Citrus Sinensis ID: 005744


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------68
MQSYEYSEDFLDWLLSNEEASHLFEKIVGHSAKKSDFETIGVEIVAKCGGLPIAIKTIANALKNKSPRIWKDAVNQLSNSNPRKIQGMDADLSSIELSYEFLKCKEVKSLFQLCGLLKDGSRIAVDDLLRYVMGLRLLTNADTLEAARNRVHTLIDNLKSASLLFDGDSEDHAKMHRIIHAIAVSIAAEKLLFNIQNVADLKEELDKIDEAPTAISIPFRGIYELPERLGFLKLKLFLFFTENLSLQIPDPFFEGMTELRVLDLTGFRFHSLPSSLGCLINLRTLSLENCLVVDVAIIGDLKKLEILSLKHSSIEQLPREIGQLTCLKLLDLSNCSKLKEIRPNVISNLTRLEELYMGNSFTQWKVEGQSNASLGELKQLSRLTTLEVHIPDAQVMPQDLVFVELERFRICIGDVWSWSDGYETSKTLKLQLNNSTYLGYGMKMLLKRTEDLHLDELAGFKNVVHELDDEEGFARLRHLHVHNGPEILHILNSDGRVGTFPLLESLFLHNLINLEKVCDGKVRLNEDDKSFSNLRIIKVEGCHRVKHLFPFSLVKNLLQLQKVKVTDCTNLKLIVGKESENSAHKNGSISGVYFRKLHFLKLQHLPQLTSSGFDLETPTNTQGSNPGIIAEGDPKDFTSLFNERVVFPSLKKLKLSSINVEKIWLNSFSAIESWVVQKK
ccccccccEEEcccccHHHHHHHHHHHHccccccccHHHHHHHHHcccccHHHHHHHHHHHHccccHHHHHHHHHHHHcccccccccccccHHHHHccccccccHHHHHHHHHHccccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHccccccccccccEEEccHHHHHHHHHHHccEEEEEcccccccccccccccccEEEEccccccccccccccccccEEEEEEccccccccccHHHcccccccEEEccccccccccccccccccccEEEcccccccccccccccccccEEEccccccccccHHHcccccccEEEccccccccccccccccccccccEEEcccccccEEEcccccccHHHccccccccEEEEEccccccccccccHHHcccccEEEccccccccccccccEEEEEEccccccccccccccccccccEEEccccccccccccccccccccccEEEEEcccccEEEccccccccccccccEEEEEccccccEEccccccccccccccccccEEEEEcccccccccccccccccccccEEEEEEcccccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccEEEEcc
cccccccccEEcccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccccHHHEEcHcccccHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHcccccccEEEHHHHHHHHHHHHHccccEEEEEcccccccccccccccEEEEEccccccccccccccccccEEEEEccccccccccHHHHHcccccEEEEEcccccccccccccccccccEEEEcccccccccccccccccEEEEEccccccccccHHcccccccEEEEccccccccccHHHHcccccccEEEEEcccccccccccccccHHHHHHHHHccEEEccccccccccccccHHHHHHcEEcccccccccccccccHHHHHHHHcccccccccccHcccccEEEEccccccccHHcccccccccccccEEEEccccccEEcccccccccccccccEEEEcccHcHHHHcccccccccccccccccEEEEEcccHHHcccccccHHHccccccEEEEcccccHcEcccccccccHHHcccccccccccccEEEccccccHHcccccccccHHcccccccHcccccccccccccccccccccccEEEEcccccHHHccHHccccccEEEEcc
MQSYEYSEDFLDWLLSNEEASHLFEKIVghsakksdfeTIGVEIVAKCGGLPIAIKTIANALKNKSPRIWKDAVNqlsnsnprkiqgmdadLSSIELSYEFLKCKEVKSLFQLCgllkdgsriaVDDLLRYVMGLRLLTNADTLEAARNRVHTLIDNLksasllfdgdsedhaKMHRIIHAIAVSIAAEKLLFNIQNVADLKEELdkideaptaisipfrgiyelperlGFLKLKLFLFFTenlslqipdpffegmtELRVLDltgfrfhslpsslgclinlrtlslenclVVDVAIIGDLKKLEILSLKHSSIEQLPREIGQLTclklldlsncsklkeirpnVISNLTRLEElymgnsftqwkvegqsnaslgelkqlsrlttlevhipdaqvmpqdLVFVELERFRICIgdvwswsdgyetsktLKLQLNNSTYLGYGMKMLLKRTEDLHLDELAGFKNVVHELDDEEGFARLRHLHVHNGPEILHILnsdgrvgtfpLLESLFLHNLInlekvcdgkvrlneddksfsNLRIIKVegchrvkhlfpFSLVKNLLQLqkvkvtdctnlklivgkesensahkngsisgvyFRKLHFlklqhlpqltssgfdletptntqgsnpgiiaegdpkdftslfnervvfpslkklklsSINVEKIWLNSFSAIESWVVQKK
MQSYEYSEDFLDWLLSNEEASHLFEKIVghsakksdFETIGVEIVAKCGGLPIAIKTIANALKNKSPRIWKDAvnqlsnsnprkiqGMDADLSSIELSYEFLKCKEVKSLFQLCGLLKDGSRIAVDDLLRYVMGLRLLTNADTLEAARNRVHTLIDNLKSASLLFDGDSEDHAKMHRIIHAIAVSIAAEKLLFNIQNVADLKEELDKIdeaptaisipfrgIYELPERLGFLKLKLFLFFTENLSLQIPDPFFEGMTELRVLDLTGFRFHSLPSSLGCLINLRTLSLENCLVVDVAIIGDLKKLEILSLKHSSIEQLPREIGQLTCLKLLDLsncsklkeirpnVISNLTRLEELYMGNSFTQWKVEGQSNASLGELKQLSRLTTLEVHIPDAQVMPQDLVFVELERFRICIGDvwswsdgyetsktlklqlNNSTYLGYGMKMLLKRTEDLHLDELAGFKNVVHELDDEEGFARLRHLHVHNGPEILHILNSDGRVGTFPLLESLFLHNLINLEKVCDGKVRLNEDDKSFSNLRIIKVEGCHRVKHLFPFSLVKNLLQLQKVKVTDCTNLKLivgkesensahkngSISGVYFRKLHFLKLQHLPQLTSSGFDLETPTNTQGSNPGIIAEGDPKDFTSLFNERVVFPSLKKLKLSSINVEKIWLNSFSAIESWVVQKK
MQSYEYSEDFLDWLLSNEEASHLFEKIVGHSAKKSDFETIGVEIVAKCGGLPIAIKTIANALKNKSPRIWKDAVNQLSNSNPRKIQGMDADLSSIELSYEFLKCKEVKSLFQLCGLLKDGSRIAVDDLLRYVMGLRLLTNADTLEAARNRVHTLIDNLKSASLLFDGDSEDHAKMHRIIHAIAVSIAAEKLLFNIQNVADLKEELDKIDEAPTAISIPFRGIYELPERLGflklklflffTENLSLQIPDPFFEGMTELRVLDLTGFRFHSLPSSLGCLINLRTLSLENCLVVDVAIIGDLKKLEILSLKHSSIEQLPREIGQLTCLKLLDLSNCSKLKEIRPNVISNLTRLEELYMGNSFTQWKVEGQSNASLGELKQLSRLTTLEVHIPDAQVMPQDLVFVELERFRICIGDVWSWSDGYETSKTLKLQLNNSTYLGYGMKMLLKRTEDLHLDELAGFKNVVHELDDEEGFARLRHLHVHNGPEILHILNSDGRVGTFPLLESLFLHNLINLEKVCDGKVRLNEDDKSFSNLRIIKVEGCHRVKHLFPFSlvknllqlqkvkvTDCTNLKLIVGKESENSAHKNGSISGVYFRKLHFLKLQHLPQLTSSGFDLETPTNTQGSNPGIIAEGDPKDFTSLFNERVVFPSLKKLKLSSINVEKIWLNSFSAIESWVVQKK
*******EDFLDWLLSNEEASHLFEKIVGHSAKKSDFETIGVEIVAKCGGLPIAIKTIANALKNKSPRIWKDAV****************DLSSIELSYEFLKCKEVKSLFQLCGLLKDGSRIAVDDLLRYVMGLRLLTNADTLEAARNRVHTLIDNLKSASLLFDGDSEDHAKMHRIIHAIAVSIAAEKLLFNIQNVADLKEELDKIDEAPTAISIPFRGIYELPERLGFLKLKLFLFFTENLSLQIPDPFFEGMTELRVLDLTGFRFHSLPSSLGCLINLRTLSLENCLVVDVAIIGDLKKLEILSLKHSSIEQLPREIGQLTCLKLLDLSNCSKLKEIRPNVISNLTRLEELYMGNSFTQWKVEGQSNASLGELKQLSRLTTLEVHIPDAQVMPQDLVFVELERFRICIGDVWSWSDGYETSKTLKLQLNNSTYLGYGMKMLLKRTEDLHLDELAGFKNVVHELDDEEGFARLRHLHVHNGPEILHILNSDGRVGTFPLLESLFLHNLINLEKVCDGKVRLNEDDKSFSNLRIIKVEGCHRVKHLFPFSLVKNLLQLQKVKVTDCTNLKLIVGK*********GSISGVYFRKLHFLKLQHLPQLT**************************DFTSLFNERVVFPSLKKLKLSSINVEKIWLNSFSAIESWVV***
******SEDFLDWLLSNEEASHLFEKIVGHSAKKSDFETIGVEIVAKCGGLPIAIKTIANALKNKSPRIWKDAVNQLSN*********DADLSSIELSYEFLKCKEVKSLFQLCGLLKDGSRIAVDDLLRYVMGLRLLTNADTLEAARNRVHTLIDNLKSASLLFDGDSEDHAKMHRIIHAIAVSIAAEKLLFNIQNVADLKEELDKIDEAPTAISIPFRGIYELPERLGFLKLKLFLFFTENLSLQIPDPFFEGMTELRVLDLTGFRFHSLPSSLGCLINLRTLSLENCLVVDVAIIGDLKKLEILSLKHSSIEQLPREIGQLTCLKLLDLSNCSKLKEIRP*VISNLTRLEELYMGNSFTQWKVEGQSNASLGELKQLSRLTTLEVHIPDAQVMPQDLVFVELERFRICIGDVWSW********TLKLQLNNSTYLGYGMKMLLKRTEDLHLDELAGFKNVVHELDDEEGFARLRHLHVHNGPEILHILNSDGRVGTFPLLESLFLHNLINLEKVCDGKVRLNEDDKSFSNLRIIKVEGCHRVKHLFPFSLVKNLLQLQKVKVTDCTNLKLIVG************ISGVYFRKLHFLKLQHLPQLTSSGFDLETPTNT*G***GIIAEGDPKDFTSLFNERVVFPSLKKLKLSSINVEKIWLNSFSAIESWV****
********DFLDWLLSNEEASHLFEKIVGHSAKKSDFETIGVEIVAKCGGLPIAIKTIANALKNKSPRIWKDAVNQLSNSNPRKIQGMDADLSSIELSYEFLKCKEVKSLFQLCGLLKDGSRIAVDDLLRYVMGLRLLTNADTLEAARNRVHTLIDNLKSASLLFDGDSEDHAKMHRIIHAIAVSIAAEKLLFNIQNVADLKEELDKIDEAPTAISIPFRGIYELPERLGFLKLKLFLFFTENLSLQIPDPFFEGMTELRVLDLTGFRFHSLPSSLGCLINLRTLSLENCLVVDVAIIGDLKKLEILSLKHSSIEQLPREIGQLTCLKLLDLSNCSKLKEIRPNVISNLTRLEELYMGNSFTQWKVEGQSNASLGELKQLSRLTTLEVHIPDAQVMPQDLVFVELERFRICIGDVWSWSDGYETSKTLKLQLNNSTYLGYGMKMLLKRTEDLHLDELAGFKNVVHELDDEEGFARLRHLHVHNGPEILHILNSDGRVGTFPLLESLFLHNLINLEKVCDGKVRLNEDDKSFSNLRIIKVEGCHRVKHLFPFSLVKNLLQLQKVKVTDCTNLKLIVGKESENSAHKNGSISGVYFRKLHFLKLQHLPQLTSSGFDLETPTNTQGSNPGIIAEGDPKDFTSLFNERVVFPSLKKLKLSSINVEKIWLNSFSAIESWVVQKK
****EYSEDFLDWLLSNEEASHLFEKIVGHSAKKSDFETIGVEIVAKCGGLPIAIKTIANALKNKSPRIWKDAVNQLSNSNPRKIQGMDADLSSIELSYEFLKCKEVKSLFQLCGLLKDGSRIAVDDLLRYVMGLRLLTNADTLEAARNRVHTLIDNLKSASLLFDGDSEDHAKMHRIIHAIAVSIAAEKLLFNIQNVADLKEELDKIDEAPTAISIPFRGIYELPERLGFLKLKLFLFFTENLSLQIPDPFFEGMTELRVLDLTGFRFHSLPSSLGCLINLRTLSLENCLVVDVAIIGDLKKLEILSLKHSSIEQLPREIGQLTCLKLLDLSNCSKLKEIRPNVISNLTRLEELYMGNSFTQWKVEGQSNASLGELKQLSRLTTLEVHIPDAQVMPQDLVFVELERFRICIGDVWSWSDGYETSKTLKLQLNNSTYLGYGMKMLLKRTEDLHLDELAGFKNVVHELDDEEGFARLRHLHVHNGPEILHILNSDGRVGTFPLLESLFLHNLINLEKVCDGKVRLNEDDKSFSNLRIIKVEGCHRVKHLFPFSLVKNLLQLQKVKVTDCTNLKLIVGKESENSAHKNGSISGVYFRKLHFLKLQHLPQLTSSGFDLETPTNTQGSNPGIIAEGDPKDFTSLFNERVVFPSLKKLKLSSINVEKIWLNSFSAIESWVVQ**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQSYEYSEDFLDWLLSNEEASHLFEKIVGHSAKKSDFETIGVEIVAKCGGLPIAIKTIANALKNKSPRIWKDAVNQLSNSNPRKIQGMDADLSSIELSYEFLKCKEVKSLFQLCGLLKDGSRIAVDDLLRYVMGLRLLTNADTLEAARNRVHTLIDNLKSASLLFDGDSEDHAKMHRIIHAIAVSIAAEKLLFNIQNVADLKEELDKIDEAPTAISIPFRGIYELPERLGFLKLKLFLFFTENLSLQIPDPFFEGMTELRVLDLTGFRFHSLPSSLGCLINLRTLSLENCLVVDVAIIGDLKKLEILSLKHSSIEQLPREIGQLTCLKLLDLSNCSKLKEIRPNVISNLTRLEELYMGNSFTQWKVEGQSNASLGELKQLSRLTTLEVHIPDAQVMPQDLVFVELERFRICIGDVWSWSDGYETSKTLKLQLNNSTYLGYGMKMLLKRTEDLHLDELAGFKNVVHELDDEEGFARLRHLHVHNGPEILHILNSDGRVGTFPLLESLFLHNLINLEKVCDGKVRLNEDDKSFSNLRIIKVEGCHRVKHLFPFSLVKNLLQLQKVKVTDCTNLKLIVGKESENSAHKNGSISGVYFRKLHFLKLQHLPQLTSSGFDLETPTNTQGSNPGIIAEGDPKDFTSLFNERVVFPSLKKLKLSSINVEKIWLNSFSAIESWVVQKK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query679 2.2.26 [Sep-21-2011]
O81825919 Probable disease resistan yes no 0.852 0.630 0.285 9e-47
Q9T048985 Disease resistance protei no no 0.840 0.579 0.262 6e-41
Q42484909 Disease resistance protei no no 0.749 0.559 0.263 4e-31
Q9LVT4843 Probable disease resistan no no 0.471 0.379 0.296 9e-22
Q9C8T9898 Putative disease resistan no no 0.536 0.405 0.264 7e-19
Q9FLB4874 Putative disease resistan no no 0.413 0.321 0.285 4e-18
Q7XBQ9970 Disease resistance protei N/A no 0.756 0.529 0.246 3e-17
Q9SI85893 Probable disease resistan no no 0.764 0.581 0.233 1e-15
Q7XA42979 Putative disease resistan N/A no 0.452 0.313 0.281 4e-15
Q8RXS5888 Probable disease resistan no no 0.458 0.350 0.280 6e-15
>sp|O81825|DRL28_ARATH Probable disease resistance protein At4g27220 OS=Arabidopsis thaliana GN=At4g27220 PE=2 SV=1 Back     alignment and function desciption
 Score =  189 bits (479), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 176/616 (28%), Positives = 286/616 (46%), Gaps = 37/616 (6%)

Query: 15  LSNEEASHLFEKIVGHSAKKSDFETIGVEIVAKCGGLPIAIKTIANALKNKSP-RIWKDA 73
           L  +EA  LF   VG  A   + + I  ++  +C GLP+AI TI   L+ K    +WK  
Sbjct: 272 LQEKEAWELFCHNVGEVANSDNVKPIAKDVSHECCGLPLAIITIGRTLRGKPQVEVWKHT 331

Query: 74  VNQLSNSNPRKIQGMDADLSSIELSYEFLKCKEVKSLFQLCGLLKDGSRIAVDDLLRYVM 133
           +N L  S P  I   +    +++LSY+FL+   +KS F  C L  +   I V +L+ Y +
Sbjct: 332 LNLLKRSAP-SIDTEEKIFGTLKLSYDFLQ-DNMKSCFLFCALFPEDYSIKVSELIMYWV 389

Query: 134 GLRLLTNADTLEAARNRVHTLIDNLKSASLLFDGDSEDHAKMHRIIHAIAVSIAAEK--- 190
              LL      E   N   TL++ LK + LL DGDS D  KMH ++   A+   + +   
Sbjct: 390 AEGLLDGQHHYEDMMNEGVTLVERLKDSCLLEDGDSCDTVKMHDVVRDFAIWFMSSQGEG 449

Query: 191 ---LLFNIQNVADLKEELDKIDEAPTAISIPFRGIYELPERL--GFLKLKLFLFFTENLS 245
              L+   + + +  +  DK   +   +S+    +  LP  +  G   L L L    ++ 
Sbjct: 450 FHSLVMAGRGLIEFPQ--DKFVSSVQRVSLMANKLERLPNNVIEGVETLVLLLQGNSHVK 507

Query: 246 LQIPDPFFEGMTELRVLDLTGFRFHSLPSSLGCLINLRTLSLENC-LVVDVAIIGDLKKL 304
            ++P+ F +    LR+LDL+G R  +LP S   L +LR+L L NC  + ++  +  L KL
Sbjct: 508 -EVPNGFLQAFPNLRILDLSGVRIRTLPDSFSNLHSLRSLVLRNCKKLRNLPSLESLVKL 566

Query: 305 EILSLKHSSIEQLPREIGQLTCLKLLDLSNCSKLKEIRPNVISNLTRLEELYMGNSFTQW 364
           + L L  S+I +LPR +  L+ L+ + +SN  +L+ I    I  L+ LE L M  S   W
Sbjct: 567 QFLDLHESAIRELPRGLEALSSLRYICVSNTYQLQSIPAGTILQLSSLEVLDMAGSAYSW 626

Query: 365 KVEG---QSNASLGELKQLSRLTTLEVHIPDAQVMPQ--DLVFVELERFRICIGDVWSWS 419
            ++G   +  A+L E+  L  L  L + + D        D +   L +F+     + S S
Sbjct: 627 GIKGEEREGQATLDEVTCLPHLQFLAIKLLDVLSFSYEFDSLTKRLTKFQFLFSPIRSVS 686

Query: 420 DGYETSKTLKLQLNNSTYLGYGMKMLLKRTEDLHLDELAG----FKNVVHELDDEEGFAR 475
                   L +   N +    G   LL+    L L+   G    F+N+V +   +  F  
Sbjct: 687 PPGTGEGCLAISDVNVSNASIG--WLLQHVTSLDLNYCEGLNGMFENLVTK--SKSSFVA 742

Query: 476 LRHLHVHNGPEILHILNSDGRVGTFPLLESLFLHNLINLEKVCDGKVRLNEDDKSFSNLR 535
           ++ L +H  P +      + ++  FP LE L L N +NLE + +    L         L+
Sbjct: 743 MKALSIHYFPSLSLASGCESQLDLFPNLEELSLDN-VNLESIGELNGFLG---MRLQKLK 798

Query: 536 IIKVEGCHRVKHLFPFSLVKNLL-QLQKVKVTDCTNLKLIVGKESENSAHKNGSISGVYF 594
           +++V GC ++K LF   ++   L  LQ++KV  C  L+ +    S        S+     
Sbjct: 799 LLQVSGCRQLKRLFSDQILAGTLPNLQEIKVVSCLRLEELFNFSSVPVDFCAESL----L 854

Query: 595 RKLHFLKLQHLPQLTS 610
            KL  +KL++LPQL S
Sbjct: 855 PKLTVIKLKYLPQLRS 870




Probable disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9T048|DRL27_ARATH Disease resistance protein At4g27190 OS=Arabidopsis thaliana GN=At4g27190 PE=2 SV=1 Back     alignment and function description
>sp|Q42484|RPS2_ARATH Disease resistance protein RPS2 OS=Arabidopsis thaliana GN=RPS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LVT4|DRL37_ARATH Probable disease resistance protein At5g47250 OS=Arabidopsis thaliana GN=At5g47250 PE=2 SV=1 Back     alignment and function description
>sp|Q9C8T9|DRL19_ARATH Putative disease resistance protein At1g63350 OS=Arabidopsis thaliana GN=At1g63350 PE=2 SV=1 Back     alignment and function description
>sp|Q9FLB4|DRL31_ARATH Putative disease resistance protein At5g05400 OS=Arabidopsis thaliana GN=At5g05400 PE=2 SV=1 Back     alignment and function description
>sp|Q7XBQ9|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1 Back     alignment and function description
>sp|Q9SI85|DRL14_ARATH Probable disease resistance protein At1g62630 OS=Arabidopsis thaliana GN=At1g62630 PE=3 SV=2 Back     alignment and function description
>sp|Q7XA42|RGA1_SOLBU Putative disease resistance protein RGA1 OS=Solanum bulbocastanum GN=RGA1 PE=2 SV=2 Back     alignment and function description
>sp|Q8RXS5|DRL40_ARATH Probable disease resistance protein At5g63020 OS=Arabidopsis thaliana GN=At5g63020 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query679
255563252 1603 Disease resistance protein RPS5, putativ 0.954 0.404 0.483 1e-149
296087872 1152 unnamed protein product [Vitis vinifera] 0.914 0.539 0.464 1e-148
359488027 1520 PREDICTED: disease resistance protein At 0.904 0.403 0.466 1e-147
224111296 1315 cc-nbs-lrr resistance protein [Populus t 0.951 0.491 0.460 1e-147
224111284 1340 cc-nbs-lrr resistance protein [Populus t 0.946 0.479 0.457 1e-138
224143316 1337 cc-nbs-lrr resistance protein [Populus t 0.948 0.481 0.453 1e-136
147865073 1694 hypothetical protein VITISV_021876 [Viti 0.892 0.357 0.458 1e-134
359488095 1347 PREDICTED: probable disease resistance p 0.891 0.449 0.450 1e-132
359488288 1340 PREDICTED: LOW QUALITY PROTEIN: probable 0.893 0.452 0.446 1e-131
224083434 1144 cc-nbs-lrr resistance protein [Populus t 0.957 0.568 0.420 1e-130
>gi|255563252|ref|XP_002522629.1| Disease resistance protein RPS5, putative [Ricinus communis] gi|223538105|gb|EEF39716.1| Disease resistance protein RPS5, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  535 bits (1379), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 327/677 (48%), Positives = 434/677 (64%), Gaps = 29/677 (4%)

Query: 14  LLSNEEASHLFEKIVGHSAKKSDFETIGVEIVAKCGGLPIAIKTIANALKNKSPRIWKDA 73
           +L  EEA  LFE +VG   K  +F++   E+  KC GLP+ I TIA ALKNK   +WKDA
Sbjct: 309 VLQEEEALSLFEMMVG-DVKGGEFQSAASEVTKKCAGLPVLIVTIARALKNKDLYVWKDA 367

Query: 74  VNQLSNSNPRKIQGMDADLSSIELSYEFLKCKEVKSLFQLCGLLKDGSRIAVDDLLRYVM 133
           V QLS  +  +IQ  +   S++ELSY  L   EVKSLF LCGLL   S IA+ DLL Y  
Sbjct: 368 VKQLSRCDNEEIQ--EKVYSALELSYNHLIGAEVKSLFLLCGLLGK-SDIAILDLLMYST 424

Query: 134 GLRLLTNADTLEAARNRVHTLIDNLKSASLLFDGDSEDHAKMHRIIHAIAVSIAAE-KLL 192
           GL L    DTL  ARNRVH LI +LK+A LL D D +   K+H ++  +A+SIA+  + L
Sbjct: 425 GLGLFKGIDTLGDARNRVHKLISDLKAACLLLDSDIKGRVKIHDVVRDVAISIASRMQHL 484

Query: 193 FNIQNVADLKEELDK-IDEAPTAISIPFRGIYELPERLGFLKLKLFLFFTENLSLQIPDP 251
           F ++N A LKE  +K + ++ T IS+P+  I+ LPE L   +L+LFL FT+++SL++PD 
Sbjct: 485 FTVRNGALLKEWPNKDVCKSCTRISLPYNDIHGLPEVLECPELELFLLFTQDISLKVPDL 544

Query: 252 FFEGMTELRVLDLTGFRFHSLPSSLGCLINLRTLSLENCLVVDVAIIGDLKKLEILSLKH 311
            FE    LRVL+ TG  F SLP SLG L NL TL L+ C + DVAIIG+L  L ILS KH
Sbjct: 545 CFELTKNLRVLNFTGMHFSSLPPSLGFLKNLFTLCLDWCALRDVAIIGELTGLTILSFKH 604

Query: 312 SSIEQLPREIGQLTCLKLLDLSNCSKLKEIRPNVISNLTRLEELYMGNSFTQWKVEG--- 368
           S I +LPREI QLT LK LDLS+C KLK I   +IS LT+LEELYM NSF  W V+G   
Sbjct: 605 SDIVELPREIRQLTKLKFLDLSHCLKLKVIPAKIISELTQLEELYMNNSFDLWDVQGINN 664

Query: 369 QSNASLGELKQLSRLTTLEVHIPDAQVMPQDLVFVELERFRICIGDVWSWSDGYETSKTL 428
           Q NASL EL+ L  LTTLE+ + DA+++P+DL F +LERFRI IGDVWS +  Y TS+TL
Sbjct: 665 QRNASLAELECLPYLTTLEICVLDAKILPKDLFFRKLERFRIFIGDVWSGTGDYGTSRTL 724

Query: 429 KLQLNNST-YLGYGMKMLLKRTEDLHLDELAGFKNVVHELDDEEGFARLRHLHVHNGPEI 487
           KL+LN S+ +L +G+ +LL+ TEDL+L E+ G K+V+++LD  +GF +L+HL V N PEI
Sbjct: 725 KLKLNTSSIHLEHGLSILLEVTEDLYLAEVKGIKSVLYDLDS-QGFTQLKHLDVQNDPEI 783

Query: 488 LHILNSDGR--VGTFPLLESLFLHNLINLEKVCDGKVRLNEDDKSFSNLRIIKVEGCHRV 545
            +I++ + R     FP+LESL+L NL++LEK+C GK+       SFS LR + V  C R+
Sbjct: 784 QYIIDPNRRSPCNAFPILESLYLDNLMSLEKICCGKLTTG----SFSKLRSLTVVKCDRL 839

Query: 546 KHLFPFSLVKNLLQLQKVKVTDCTNLKLIVGKESENSAHKNGSISGVYFRKLHFLKLQHL 605
           K+LF FS+++ LLQLQ++KV DC NL+ IV   SE++   +     V   +L  L L+ L
Sbjct: 840 KNLFSFSMMRCLLQLQQMKVVDCANLEEIVACGSEDT---DNDYEAVKLTQLCSLTLKRL 896

Query: 606 PQLTS---------SGFDLETPTNTQGSNPGIIAEGDPKDFTSLFNERVVFPSLKKLKLS 656
           P   S             ++    T      I  +G+  D   LFNE   FP+L+ L+LS
Sbjct: 897 PMFKSFCSKKKVSPISLRVQKQLTTDTGLKEIAPKGELGDPLPLFNEMFCFPNLENLELS 956

Query: 657 SINVEKIWLNSFSAIES 673
           SI  EKI  +  SAI S
Sbjct: 957 SIACEKICDDQLSAISS 973




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|296087872|emb|CBI35155.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488027|ref|XP_002269288.2| PREDICTED: disease resistance protein At4g27190-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224111296|ref|XP_002332952.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834264|gb|EEE72741.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224111284|ref|XP_002332949.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222834261|gb|EEE72738.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224143316|ref|XP_002336027.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222838884|gb|EEE77235.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147865073|emb|CAN83232.1| hypothetical protein VITISV_021876 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488095|ref|XP_002270726.2| PREDICTED: probable disease resistance protein At4g27220-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359488288|ref|XP_003633735.1| PREDICTED: LOW QUALITY PROTEIN: probable disease resistance protein At1g61310-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224083434|ref|XP_002307025.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222856474|gb|EEE94021.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query679
TAIR|locus:2131689919 AT4G27220 [Arabidopsis thalian 0.860 0.635 0.273 7e-48
TAIR|locus:2136447985 AT4G27190 [Arabidopsis thalian 0.855 0.589 0.261 1e-39
TAIR|locus:2005517909 RPS2 "RESISTANT TO P. SYRINGAE 0.539 0.402 0.279 2.7e-20
TAIR|locus:2031366898 AT1G63350 "AT1G63350" [Arabido 0.490 0.370 0.284 5e-20
TAIR|locus:2171579843 AT5G47250 [Arabidopsis thalian 0.468 0.377 0.291 7.8e-20
TAIR|locus:2197739762 AT1G61300 [Arabidopsis thalian 0.742 0.661 0.244 5.8e-18
TAIR|locus:2034770894 SUMM2 "AT1G12280" [Arabidopsis 0.712 0.541 0.250 7.2e-17
TAIR|locus:2166320888 AT5G63020 [Arabidopsis thalian 0.577 0.441 0.259 2.1e-16
TAIR|locus:2036214851 AT1G15890 [Arabidopsis thalian 0.491 0.392 0.262 5e-16
TAIR|locus:2171589948 AT5G47260 [Arabidopsis thalian 0.556 0.398 0.253 4.3e-15
TAIR|locus:2131689 AT4G27220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 490 (177.5 bits), Expect = 7.0e-48, Sum P(2) = 7.0e-48
 Identities = 167/611 (27%), Positives = 271/611 (44%)

Query:    15 LSNEEASHLFEKIVGHSAKKSDFETIGVEIVAKCGGLPIAIKTIANALKNKSP-RIWKDA 73
             L  +EA  LF   VG  A   + + I  ++  +C GLP+AI TI   L+ K    +WK  
Sbjct:   272 LQEKEAWELFCHNVGEVANSDNVKPIAKDVSHECCGLPLAIITIGRTLRGKPQVEVWKHT 331

Query:    74 VNQLSNSNPRKIQGMDADLSSIELSYEFLKCKEVKSLFQLCGLLKDGSRIAVDDLLRYVM 133
             +N L  S P  I   +    +++LSY+FL+   +KS F  C L  +   I V +L+ Y +
Sbjct:   332 LNLLKRSAP-SIDTEEKIFGTLKLSYDFLQ-DNMKSCFLFCALFPEDYSIKVSELIMYWV 389

Query:   134 GLRLLTNADTLEAARNRVHTLIDNLKSASLLFDGDSEDHAKMHRIIHAIAV-SIAAEKLL 192
                LL      E   N   TL++ LK + LL DGDS D  KMH ++   A+  ++++   
Sbjct:   390 AEGLLDGQHHYEDMMNEGVTLVERLKDSCLLEDGDSCDTVKMHDVVRDFAIWFMSSQGEG 449

Query:   193 FNIQNVAD---LKEELDKIDEAPTAISIPFRGIYELPERLGXXXXXXXXXXTENLSL-QI 248
             F+   +A    ++   DK   +   +S+    +  LP  +             N  + ++
Sbjct:   450 FHSLVMAGRGLIEFPQDKFVSSVQRVSLMANKLERLPNNVIEGVETLVLLLQGNSHVKEV 509

Query:   249 PDPFFEGMTELRVLDLTGFRFHSLPSSLGCLINLRTLSLENCLVV-DVAIIGDLKKLEIL 307
             P+ F +    LR+LDL+G R  +LP S   L +LR+L L NC  + ++  +  L KL+ L
Sbjct:   510 PNGFLQAFPNLRILDLSGVRIRTLPDSFSNLHSLRSLVLRNCKKLRNLPSLESLVKLQFL 569

Query:   308 SLKHSSIEQLPREIGQLTCLKLLDLSNCSKLKEIRPNVISNLTRLEELYMGNSFTQWKVE 367
              L  S+I +LPR +  L+ L+ + +SN  +L+ I    I  L+ LE L M  S   W ++
Sbjct:   570 DLHESAIRELPRGLEALSSLRYICVSNTYQLQSIPAGTILQLSSLEVLDMAGSAYSWGIK 629

Query:   368 GQSN---ASLGELKQLSRLTTLEVHIPDAQVMPQ--DLVFVELERFRICIGDVWSWSDGY 422
             G+     A+L E+  L  L  L + + D        D +   L +F+     + S S   
Sbjct:   630 GEEREGQATLDEVTCLPHLQFLAIKLLDVLSFSYEFDSLTKRLTKFQFLFSPIRSVSPPG 689

Query:   423 ETSKTLKLQLNNSTYLGYGMKMLLKRTEDLHLDELAGFKNVVHEL--DDEEGFARLRHLH 480
                  L +   N +    G   LL+    L L+   G   +   L    +  F  ++ L 
Sbjct:   690 TGEGCLAISDVNVSNASIGW--LLQHVTSLDLNYCEGLNGMFENLVTKSKSSFVAMKALS 747

Query:   481 VHNGPEILHILNSDGRVGTFPLLESLFLHNLINLEKVCDGKVRLNEDDKSFSNLRIIKVE 540
             +H  P +      + ++  FP LE L L N +NLE + +    L         L++++V 
Sbjct:   748 IHYFPSLSLASGCESQLDLFPNLEELSLDN-VNLESIGELNGFLG---MRLQKLKLLQVS 803

Query:   541 GCHRVKHLFPFSXXXXXX-XXXXXXXTDCTNLKLIVGKESENSAHKNGSISGVYFRKLHF 599
             GC ++K LF                   C  L+ +    S        S+      KL  
Sbjct:   804 GCRQLKRLFSDQILAGTLPNLQEIKVVSCLRLEELFNFSSVPVDFCAESL----LPKLTV 859

Query:   600 LKLQHLPQLTS 610
             +KL++LPQL S
Sbjct:   860 IKLKYLPQLRS 870


GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2136447 AT4G27190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005517 RPS2 "RESISTANT TO P. SYRINGAE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031366 AT1G63350 "AT1G63350" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171579 AT5G47250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197739 AT1G61300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034770 SUMM2 "AT1G12280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166320 AT5G63020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2036214 AT1G15890 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171589 AT5G47260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query679
pfam00931285 pfam00931, NB-ARC, NB-ARC domain 3e-14
PLN032101153 PLN03210, PLN03210, Resistant to P 3e-06
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-05
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
>gnl|CDD|216202 pfam00931, NB-ARC, NB-ARC domain Back     alignment and domain information
 Score = 73.5 bits (181), Expect = 3e-14
 Identities = 36/129 (27%), Positives = 57/129 (44%), Gaps = 5/129 (3%)

Query: 14  LLSNEEASHLFEKIVGH--SAKKSDFETIGVEIVAKCGGLPIAIKTIANALKNKS-PRIW 70
            L  EE+  LF   V         + E +  EIV KC GLP+A+K +   L  KS  + W
Sbjct: 155 SLEPEESWELFSNKVFEKELPPCPELEEVAKEIVEKCKGLPLALKVLGGLLAFKSTVQEW 214

Query: 71  KDAVNQLSNSNPRKIQGMDADLSSIELSYEFLKCKEVKSLFQLCGLLKDGSRIAVDDLLR 130
           +  + QL+N       G++  LS + LSY+ L    +K  F    L  +   I  + L++
Sbjct: 215 EHVLEQLNNE-LAGRDGLNEVLSILSLSYDNLP-MHLKRCFLYLALFPEDYNIRKEQLIK 272

Query: 131 YVMGLRLLT 139
             +    + 
Sbjct: 273 LWIAEGFVI 281


Length = 285

>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 679
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.97
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.97
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.94
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.94
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.92
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.92
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.91
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.91
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.89
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.87
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 99.81
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.8
KOG0617264 consensus Ras suppressor protein (contains leucine 99.7
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.65
KOG0617264 consensus Ras suppressor protein (contains leucine 99.63
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.6
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.6
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.57
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.56
KOG4237498 consensus Extracellular matrix protein slit, conta 99.55
KOG4237498 consensus Extracellular matrix protein slit, conta 99.51
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.3
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.2
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.2
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.1
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.1
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.07
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.96
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.95
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.91
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.88
KOG4341483 consensus F-box protein containing LRR [General fu 98.79
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.79
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.65
PLN03150623 hypothetical protein; Provisional 98.63
KOG4341483 consensus F-box protein containing LRR [General fu 98.57
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.55
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.52
PLN03150623 hypothetical protein; Provisional 98.45
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.41
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.39
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.35
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.29
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.22
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 98.22
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.22
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.12
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.12
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 98.04
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.96
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.94
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.92
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.76
PRK15386 426 type III secretion protein GogB; Provisional 97.75
PRK15386426 type III secretion protein GogB; Provisional 97.73
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.71
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.69
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.58
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.45
KOG2123388 consensus Uncharacterized conserved protein [Funct 97.12
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.81
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.76
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.73
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.73
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.62
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.31
KOG3864221 consensus Uncharacterized conserved protein [Funct 96.27
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.22
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.14
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.01
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.45
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 95.45
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.42
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.42
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 94.59
KOG0473326 consensus Leucine-rich repeat protein [Function un 92.9
smart0037026 LRR Leucine-rich repeats, outliers. 92.41
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 92.41
KOG0473326 consensus Leucine-rich repeat protein [Function un 91.63
smart0037026 LRR Leucine-rich repeats, outliers. 91.23
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.23
PRK04841903 transcriptional regulator MalT; Provisional 90.28
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 83.25
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 81.97
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 80.1
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 80.01
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=4.6e-60  Score=525.50  Aligned_cols=459  Identities=26%  Similarity=0.348  Sum_probs=345.0

Q ss_pred             CCCCCCceeccCCCHHHHHHHHHHHhCCC--CCCCChHHHHHHHHHHhCCcchHHHHHHHHhcCC-ChHHHHHHHHHhhc
Q 005744            3 SYEYSEDFLDWLLSNEEASHLFEKIVGHS--AKKSDFETIGVEIVAKCGGLPIAIKTIANALKNK-SPRIWKDAVNQLSN   79 (679)
Q Consensus         3 ~~~~~~~~~~~~L~~~~~~~Lf~~~~~~~--~~~~~~~~~~~~i~~~c~GlPLai~~ig~~L~~~-~~~~W~~~~~~l~~   79 (679)
                      +|+++..+++++|+++|||+||+++||..  ..+++++++|+++|++|+|+|||++++|+.|+.| +.++|+++.+.+.+
T Consensus       305 ~m~~~~~~~v~~L~~~eaW~LF~~~v~~~~~~~~~~i~~lak~v~~kC~GLPLAl~viG~~ma~K~t~~eW~~~~~~l~s  384 (889)
T KOG4658|consen  305 AMGVDYPIEVECLTPEEAWDLFQKKVGPNTLGSHPDIEELAKEVAEKCGGLPLALNVLGGLLACKKTVQEWRRALNVLKS  384 (889)
T ss_pred             cccCCccccccccCccccHHHHHHhhccccccccccHHHHHHHHHHHhCChHHHHHHHHHHhcCCCcHHHHHHHHccccc
Confidence            48999999999999999999999999954  3445699999999999999999999999999988 88899999999998


Q ss_pred             cCCCcccccccc-cceeeeccccCChhhHHHHHHhccccCCCCcccHHhHHHHHhhcccccccchHHHHHHHHHHHHHHH
Q 005744           80 SNPRKIQGMDAD-LSSIELSYEFLKCKEVKSLFQLCGLLKDGSRIAVDDLLRYVMGLRLLTNADTLEAARNRVHTLIDNL  158 (679)
Q Consensus        80 ~~~~~~~~~~~~-~~~l~~SY~~L~~~~lk~cfl~~~~fp~~~~~~~~~li~~wiaeg~i~~~~~~~~~~~~~~~l~~~L  158 (679)
                      ....+..++.+. +++|++|||+||.+ +|.||+|||+||+||+|+++++|..|+||||+++.+..+.+++.+++|+.+|
T Consensus       385 ~~~~~~~~~~~~i~~iLklSyd~L~~~-lK~CFLycalFPED~~I~~e~Li~yWiaEGfi~~~~~~~~~~d~G~~~i~~L  463 (889)
T KOG4658|consen  385 SLAADFSGMEESILPILKLSYDNLPEE-LKSCFLYCALFPEDYEIKKEKLIEYWIAEGFIDPLDGGETAEDVGYDYIEEL  463 (889)
T ss_pred             cccCCCCchhhhhHHhhhccHhhhhHH-HHHHHHhhccCCcccccchHHHHHHHHhccCcCccccccchhcchHHHHHHH
Confidence            866666666655 89999999999966 9999999999999999999999999999999998766678899999999999


Q ss_pred             HhccccccCC---CCCceEehhhHHHHHHHHHh-----cccEeEEecccchhhhhh-hhcCCCeEEEccCCCcccCCccc
Q 005744          159 KSASLLFDGD---SEDHAKMHRIIHAIAVSIAA-----EKLLFNIQNVADLKEELD-KIDEAPTAISIPFRGIYELPERL  229 (679)
Q Consensus       159 ~~~~~~~~~~---~~~~~~mhdli~~l~~~~~~-----~e~~~~~~~~~~~~~~~~-~~~~~l~~l~l~~~~~~~l~~~~  229 (679)
                      +++++++..+   +..+|+|||++||+|.++++     +++ ..+..+......|+ ..+..+|++++.++.+..++...
T Consensus       464 V~~~Ll~~~~~~~~~~~~kmHDvvRe~al~ias~~~~~~e~-~iv~~~~~~~~~~~~~~~~~~rr~s~~~~~~~~~~~~~  542 (889)
T KOG4658|consen  464 VRASLLIEERDEGRKETVKMHDVVREMALWIASDFGKQEEN-QIVSDGVGLSEIPQVKSWNSVRRMSLMNNKIEHIAGSS  542 (889)
T ss_pred             HHHHHHhhcccccceeEEEeeHHHHHHHHHHhccccccccc-eEEECCcCccccccccchhheeEEEEeccchhhccCCC
Confidence            9999998765   45789999999999999999     666 33343334444555 55678999999999999999999


Q ss_pred             CCcceeeeeeccCCc-ccCCCchhhcCCCCccEEEeCCCc-CCcCCccccCCcCCCEEEcCCcccCC-cccccCCCCCcE
Q 005744          230 GFLKLKLFLFFTENL-SLQIPDPFFEGMTELRVLDLTGFR-FHSLPSSLGCLINLRTLSLENCLVVD-VAIIGDLKKLEI  306 (679)
Q Consensus       230 ~~~~L~~L~l~~~~~-~~~~~~~~~~~l~~L~~L~l~~~~-l~~lp~~i~~l~~L~~L~L~~~~~~~-~~~i~~L~~L~~  306 (679)
                      .+++|++|.+.+|.. ...++..+|..++.||+||+++|. +.++|++|+.|.|||||+++++.+.. |.++++|+.|.+
T Consensus       543 ~~~~L~tLll~~n~~~l~~is~~ff~~m~~LrVLDLs~~~~l~~LP~~I~~Li~LryL~L~~t~I~~LP~~l~~Lk~L~~  622 (889)
T KOG4658|consen  543 ENPKLRTLLLQRNSDWLLEISGEFFRSLPLLRVLDLSGNSSLSKLPSSIGELVHLRYLDLSDTGISHLPSGLGNLKKLIY  622 (889)
T ss_pred             CCCccceEEEeecchhhhhcCHHHHhhCcceEEEECCCCCccCcCChHHhhhhhhhcccccCCCccccchHHHHHHhhhe
Confidence            999999999999873 457888889999999999999875 78999999999999999999999998 999999999999


Q ss_pred             EEecCC-CCCccchhhhcCCCCCEEcccCCc-cccccCcccccCCCCCcEEEccCCcccceeccCCcCChhhhhcCCCCc
Q 005744          307 LSLKHS-SIEQLPREIGQLTCLKLLDLSNCS-KLKEIRPNVISNLTRLEELYMGNSFTQWKVEGQSNASLGELKQLSRLT  384 (679)
Q Consensus       307 L~l~~~-~l~~lp~~i~~L~~L~~L~l~~~~-~l~~lp~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~l~~l~~L~  384 (679)
                      |++..+ .+..+|..+..|.+||+|.+.... ..+..-...+.++++|+.+.+.....         ..+..+..++.|+
T Consensus       623 Lnl~~~~~l~~~~~i~~~L~~Lr~L~l~~s~~~~~~~~l~el~~Le~L~~ls~~~~s~---------~~~e~l~~~~~L~  693 (889)
T KOG4658|consen  623 LNLEVTGRLESIPGILLELQSLRVLRLPRSALSNDKLLLKELENLEHLENLSITISSV---------LLLEDLLGMTRLR  693 (889)
T ss_pred             eccccccccccccchhhhcccccEEEeeccccccchhhHHhhhcccchhhheeecchh---------HhHhhhhhhHHHH
Confidence            999988 445556556669999999887632 11111111133444444444322211         1223333444443


Q ss_pred             ----eEEeecCCCccCCccc-cccccceeEEEeCCcccCCC-CCCCcceEEecCCCcceechhHHHHhhccccccccccc
Q 005744          385 ----TLEVHIPDAQVMPQDL-VFVELERFRICIGDVWSWSD-GYETSKTLKLQLNNSTYLGYGMKMLLKRTEDLHLDELA  458 (679)
Q Consensus       385 ----~L~l~~~~~~~~~~~~-~~~~L~~L~l~~~~~~~~~~-~~~~l~~L~L~~~~~~~~~~~~~~~l~~L~~L~l~~~~  458 (679)
                          .+.+.++........+ .+.+|+.|.+..+...+... .......               ...++++.++.+.+|.
T Consensus       694 ~~~~~l~~~~~~~~~~~~~~~~l~~L~~L~i~~~~~~e~~~~~~~~~~~---------------~~~f~~l~~~~~~~~~  758 (889)
T KOG4658|consen  694 SLLQSLSIEGCSKRTLISSLGSLGNLEELSILDCGISEIVIEWEESLIV---------------LLCFPNLSKVSILNCH  758 (889)
T ss_pred             HHhHhhhhcccccceeecccccccCcceEEEEcCCCchhhcccccccch---------------hhhHHHHHHHHhhccc
Confidence                2222222323333333 66777777776665442111 0000000               0014566666666666


Q ss_pred             CcccccccccchhhccccceEeeecCCCeeEEE
Q 005744          459 GFKNVVHELDDEEGFARLRHLHVHNGPEILHIL  491 (679)
Q Consensus       459 ~~~~~~~~~~~~~~l~~L~~L~l~~~~~l~~~~  491 (679)
                      ....+.. .   .-.|+|+.|.+..|..++.+.
T Consensus       759 ~~r~l~~-~---~f~~~L~~l~l~~~~~~e~~i  787 (889)
T KOG4658|consen  759 MLRDLTW-L---LFAPHLTSLSLVSCRLLEDII  787 (889)
T ss_pred             cccccch-h---hccCcccEEEEecccccccCC
Confidence            5544332 2   335788888888887666543



>PLN03210 Resistant to P Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query679
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 6e-22
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-16
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-14
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-16
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-15
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-12
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-10
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-09
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 6e-16
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-15
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 7e-13
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-12
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-08
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-14
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-08
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-08
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-06
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-14
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-13
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-12
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-10
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-10
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-10
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-09
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-14
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-13
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-14
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-11
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-10
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-08
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-13
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-13
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-13
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-11
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-11
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-11
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-13
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-13
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-11
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-12
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-10
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 9e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-11
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-10
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-12
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-12
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-11
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-10
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-08
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-12
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-11
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-11
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-10
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-12
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 7e-10
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-09
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-09
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-11
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-11
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-11
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-09
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 9e-09
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-08
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-11
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-05
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 9e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-11
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-11
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-09
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-10
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-09
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-09
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-10
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-09
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-08
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-05
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-05
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-09
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-09
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-07
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-09
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-06
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 9e-06
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-09
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 8e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-09
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-08
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-08
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 8e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-06
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 2e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 2e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 8e-04
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Length = 549 Back     alignment and structure
 Score = 99.3 bits (247), Expect = 6e-22
 Identities = 26/187 (13%), Positives = 54/187 (28%), Gaps = 11/187 (5%)

Query: 15  LSNEEASHLFEKIVGHSAKKSDFETIGVEIVAKCGGLPIAIKTIANALKNKSPRIWKDAV 74
           L  +E     E            E +  + +    G P  +     + + K+        
Sbjct: 293 LEIDECYDFLEAYGMPMPVGEKEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLN 352

Query: 75  NQLSNSNPRKIQGMDAD-----LSSIELSYEFLKCKEVKSLFQLCGLLKDGSRIAVDDLL 129
           N+L +     ++ +          +++   E L   E +S      ++  G  I V    
Sbjct: 353 NKLESRGLVGVECITPYSYKSLAMALQRCVEVLSD-EDRSALAFAVVMPPGVDIPVKLWS 411

Query: 130 RYVMGLRLLTNADTLEAARNRVHTLIDNLKSASLLFDGD--SEDHAKMHRIIHAIAVSIA 187
             +         + L+   + V   +  L     L  G        K+  IIH     + 
Sbjct: 412 CVIPVDICSNEEEQLD---DEVADRLKRLSKRGALLSGKRMPVLTFKIDHIIHMFLKHVV 468

Query: 188 AEKLLFN 194
             + + N
Sbjct: 469 DAQTIAN 475


>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Length = 591 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query679
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.98
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.98
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.98
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.98
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.98
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.98
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.97
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.97
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.97
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.97
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.97
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.96
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.96
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.96
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.96
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.96
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.96
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.96
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.96
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.96
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.95
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.95
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.95
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.95
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.95
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.94
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.94
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.94
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.94
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.94
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.94
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.93
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.93
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.93
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.93
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 99.92
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.92
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.91
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.91
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.89
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.89
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.89
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.88
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.88
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.88
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.87
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.87
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.87
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.86
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.86
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.86
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.86
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.84
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.84
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.84
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.83
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.83
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.83
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.83
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.82
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.82
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.82
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.82
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.8
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.79
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.79
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.79
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.79
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.79
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.78
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.78
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.78
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.77
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.77
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.76
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.76
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.76
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.75
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.75
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.75
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.74
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.73
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.73
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.72
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.71
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 99.71
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.69
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.69
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.68
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.68
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.67
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.66
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.66
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.66
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.66
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.65
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.65
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.65
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.64
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.64
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.64
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.64
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.63
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.61
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.6
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 99.59
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.59
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.59
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.59
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.59
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.59
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.58
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.58
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.57
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.56
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.54
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.54
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.53
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.53
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.51
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.48
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.47
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.45
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.45
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.44
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.44
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.42
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.4
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.38
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.37
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.36
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.35
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.33
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.26
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.25
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.25
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.21
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.16
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.15
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.15
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.94
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.88
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.85
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.84
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.82
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.77
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.66
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.58
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.51
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.31
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.16
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.16
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.04
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.96
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.91
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.8
4gt6_A394 Cell surface protein; leucine rich repeats, putati 97.76
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.33
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 97.25
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.53
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.31
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 94.74
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 94.26
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 92.08
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 91.88
2fna_A357 Conserved hypothetical protein; structural genomic 90.21
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
Probab=100.00  E-value=5.1e-33  Score=310.86  Aligned_cols=357  Identities=16%  Similarity=0.134  Sum_probs=230.8

Q ss_pred             ecccchhhhhhhhcCCCeEEEccCCCcccCCc-cc-CCcceeeeeeccCCcccCCCchhhcCCCCccEEEeCCCcCCcC-
Q 005744          196 QNVADLKEELDKIDEAPTAISIPFRGIYELPE-RL-GFLKLKLFLFFTENLSLQIPDPFFEGMTELRVLDLTGFRFHSL-  272 (679)
Q Consensus       196 ~~~~~~~~~~~~~~~~l~~l~l~~~~~~~l~~-~~-~~~~L~~L~l~~~~~~~~~~~~~~~~l~~L~~L~l~~~~l~~l-  272 (679)
                      ..+..+..+|...+..+++|++++|.+..+++ .+ .+++|++|++++|.+.+..|.. |.++++|++|++++|.++.+ 
T Consensus        19 c~~~~l~~iP~~l~~~l~~L~Ls~n~i~~~~~~~~~~l~~L~~L~Ls~n~i~~~~~~~-~~~l~~L~~L~Ls~n~l~~~~   97 (606)
T 3t6q_A           19 CENLGLNEIPGTLPNSTECLEFSFNVLPTIQNTTFSRLINLTFLDLTRCQIYWIHEDT-FQSQHRLDTLVLTANPLIFMA   97 (606)
T ss_dssp             CTTSCCSSCCTTSCTTCCEEECTTCCCSEECTTTSTTCTTCSEEECTTCCCCEECTTT-TTTCTTCCEEECTTCCCSEEC
T ss_pred             CCCCCcccCcCCCCCcCcEEEccCCccCcCChhHhccCccceEEECCCCccceeChhh-ccCccccCeeeCCCCcccccC
Confidence            34556677777778899999999999988754 44 8999999999999987554554 58999999999999999876 


Q ss_pred             CccccCCcCCCEEEcCCcccCC--cccccCCCCCcEEEecCCCCCccc-hhhhcCCCCCEEcccCCccccccCcccccCC
Q 005744          273 PSSLGCLINLRTLSLENCLVVD--VAIIGDLKKLEILSLKHSSIEQLP-REIGQLTCLKLLDLSNCSKLKEIRPNVISNL  349 (679)
Q Consensus       273 p~~i~~l~~L~~L~L~~~~~~~--~~~i~~L~~L~~L~l~~~~l~~lp-~~i~~L~~L~~L~l~~~~~l~~lp~~~l~~l  349 (679)
                      |..++++++|++|++++|.+..  +..++++++|++|++++|.++.++ ..+..+++|++|++++ +.++.+++..++.+
T Consensus        98 ~~~~~~l~~L~~L~L~~n~i~~l~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~-n~l~~~~~~~~~~l  176 (606)
T 3t6q_A           98 ETALSGPKALKHLFFIQTGISSIDFIPLHNQKTLESLYLGSNHISSIKLPKGFPTEKLKVLDFQN-NAIHYLSKEDMSSL  176 (606)
T ss_dssp             TTTTSSCTTCCEEECTTSCCSCGGGSCCTTCTTCCEEECCSSCCCCCCCCTTCCCTTCCEEECCS-SCCCEECHHHHHTT
T ss_pred             hhhhcccccccEeeccccCcccCCcchhccCCcccEEECCCCcccccCcccccCCcccCEEEccc-CcccccChhhhhhh
Confidence            7789999999999999999988  688999999999999999999763 3355599999999999 67778877768899


Q ss_pred             CCCc--EEEccCCcccceeccCCcC---------------------------------------------ChhhhhcCCC
Q 005744          350 TRLE--ELYMGNSFTQWKVEGQSNA---------------------------------------------SLGELKQLSR  382 (679)
Q Consensus       350 ~~L~--~L~l~~~~~~~~~~~~~~~---------------------------------------------~~~~l~~l~~  382 (679)
                      ++|+  .|++++|.+....++....                                             .+..+..+ +
T Consensus       177 ~~L~~l~L~l~~n~l~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~l~~~~l~~l~~~~~~~~~~~~i~~~~~~~l~~~-~  255 (606)
T 3t6q_A          177 QQATNLSLNLNGNDIAGIEPGAFDSAVFQSLNFGGTQNLLVIFKGLKNSTIQSLWLGTFEDMDDEDISPAVFEGLCEM-S  255 (606)
T ss_dssp             TTCCSEEEECTTCCCCEECTTTTTTCEEEEEECTTCSCHHHHHHHTTTCEEEEEECCCCTTSCCCCCCGGGGGGGGGS-E
T ss_pred             cccceeEEecCCCccCccChhHhhhccccccccCCchhHHHHhhhccccchhheechhhccccccccChhHhchhhcC-c
Confidence            9999  8899888765433221000                                             00011111 4


Q ss_pred             CceEEeecCCCccCCccc--cccccceeEEEeCC---cccCCCCCCCcceEEecCCCcceech-hHHHHhhccccccccc
Q 005744          383 LTTLEVHIPDAQVMPQDL--VFVELERFRICIGD---VWSWSDGYETSKTLKLQLNNSTYLGY-GMKMLLKRTEDLHLDE  456 (679)
Q Consensus       383 L~~L~l~~~~~~~~~~~~--~~~~L~~L~l~~~~---~~~~~~~~~~l~~L~L~~~~~~~~~~-~~~~~l~~L~~L~l~~  456 (679)
                      |+.|++++|.+..++...  .+++|+.|++..+.   .+..+..+++|+.|+++++.....+. .+.. +++|+.|++++
T Consensus       256 L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~lp~~l~~l~~L~~L~l~~n~l~~~~~~~~~~-l~~L~~L~l~~  334 (606)
T 3t6q_A          256 VESINLQKHYFFNISSNTFHCFSGLQELDLTATHLSELPSGLVGLSTLKKLVLSANKFENLCQISASN-FPSLTHLSIKG  334 (606)
T ss_dssp             EEEEECTTCCCSSCCTTTTTTCTTCSEEECTTSCCSCCCSSCCSCTTCCEEECTTCCCSBGGGGCGGG-CTTCSEEECCS
T ss_pred             eeEEEeecCccCccCHHHhccccCCCEEeccCCccCCCChhhcccccCCEEECccCCcCcCchhhhhc-cCcCCEEECCC
Confidence            556666666665555542  55666666665443   22344555666666666665554432 2332 56666666666


Q ss_pred             ccCccccccc-ccchhhccccceEeeecCCCeeEEEeCCCccccccccceeeccccccccccccCcccCCCCccccCCcc
Q 005744          457 LAGFKNVVHE-LDDEEGFARLRHLHVHNGPEILHILNSDGRVGTFPLLESLFLHNLINLEKVCDGKVRLNEDDKSFSNLR  535 (679)
Q Consensus       457 ~~~~~~~~~~-~~~~~~l~~L~~L~l~~~~~l~~~~~~~~~~~~~~~L~~L~l~~c~~L~~~~~~~~~~~~~~~~l~~L~  535 (679)
                      |.....++.. +   ..+++|++|++++|.. ..+.........+++|++|++++ +.+..+....      ...+++|+
T Consensus       335 n~~~~~~~~~~~---~~l~~L~~L~l~~n~l-~~~~~~~~~~~~l~~L~~L~l~~-n~l~~~~~~~------~~~l~~L~  403 (606)
T 3t6q_A          335 NTKRLELGTGCL---ENLENLRELDLSHDDI-ETSDCCNLQLRNLSHLQSLNLSY-NEPLSLKTEA------FKECPQLE  403 (606)
T ss_dssp             CSSCCBCCSSTT---TTCTTCCEEECCSSCC-CEEEESTTTTTTCTTCCEEECCS-CSCEEECTTT------TTTCTTCS
T ss_pred             CCcccccchhhh---hccCcCCEEECCCCcc-ccccCcchhcccCCCCCEEECCC-CcCCcCCHHH------hcCCccCC
Confidence            6544344332 3   5566666666666642 22221122334566666666665 3333332222      22445555


Q ss_pred             EEEEecCCCccccccHHHHHHhhcCcEEEEccc
Q 005744          536 IIKVEGCHRVKHLFPFSLVKNLLQLQKVKVTDC  568 (679)
Q Consensus       536 ~L~l~~c~~L~~l~~~~~~~~l~~L~~L~i~~c  568 (679)
                      .|++++| +++...+...+..+++|++|++++|
T Consensus       404 ~L~l~~n-~l~~~~~~~~~~~l~~L~~L~l~~n  435 (606)
T 3t6q_A          404 LLDLAFT-RLKVKDAQSPFQNLHLLKVLNLSHS  435 (606)
T ss_dssp             EEECTTC-CEECCTTCCTTTTCTTCCEEECTTC
T ss_pred             eEECCCC-cCCCcccchhhhCcccCCEEECCCC
Confidence            5555553 3333322222344555555555554



>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 679
d2a5yb3277 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenor 1e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-09
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-06
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 3e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 5e-04
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 7e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 8e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.002
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: CED-4, NB-ARC domain
species: Caenorhabditis elegans [TaxId: 6239]
 Score = 57.5 bits (138), Expect = 1e-09
 Identities = 12/88 (13%), Positives = 25/88 (28%), Gaps = 6/88 (6%)

Query: 15  LSNEEASHLFEKIVGHSAKKSDFETIGVEIVAKCGGLPIAIKTIANALKNKSPRIWKDAV 74
           L  +E     E            E +  + +    G P  +     + + K+        
Sbjct: 185 LEIDECYDFLEAYGMPMPVGEKEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLN 244

Query: 75  NQLSNSNPRKIQGMDADLSSIELSYEFL 102
           N+L +     ++           SY+ L
Sbjct: 245 NKLESRGLVGVE------CITPYSYKSL 266


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query679
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.87
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.85
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.8
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.78
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.78
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.75
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.75
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.75
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.75
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.74
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.74
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 99.69
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.65
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.64
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.64
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.59
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.54
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.49
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.49
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.49
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.48
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.46
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.45
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.45
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.42
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.39
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.27
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.17
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.15
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.02
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.94
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.9
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.76
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.53
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.85
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.82
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.04
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.0
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.6
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.41
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.87  E-value=8e-21  Score=196.82  Aligned_cols=340  Identities=17%  Similarity=0.197  Sum_probs=159.4

Q ss_pred             CCcceeeeeeccCCcccCCCchhhcCCCCccEEEeCCCcCCcCCccccCCcCCCEEEcCCcccCCcccccCCCCCcEEEe
Q 005744          230 GFLKLKLFLFFTENLSLQIPDPFFEGMTELRVLDLTGFRFHSLPSSLGCLINLRTLSLENCLVVDVAIIGDLKKLEILSL  309 (679)
Q Consensus       230 ~~~~L~~L~l~~~~~~~~~~~~~~~~l~~L~~L~l~~~~l~~lp~~i~~l~~L~~L~L~~~~~~~~~~i~~L~~L~~L~l  309 (679)
                      .+.+|++|+++++.+. .+. + +..+++|++|++++|.++.+|. ++++++|++|++++|.+.....++++++|++|++
T Consensus        42 ~l~~l~~L~l~~~~I~-~l~-g-l~~L~nL~~L~Ls~N~l~~l~~-l~~L~~L~~L~L~~n~i~~i~~l~~l~~L~~L~~  117 (384)
T d2omza2          42 DLDQVTTLQADRLGIK-SID-G-VEYLNNLTQINFSNNQLTDITP-LKNLTKLVDILMNNNQIADITPLANLTNLTGLTL  117 (384)
T ss_dssp             HHTTCCEEECCSSCCC-CCT-T-GGGCTTCCEEECCSSCCCCCGG-GTTCTTCCEEECCSSCCCCCGGGTTCTTCCEEEC
T ss_pred             HhCCCCEEECCCCCCC-Ccc-c-cccCCCCCEEeCcCCcCCCCcc-ccCCcccccccccccccccccccccccccccccc
Confidence            3455666666666554 232 2 3556666666666666666653 6666666666666666655444666666666666


Q ss_pred             cCCCCCccchhhhcCCCCCEEcccCCccccccCcccccCCCCCcEEEccCCcccceeccCCcCChhhhhcCCCCceEEee
Q 005744          310 KHSSIEQLPREIGQLTCLKLLDLSNCSKLKEIRPNVISNLTRLEELYMGNSFTQWKVEGQSNASLGELKQLSRLTTLEVH  389 (679)
Q Consensus       310 ~~~~l~~lp~~i~~L~~L~~L~l~~~~~l~~lp~~~l~~l~~L~~L~l~~~~~~~~~~~~~~~~~~~l~~l~~L~~L~l~  389 (679)
                      +++.++.++. ......+..+.... +.+..+..................            .....+...+........
T Consensus       118 ~~~~~~~~~~-~~~~~~~~~~~~~~-~~l~~~~~~~~~~~~~~~~~~~~~------------~~~~~~~~~~~~~~~~~~  183 (384)
T d2omza2         118 FNNQITDIDP-LKNLTNLNRLELSS-NTISDISALSGLTSLQQLSFGNQV------------TDLKPLANLTTLERLDIS  183 (384)
T ss_dssp             CSSCCCCCGG-GTTCTTCSEEEEEE-EEECCCGGGTTCTTCSEEEEEESC------------CCCGGGTTCTTCCEEECC
T ss_pred             cccccccccc-cccccccccccccc-cccccccccccccccccccccccc------------chhhhhcccccccccccc
Confidence            6665555543 23333444443333 122222111000000000100000            011111122222222222


Q ss_pred             cCCCccCCccccccccceeEEEeCCccc--CCCCCCCcceEEecCCCcceechhHHHHhhcccccccccccCcccccccc
Q 005744          390 IPDAQVMPQDLVFVELERFRICIGDVWS--WSDGYETSKTLKLQLNNSTYLGYGMKMLLKRTEDLHLDELAGFKNVVHEL  467 (679)
Q Consensus       390 ~~~~~~~~~~~~~~~L~~L~l~~~~~~~--~~~~~~~l~~L~L~~~~~~~~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~  467 (679)
                      .+..........+++++.+.+..+....  .....++++.+.++++....++ .+.. +++|+.|++.+|.. ..++. +
T Consensus       184 ~~~~~~~~~~~~l~~~~~l~l~~n~i~~~~~~~~~~~L~~L~l~~n~l~~~~-~l~~-l~~L~~L~l~~n~l-~~~~~-~  259 (384)
T d2omza2         184 SNKVSDISVLAKLTNLESLIATNNQISDITPLGILTNLDELSLNGNQLKDIG-TLAS-LTNLTDLDLANNQI-SNLAP-L  259 (384)
T ss_dssp             SSCCCCCGGGGGCTTCSEEECCSSCCCCCGGGGGCTTCCEEECCSSCCCCCG-GGGG-CTTCSEEECCSSCC-CCCGG-G
T ss_pred             ccccccccccccccccceeeccCCccCCCCcccccCCCCEEECCCCCCCCcc-hhhc-ccccchhccccCcc-CCCCc-c
Confidence            2211111111122333333322221111  1122334444555544433332 2222 46666666666543 23322 2


Q ss_pred             cchhhccccceEeeecCCCeeEEEeCCCccccccccceeeccccccccccccCcccCCCCccccCCccEEEEecCCCccc
Q 005744          468 DDEEGFARLRHLHVHNGPEILHILNSDGRVGTFPLLESLFLHNLINLEKVCDGKVRLNEDDKSFSNLRIIKVEGCHRVKH  547 (679)
Q Consensus       468 ~~~~~l~~L~~L~l~~~~~l~~~~~~~~~~~~~~~L~~L~l~~c~~L~~~~~~~~~~~~~~~~l~~L~~L~l~~c~~L~~  547 (679)
                         ..+++|++|+++++.. ..    ......++.++.+.+.+ +.++.+..        ...+++++.|+++++ ++++
T Consensus       260 ---~~~~~L~~L~l~~~~l-~~----~~~~~~~~~l~~l~~~~-n~l~~~~~--------~~~~~~l~~L~ls~n-~l~~  321 (384)
T d2omza2         260 ---SGLTKLTELKLGANQI-SN----ISPLAGLTALTNLELNE-NQLEDISP--------ISNLKNLTYLTLYFN-NISD  321 (384)
T ss_dssp             ---TTCTTCSEEECCSSCC-CC----CGGGTTCTTCSEEECCS-SCCSCCGG--------GGGCTTCSEEECCSS-CCSC
T ss_pred             ---cccccCCEeeccCccc-CC----CCccccccccccccccc-cccccccc--------cchhcccCeEECCCC-CCCC
Confidence               5566677777766542 11    12234556666666655 33333211        345667777777664 5666


Q ss_pred             cccHHHHHHhhcCcEEEEcccccchhhhccccccccCCCCccccccccccceeeccCCCCccccccCCCCCcccCCCCCc
Q 005744          548 LFPFSLVKNLLQLQKVKVTDCTNLKLIVGKESENSAHKNGSISGVYFRKLHFLKLQHLPQLTSSGFDLETPTNTQGSNPG  627 (679)
Q Consensus       548 l~~~~~~~~l~~L~~L~i~~c~~L~~l~~~~~~~~~~~~~~~~l~~l~~L~~L~l~~cp~L~~l~~~~~~p~l~~~~~l~  627 (679)
                      +++   +..+++|++|++++| .++.++              .+..+++|++|+++++ +++.++.              
T Consensus       322 l~~---l~~l~~L~~L~L~~n-~l~~l~--------------~l~~l~~L~~L~l~~N-~l~~l~~--------------  368 (384)
T d2omza2         322 ISP---VSSLTKLQRLFFANN-KVSDVS--------------SLANLTNINWLSAGHN-QISDLTP--------------  368 (384)
T ss_dssp             CGG---GGGCTTCCEEECCSS-CCCCCG--------------GGGGCTTCCEEECCSS-CCCBCGG--------------
T ss_pred             Ccc---cccCCCCCEEECCCC-CCCCCh--------------hHcCCCCCCEEECCCC-cCCCChh--------------
Confidence            532   456677777777766 455543              2446677777777654 4444321              


Q ss_pred             cccCCCCCCCccCccccccCCCcceeecccc
Q 005744          628 IIAEGDPKDFTSLFNERVVFPSLKKLKLSSI  658 (679)
Q Consensus       628 ~~~~~~~~~l~~~~~~~~~~p~L~~L~l~~~  658 (679)
                                      ...+|+|+.|+|++|
T Consensus       369 ----------------l~~l~~L~~L~L~~N  383 (384)
T d2omza2         369 ----------------LANLTRITQLGLNDQ  383 (384)
T ss_dssp             ----------------GTTCTTCSEEECCCE
T ss_pred             ----------------hccCCCCCEeeCCCC
Confidence                            235689999999876



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure