE
T ss_pred             cCCCCceee
Confidence            999999985

PyMOL of d1m4za_

>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]}	Back information, alignment and structure

>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]}	Back information, alignment and structure

>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]}	Back information, alignment and structure

>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]}	Back information, alignment and structure

>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]}	Back information, alignment and structure

>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]}	Back information, alignment and structure

>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure