Citrus Sinensis ID: 005770

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------68
MVSSMFYNSVNLSTAVFSRTHFPVPVYKHSCIEFSRYDHCINYKFRTGTSGQSKNPTQMKAAVAESPTNNSDSENKKLRILVAGGGIGGLVFALAAKRKGFEVLVFEKDMSAIRGEGQYRGPIQIQSNALAALEAIDLDVAEEVMRAGCVTGDRINGLVDGISGSWYIKFDTFTPAAEKGLPVTRVISRMTLQQILAKAVGDEIILNESNVIDFKDHGDKVSVVLENGQCYAGDLLIGADGIWSKVRKNLFGPQEAIYSGYTCYTGIADFVPADIESVGYRVFLGHKQYFVSSDVGAGKMQWYAFHKEPAGGVDGPEGKKERLLKIFEGWCDNVVDLILATDEEAILRRDIYDRTPIFTWGRGRVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSALKSYERARRLRVAVIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNSIGQLVISYDHICISSKLEGRSPCCKLSDKASDNLRTWFRDDDALERAMNGEWFLVPSGSENVVSQPIYLSVSHENEPYLIGSESHEDFSRTSIVIPSAQVSKMHARISYKDGAFYLIDLQSEHGTYVTDNEGRRYRVSSNFPARFRPSDTIEFGSDKKAIFRVKVIGTPPNNNSERKEAGEILQAV
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccHHHHHHHHHHHHccccEEEEccccccccccccccccEEccHHHHHHHHHcccccHHHHHHccccccccEEEEEEcccccEEEEEcccHHHHHHccccEEEEcHHHHHHHHHHHcccccEEccccEEEEEEcccEEEEEEccccEEEccEEEEcccccHHHHcccccccccccccEEEEEEEEcccccccccccEEEEEEccEEEEEEEccccEEEEEEEEEcccccccccccHHHHHHHHHccccHHHHHHHHccccccEEEEEccccccccccccccEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccEEccccccHHHHcccccHHHHHHHHcccEEEEEccccccccccEEEccccccccEEEcccccccccccEEEEEccccccccEEEEEcccEEEEEEcccccccEEEcccccEEccccccccccccccEEEEcccccEEEEEEEEcccccccccccccccccccc
ccccEEEccccccccHcccccccccccccccHHHccccccccccccccccccccEEEEEEEEccccccccccccccccEEEEEcccHHHHHHHHHHHHcccEEEEEEccHHHHcccccccccEEccHHHHHHHHHccccHHHHHHHHcccccccEEEEEccccccEEEccccccHHHHHcccccEEEcHHHHHHHHHHHcccccEEcccEEEEEEEccccEEEEEccccEEEEEEEEEcccHHHHHHHHHcccccccEccEEEEEEEEEccccccccccEEEEEccccEEEEEEccccEEEEEEEEcccccccccccccHHHHHHHHccccHHHHHHHHHccHHHHHHHHHHccccccccccccEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHccccccHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccccccccccccHccccccccccccccccccccccHHHHHHHHcHHHHHHHHcccEEEEEccccccccccEEEEEccccccEEEEccccccccccEEEEccccccHccEEEEEccccEEEEEccccccEEEEcccccEEEccccccEEEccccEEEEccccEEEEEEEEEEccccccHHccccccEEEcc
MVSSMFYNSVNLSTAvfsrthfpvpvykhsciefsrydhcinykfrtgtsgqsknptQMKAAvaesptnnsdsenkKLRILVAGGGIGGLVFALAAKRKGFEVLVFEKDmsairgegqyrgpiqIQSNALAALEAIDLDVAEEVMRAGcvtgdringlvdgisgswyikfdtftpaaekglpvtRVISRMTLQQILAKAVGdeiilnesnvidfkdhgdKVSVVLENgqcyagdlligadgIWSKVrknlfgpqeaiysgytcytgiadfvpadiesvgYRVFLGHKqyfvssdvgagkmQWYAfhkepaggvdgpegkKERLLKIFEGWCDNVVDLILATDEEAILRrdiydrtpiftwgrgrvtllgdsvhamqpnlgqggcmaiEDGYQLAVELEKACkksnesktpIDIVSALKSYERARRLRVAVIHGLARSAAVMASTYKAYLgvglgplsfltkfriphpgrvggrFFIDLAMPLMLSWVLGGNSIGQLVISYDHIcissklegrspccklsdkaSDNLRTWFRDDDALEramngewflvpsgsenvvsqpiylsvshenepyligseshedfsrtsivipsaqvsKMHARISYKDGAFYLIDLqsehgtyvtdnegrryrvssnfparfrpsdtiefgsdkkaIFRVKVigtppnnnserKEAGEILQAV
MVSSMFYNSVNLSTAVFSRTHFPVPVYKHSCIEFSRYDHCINYKFRtgtsgqsknPTQMKAAVaesptnnsdsenKKLRILVAGGGIGGLVFALAAKRKGFEVLVFEKDMSAIRGEGQYRGPIQIQSNALAALEAIDLDVAEEVMRAGCVTGDRINGLVDGISGSWYIKFDTFTPAAEKGLPVTRVISRMTLQQILAKAVGDEIILNESNVIDFKDHGDKVSVVLENGQCYAGDLLIGADGIWSKVRKNLFGPQEAIYSGYTCYTGIADFVPADIESVGYRVFLGHKQYFVSSDVGAGKMQWYAFHKepaggvdgpeGKKERLLKIFEGWCDNVVDLILATdeeailrrdiydrtpiftwGRGRVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKACkksnesktpidiVSALKSYERARRLRVAVIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNSIGQLVISYDHICISSKLEGRSPCCKLSDKASDNLRTWFRDDDALERAMNGEWFLVPSGSENVVSQPIYLSVSHENEPYLIGseshedfsrTSIVIPSAQVSKMHARISYKDGAFYLIDLQSEHGtyvtdnegrryrvssnfparfrpsdtiefgsdkkaifrvkvigtppnnnserkeageilqav
MVSSMFYNSVNLSTAVFSRTHFPVPVYKHSCIEFSRYDHCINYKFRTGTSGQSKNPTQMKAAVAESPTNNSDSENKKlrilvagggigglvfalaaKRKGFEVLVFEKDMSAIRGEGQYRGPIQIQSNALAALEAIDLDVAEEVMRAGCVTGDRINGLVDGISGSWYIKFDTFTPAAEKGLPVTRVISRMTLQQILAKAVGDEIILNESNVIDFKDHGDKVSVVLENGQCYAGDLLIGADGIWSKVRKNLFGPQEAIYSGYTCYTGIADFVPADIESVGYRVFLGHKQYFVSSDVGAGKMQWYAFHKEPAGGVDGPEGKKERLLKIFEGWCDNVVDLILATDEEAILRRDIYDRTPIFTWGRGRVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSALKSYERARRLRVAVIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNSIGQLVISYDHICISSKLEGRSPCCKLSDKASDNLRTWFRDDDALERAMNGEWFLVPSGSENVVSQPIYLSVSHENEPYLIGSESHEDFSRTSIVIPSAQVSKMHARISYKDGAFYLIDLQSEHGTYVTDNEGRRYRVSSNFPARFRPSDTIEFGSDKKAIFRVKVIGTPPNNNSERKEAGEILQAV
*****FYNSVNLSTAVFSRTHFPVPVYKHSCIEFSRYDHCINYKFRT******************************LRILVAGGGIGGLVFALAAKRKGFEVLVFEKDMSAIRGEGQYRGPIQIQSNALAALEAIDLDVAEEVMRAGCVTGDRINGLVDGISGSWYIKFDTFTPAAEKGLPVTRVISRMTLQQILAKAVGDEIILNESNVIDFKDHGDKVSVVLENGQCYAGDLLIGADGIWSKVRKNLFGPQEAIYSGYTCYTGIADFVPADIESVGYRVFLGHKQYFVSSDVGAGKMQWYAFHKEPAGG*******KERLLKIFEGWCDNVVDLILATDEEAILRRDIYDRTPIFTWGRGRVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKACK*******PIDIVSALKSYERARRLRVAVIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNSIGQLVISYDHICISSKLEGRSPCCKLSDKASDNLRTWFRDDDALERAMNGEWFLVPSGSENVVSQPIYLSVSHENEPYLIG******FSRTSIVIPSAQVSKMHARISYKDGAFYLIDLQSEHGTYVTDNEGRRYRVS**F********TIEFGSDKKAIFRVKVI********************
*********VNLSTAVFSRTHFPVPVYKHSCIEFSRYD*******************************************VAGGGIGGLVFALAAKRKGFEVLVFEKDMSAIRGEGQYRGPIQIQSNALAALEAIDLDVAEEVMRAGCVTGDRINGLVDGISGSWYIKFDTFTPAAEKGLPVTRVISRMTLQQILAKAVGDEIILNESNVIDFKDHGDKVSVVLENGQCYAGDLLIGADGIWSKVRKNLFGPQEAIYSGYTCYTGIADFVPADIESVGYRVFLGHKQYFVSSDVGAGKMQWYAFHKEPAGGVDGPEGKKERLLKIFEGWCDNVVDLILATDEEAILRRDIYDRTPIFTWGRGRVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSALKSYERARRLRVAVIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNSIGQLVISYD***************KLSDKASDNLRTWFRDDDALERAMNGEWFLVPSGSENVVSQPIYLSVSHENE*****************VIPSAQVSKMHARISYKDGAFYLIDLQSEHGTYVTDNEGRRYRVSSNFPARFRPSDTIEFGSDKKAIFRVK**********************
MVSSMFYNSVNLSTAVFSRTHFPVPVYKHSCIEFSRYDHCINYKFRTGT************************ENKKLRILVAGGGIGGLVFALAAKRKGFEVLVFEKDMSAIRGEGQYRGPIQIQSNALAALEAIDLDVAEEVMRAGCVTGDRINGLVDGISGSWYIKFDTFTPAAEKGLPVTRVISRMTLQQILAKAVGDEIILNESNVIDFKDHGDKVSVVLENGQCYAGDLLIGADGIWSKVRKNLFGPQEAIYSGYTCYTGIADFVPADIESVGYRVFLGHKQYFVSSDVGAGKMQWYAFHKEPAGGVDGPEGKKERLLKIFEGWCDNVVDLILATDEEAILRRDIYDRTPIFTWGRGRVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSALKSYERARRLRVAVIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNSIGQLVISYDHICISSKLEGRSPCCKLSDKASDNLRTWFRDDDALERAMNGEWFLVPSGSENVVSQPIYLSVSHENEPYLIGSESHEDFSRTSIVIPSAQVSKMHARISYKDGAFYLIDLQSEHGTYVTDNEGRRYRVSSNFPARFRPSDTIEFGSDKKAIFRVKVIGTPPNNNSERKEAGEILQAV
**SSMFYNSVNLSTAVFSRTHFPVPVYKHSCIEFSRYDHCINYKFRTGTSGQSKNPTQMKAAVAES********NKKLRILVAGGGIGGLVFALAAKRKGFEVLVFEKDMSAIRGEGQYRGPIQIQSNALAALEAIDLDVAEEVMRAGCVTGDRINGLVDGISGSWYIKFDTFTPAAEKGLPVTRVISRMTLQQILAKAVGDEIILNESNVIDFKDHGDKVSVVLENGQCYAGDLLIGADGIWSKVRKNLFGPQEAIYSGYTCYTGIADFVPADIESVGYRVFLGHKQYFVSSDVGAGKMQWYAFHKEPAGGVDGPEGKKERLLKIFEGWCDNVVDLILATDEEAILRRDIYDRTPIFTWGRGRVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSALKSYERARRLRVAVIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNSIGQLVISYDHICISSKLEGRSPCCKLSDKASDNLRTWFRDDDALERAMNGEWFLVPSGSENVVSQPIYLSVSHENEPYLIGSESHEDFSRTSIVIPSAQVSKMHARISYKDGAFYLIDLQSEHGTYVTDNEGRRYRVSSNFPARFRPSDTIEFGSDKKAIFRVKVIGTPPNNN*************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVSSMFYNSVNLSTAVFSRTHFPVPVYKHSCIEFSRYDHCINYKFRTGTSGQSKNPTQMKAAVAESPTNNSDSENKKLRILVAGGGIGGLVFALAAKRKGFEVLVFEKDMSAIRGEGQYRGPIQIQSNALAALEAIDLDVAEEVMRAGCVTGDRINGLVDGISGSWYIKFDTFTPAAEKGLPVTRVISRMTLQQILAKAVGDEIILNESNVIDFKDHGDKVSVVLENGQCYAGDLLIGADGIWSKVRKNLFGPQEAIYSGYTCYTGIADFVPADIESVGYRVFLGHKQYFVSSDVGAGKMQWYAFHKEPAGGVDGPEGKKERLLKIFEGWCDNVVDLILATDEEAILRRDIYDRTPIFTWGRGRVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSALKSYERARRLRVAVIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNSIGQLVISYDHICISSKLEGRSPCCKLSDKASDNLRTWFRDDDALERAMNGEWFLVPSGSENVVSQPIYLSVSHENEPYLIGSESHEDFSRTSIVIPSAQVSKMHARISYKDGAFYLIDLQSEHGTYVTDNEGRRYRVSSNFPARFRPSDTIEFGSDKKAIFRVKVIGTPPNNNSERKEAGEILQAV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query678 2.2.26 [Sep-21-2011]
O81360661 Zeaxanthin epoxidase, chl N/A no 0.967 0.992 0.735 0.0
Q40412663 Zeaxanthin epoxidase, chl N/A no 0.963 0.984 0.689 0.0
P93236669 Zeaxanthin epoxidase, chl N/A no 0.969 0.982 0.687 0.0
Q9FGC7667 Zeaxanthin epoxidase, chl yes no 0.969 0.985 0.679 0.0
Q0JCU7659 Zeaxanthin epoxidase, chl yes no 0.861 0.886 0.723 0.0
Q96375660 Zeaxanthin epoxidase, chl N/A no 0.926 0.951 0.668 0.0
Q9F131394 3-hydroxybenzoate 6-hydro N/A no 0.491 0.845 0.312 6e-30
A6T923384 FAD-dependent urate hydro yes no 0.498 0.880 0.293 5e-25
B6D1N4384 FAD-dependent urate hydro yes no 0.498 0.880 0.293 2e-24
Q88FY2382 6-hydroxynicotinate 3-mon yes no 0.474 0.842 0.267 5e-20
>sp|O81360|ABA2_PRUAR Zeaxanthin epoxidase, chloroplastic OS=Prunus armeniaca PE=2 SV=1 Back     alignment and function desciption
 Score = 1016 bits (2628), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/681 (73%), Positives = 573/681 (84%), Gaps = 25/681 (3%)

Query: 1   MVSSMFYNSVNLSTAVFSRTHFPVPVYKHSCIEFSRYDHCINYKFRTGT-SGQSKNPTQM 59
           M S++FYNS+NLS AVFSRTHFP+P+ K   +EFS   H  +Y  R+ T SGQ K  T++
Sbjct: 1   MASTLFYNSMNLSAAVFSRTHFPIPINKDFPLEFSPCIHT-DYHLRSRTRSGQKKCLTEV 59

Query: 60  KAAVA---ESPTNNSDSENKKLRILVAGGGIGGLVFALAAKRKGFEVLVFEKDMSAIRGE 116
           +A VA   E P+  + ++ KKLRILVAGGGIGGLVFALAAK+KGF+V+VFEKD+SA+RGE
Sbjct: 60  RATVASPTEVPSAPASTQPKKLRILVAGGGIGGLVFALAAKKKGFDVVVFEKDLSAVRGE 119

Query: 117 GQYRGPIQIQSNALAALEAIDLDVAEEVMRAGCVTGDRINGLVDGISGSWYIKFDTFTPA 176
           GQYRGPIQIQSNALAALEAID+DVAEEVMR GCVTGDRINGLVDG+SG+WY+KFDTFTPA
Sbjct: 120 GQYRGPIQIQSNALAALEAIDMDVAEEVMRVGCVTGDRINGLVDGVSGTWYVKFDTFTPA 179

Query: 177 AEKGLPVTRVISRMTLQQILAKAVGDEIILNESNVIDFKDHGDKVSVVLENGQCYAGDLL 236
            E+GLPVTRVISR+ LQQILA+AVG+EII+N+SNV++F+D GDKV+V+LENGQ Y GD+L
Sbjct: 180 VERGLPVTRVISRIALQQILARAVGEEIIINDSNVVNFEDLGDKVNVILENGQRYEGDML 239

Query: 237 IGADGIWSKVRKNLFGPQEAIYSGYTCYTGIADFVPADIESVGYRVFLGHKQYFVSSDVG 296
           +GADGIWSKVRKNLFG  EA+YSGYTCYTGIADFVPADI SVGYRVFLGHKQYFVSSDVG
Sbjct: 240 VGADGIWSKVRKNLFGLNEAVYSGYTCYTGIADFVPADINSVGYRVFLGHKQYFVSSDVG 299

Query: 297 AGKMQWYAFHKEPAGGVDGPEGKKERLLKIFEGWCDNVVDLILATDEEAILRRDIYDRTP 356
            GKMQWYAFHKE  GGVD P GKKERLLKIFEGWCDNV+DL+LAT+E+AILRRDIYDRTP
Sbjct: 300 GGKMQWYAFHKESPGGVDSPNGKKERLLKIFEGWCDNVIDLLLATEEDAILRRDIYDRTP 359

Query: 357 IFTWGRGRVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSA 416
           I TWG+G VTLLGDSVHAMQPN+GQGGCMAIEDGYQLA+EL+KA KKS+E+ TP+D+ S+
Sbjct: 360 ILTWGKGHVTLLGDSVHAMQPNMGQGGCMAIEDGYQLALELDKAWKKSSETGTPVDVASS 419

Query: 417 LKSYERARRLRVAVIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFI 476
           L+SYE +RRLRVA+IHG+AR AA+MASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGR FI
Sbjct: 420 LRSYENSRRLRVAIIHGMARMAALMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRVFI 479

Query: 477 DLAMPLMLSWVLGGNSIGQLVISYDHICISSKLEGRSPCCKLSDKASDNLRTWFRDDDAL 536
           D AMPLMLSWVLGGN              SSKLEGRSP C+LSDKASD LR WF DDDAL
Sbjct: 480 DKAMPLMLSWVLGGN--------------SSKLEGRSPSCRLSDKASDQLRNWFEDDDAL 525

Query: 537 ERAMNGEWFLVPSGSENVVSQPIYLSVSHENEPYLIGSESHEDFSRTSIVIPSAQVSKMH 596
           ERA++GEW+L+P G +N  SQ I L+   +N P +IGS  H D S  SI IP  QVS+MH
Sbjct: 526 ERAIDGEWYLIPCGQDNDASQLICLNRDEKN-PCIIGSAPHGDVSGISIAIPKPQVSEMH 584

Query: 597 ARISYKDGAFYLIDLQSEHGTYVTDNEGRRYRVSSNFPARFRPSDTIEFGSDKKAIFRVK 656
           ARISYKDGAFYL DL+SEHGT++ D EG+RYRV  NFPARFRPSD IE GS K A FRVK
Sbjct: 585 ARISYKDGAFYLTDLRSEHGTWIADIEGKRYRVPPNFPARFRPSDAIEIGSQKVA-FRVK 643

Query: 657 VIGTPPNNNSERKEAGEILQA 677
           V+ + P   S  KE   ILQA
Sbjct: 644 VMKSSP--GSVEKEG--ILQA 660
Converts zeaxanthin into antheraxanthin and subsequently violaxanthin. Involved in the epoxidation of zeaxanthin.
Prunus armeniaca (taxid: 36596)
EC: 1EC: .EC: 1EC: 4EC: .EC: 1EC: 3EC: .EC: 9EC: 0
>sp|Q40412|ABA2_NICPL Zeaxanthin epoxidase, chloroplastic OS=Nicotiana plumbaginifolia GN=ABA2 PE=1 SV=1 Back     alignment and function description
>sp|P93236|ABA2_SOLLC Zeaxanthin epoxidase, chloroplastic OS=Solanum lycopersicum PE=2 SV=1 Back     alignment and function description
>sp|Q9FGC7|ZEP_ARATH Zeaxanthin epoxidase, chloroplastic OS=Arabidopsis thaliana GN=ZEP PE=1 SV=1 Back     alignment and function description
>sp|Q0JCU7|ZEP_ORYSJ Zeaxanthin epoxidase, chloroplastic OS=Oryza sativa subsp. japonica GN=ZEP PE=2 SV=1 Back     alignment and function description
>sp|Q96375|ABA2_CAPAN Zeaxanthin epoxidase, chloroplastic OS=Capsicum annuum PE=2 SV=1 Back     alignment and function description
>sp|Q9F131|3HBH1_PSEAC 3-hydroxybenzoate 6-hydroxylase 1 OS=Pseudomonas alcaligenes GN=xlnD PE=1 SV=1 Back     alignment and function description
>sp|A6T923|HPXO_KLEP7 FAD-dependent urate hydroxylase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=hpxO PE=1 SV=1 Back     alignment and function description
>sp|B6D1N4|HPXO_KLEPN FAD-dependent urate hydroxylase OS=Klebsiella pneumoniae GN=hpxO PE=3 SV=1 Back     alignment and function description
>sp|Q88FY2|6HN3M_PSEPK 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas putida (strain KT2440) GN=nicC PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query678
290361322664 zeaxanthin epoxidase [Citrus unshiu] 0.979 1.0 0.976 0.0
17402597664 zeaxanthin epoxidase [Citrus unshiu] 0.979 1.0 0.974 0.0
290361326664 zeaxanthin epoxidase [Citrus sinensis] 0.979 1.0 0.970 0.0
190576749664 zeaxanthin epoxidase [Citrus maxima] 0.979 1.0 0.957 0.0
290361328664 zeaxanthin epoxidase [Citrus sinensis] 0.979 1.0 0.960 0.0
290361324664 zeaxanthin epoxidase [Citrus unshiu] 0.979 1.0 0.960 0.0
255565190665 zeaxanthin epoxidase, putative [Ricinus 0.971 0.990 0.742 0.0
38112202658 zeaxanthin epoxidase [Vitis vinifera] 0.964 0.993 0.744 0.0
225438718658 PREDICTED: zeaxanthin epoxidase, chlorop 0.964 0.993 0.744 0.0
224084342692 predicted protein [Populus trichocarpa] 0.970 0.950 0.709 0.0
>gi|290361322|dbj|BAI79257.1| zeaxanthin epoxidase [Citrus unshiu] Back     alignment and taxonomy information
 Score = 1361 bits (3523), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 662/678 (97%), Positives = 662/678 (97%), Gaps = 14/678 (2%)

Query: 1   MVSSMFYNSVNLSTAVFSRTHFPVPVYKHSCIEFSRYDHCINYKFRTGTSGQSKNPTQMK 60
           MVSSMFYNSVNLSTAVFSRTHFPVPVYKHSCIEFSRYDHCINYKFRTGTSGQSKNPTQMK
Sbjct: 1   MVSSMFYNSVNLSTAVFSRTHFPVPVYKHSCIEFSRYDHCINYKFRTGTSGQSKNPTQMK 60

Query: 61  AAVAESPTNNSDSENKKLRILVAGGGIGGLVFALAAKRKGFEVLVFEKDMSAIRGEGQYR 120
           AAVAESPTNNSDSENKKLRILVAGGGIGGLVFALAAKRKGFEVLVFEKDMSAIRGEGQYR
Sbjct: 61  AAVAESPTNNSDSENKKLRILVAGGGIGGLVFALAAKRKGFEVLVFEKDMSAIRGEGQYR 120

Query: 121 GPIQIQSNALAALEAIDLDVAEEVMRAGCVTGDRINGLVDGISGSWYIKFDTFTPAAEKG 180
           GPIQIQSNALAALEAIDLDVAEEVMRAGCVTGDRINGLVDGISGSWYIKFDTFTPAAEKG
Sbjct: 121 GPIQIQSNALAALEAIDLDVAEEVMRAGCVTGDRINGLVDGISGSWYIKFDTFTPAAEKG 180

Query: 181 LPVTRVISRMTLQQILAKAVGDEIILNESNVIDFKDHGDKVSVVLENGQCYAGDLLIGAD 240
           LPVTRVISRMTLQQILAKAVGDEIILNESNVIDFKDHGDKVSVVLENGQCYAGDLLIGAD
Sbjct: 181 LPVTRVISRMTLQQILAKAVGDEIILNESNVIDFKDHGDKVSVVLENGQCYAGDLLIGAD 240

Query: 241 GIWSKVRKNLFGPQEAIYSGYTCYTGIADFVPADIESVGYRVFLGHKQYFVSSDVGAGKM 300
           GIWSKVRKNLFGPQEAIYSGYTCYTGIADFVPADIESVGYRVFLGHKQYFVSSDVGAGKM
Sbjct: 241 GIWSKVRKNLFGPQEAIYSGYTCYTGIADFVPADIESVGYRVFLGHKQYFVSSDVGAGKM 300

Query: 301 QWYAFHKEPAGGVDGPEGKKERLLKIFEGWCDNVVDLILATDEEAILRRDIYDRTPIFTW 360
           QWYAFHKEPAGGVD PEGKKERLLKIFEGWCDNVVDLILATDEEAILRRDIYDRTPIFTW
Sbjct: 301 QWYAFHKEPAGGVDDPEGKKERLLKIFEGWCDNVVDLILATDEEAILRRDIYDRTPIFTW 360

Query: 361 GRGRVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSALKSY 420
           GRGRVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSALKSY
Sbjct: 361 GRGRVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSALKSY 420

Query: 421 ERARRLRVAVIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFIDLAM 480
           ERARRLRVAVIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFIDLAM
Sbjct: 421 ERARRLRVAVIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRFFIDLAM 480

Query: 481 PLMLSWVLGGNSIGQLVISYDHICISSKLEGRSPCCKLSDKASDNLRTWFRDDDALERAM 540
           PLMLSWVLGGN              SSKLEGRSPCCKLSDKASDNLRTWFRDDDALERAM
Sbjct: 481 PLMLSWVLGGN--------------SSKLEGRSPCCKLSDKASDNLRTWFRDDDALERAM 526

Query: 541 NGEWFLVPSGSENVVSQPIYLSVSHENEPYLIGSESHEDFSRTSIVIPSAQVSKMHARIS 600
           NGEWFLVPSGSENVVSQPIYLSVSHENEPYLIGSESHEDF RTSIVIPSAQVSKMHARIS
Sbjct: 527 NGEWFLVPSGSENVVSQPIYLSVSHENEPYLIGSESHEDFPRTSIVIPSAQVSKMHARIS 586

Query: 601 YKDGAFYLIDLQSEHGTYVTDNEGRRYRVSSNFPARFRPSDTIEFGSDKKAIFRVKVIGT 660
           YKDGAFYLIDLQSEHGTYVTDNEGRRYRVSSNFPARFRPSDTIEFGSDKKAIFRVKVIGT
Sbjct: 587 YKDGAFYLIDLQSEHGTYVTDNEGRRYRVSSNFPARFRPSDTIEFGSDKKAIFRVKVIGT 646

Query: 661 PPNNNSERKEAGEILQAV 678
           PPNNNSERKEAGEILQAV
Sbjct: 647 PPNNNSERKEAGEILQAV 664

Source: Citrus unshiu

Species: Citrus unshiu

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|17402597|dbj|BAB78733.1| zeaxanthin epoxidase [Citrus unshiu] Back     alignment and taxonomy information
>gi|290361326|dbj|BAI79259.1| zeaxanthin epoxidase [Citrus sinensis] Back     alignment and taxonomy information
>gi|190576749|gb|ACE79170.1| zeaxanthin epoxidase [Citrus maxima] Back     alignment and taxonomy information
>gi|290361328|dbj|BAI79260.1| zeaxanthin epoxidase [Citrus sinensis] Back     alignment and taxonomy information
>gi|290361324|dbj|BAI79258.1| zeaxanthin epoxidase [Citrus unshiu] Back     alignment and taxonomy information
>gi|255565190|ref|XP_002523587.1| zeaxanthin epoxidase, putative [Ricinus communis] gi|223537149|gb|EEF38782.1| zeaxanthin epoxidase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|38112202|gb|AAR11195.1| zeaxanthin epoxidase [Vitis vinifera] Back     alignment and taxonomy information
>gi|225438718|ref|XP_002282543.1| PREDICTED: zeaxanthin epoxidase, chloroplastic [Vitis vinifera] gi|296082420|emb|CBI21425.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224084342|ref|XP_002307265.1| predicted protein [Populus trichocarpa] gi|222856714|gb|EEE94261.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query678
UNIPROTKB|Q0JCU7659 ZEP "Zeaxanthin epoxidase, chl 0.722 0.743 0.717 2.9e-240
TAIR|locus:2158083667 ABA1 "ABA DEFICIENT 1" [Arabid 0.967 0.983 0.656 3.7e-238
UNIPROTKB|A6T923384 hpxO "FAD-dependent urate hydr 0.352 0.622 0.318 7.4e-21
UNIPROTKB|B6D1N4384 hpxO "FAD-dependent urate hydr 0.352 0.622 0.318 3.2e-20
TIGR_CMR|SPO_3692395 SPO_3692 "monooxygenase, putat 0.458 0.787 0.282 8e-20
UNIPROTKB|B5B0J6384 hpxO "FAD-dependent urate hydr 0.389 0.687 0.294 1.8e-19
UNIPROTKB|Q88FY2382 nicC "6-hydroxynicotinate 3-mo 0.473 0.840 0.271 3e-18
UNIPROTKB|P86491385 P86491 "6-hydroxynicotinate 3- 0.317 0.558 0.291 1.8e-16
TAIR|locus:2060584427 CTF2B "AT2G29720" [Arabidopsis 0.340 0.540 0.308 4.8e-16
TAIR|locus:2058723439 CTF2A "AT2G35660" [Arabidopsis 0.334 0.517 0.307 4.2e-15
UNIPROTKB|Q0JCU7 ZEP "Zeaxanthin epoxidase, chloroplastic" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
 Score = 1865 (661.6 bits), Expect = 2.9e-240, Sum P(2) = 2.9e-240
 Identities = 364/507 (71%), Positives = 413/507 (81%)

Query:    56 PTQMKAAVAESPTNNSDSEN-KKXXXXXXXXXXXXXXXXXXXKRKGFEVLVFEKDMSAIR 114
             P    A+VA++ +     E  ++                   +RKG+EV VFE+DMSA+R
Sbjct:    55 PADAAASVAQAASPGGGGEGTRRPRVLVAGGGIGGLVLALAARRKGYEVTVFERDMSAVR 114

Query:   115 GEGQYRGPIQIQSNALAALEAIDLDVAEEVMRAGCVTGDRINGLVDGISGSWYIKFDTFT 174
             GEGQYRGPIQIQSNALAALEAID+ VAEEVMR GCVTGDRINGLVDGISGSWYIKFDTFT
Sbjct:   115 GEGQYRGPIQIQSNALAALEAIDMSVAEEVMREGCVTGDRINGLVDGISGSWYIKFDTFT 174

Query:   175 PAAEKGLPVTRVISRMTLQQILAKAVGDEIILNESNVIDFKDHGDKVSVVLENGQCYAGD 234
             PAAE+GLPVTRVISRMTLQQILA+AVGD+ ILN+S+V+DF D G+KV+ +LE+G+ + GD
Sbjct:   175 PAAERGLPVTRVISRMTLQQILARAVGDDAILNDSHVVDFIDDGNKVTAILEDGRKFEGD 234

Query:   235 LLIGADGIWSKVRKNLFGPQEAIYSGYTCYTGIADFVPADIESVGYRVFLGHKQYFVSSD 294
             LL+GADGIWSKVRK LFG  EA YS YTCYTGIADFVP DI++VGYRVFLGHKQYFVSSD
Sbjct:   235 LLVGADGIWSKVRKVLFGQSEATYSEYTCYTGIADFVPPDIDTVGYRVFLGHKQYFVSSD 294

Query:   295 VGAGKMQWYAFHKEPAGGVDGPEGKKERLLKIFEGWCDNVVDLILATDEEAILRRDIYDR 354
             VGAGKMQWYAFHKEPAGG D   GK +RLL+IF GWCDNVVDLI ATDEEAILRRDIYDR
Sbjct:   295 VGAGKMQWYAFHKEPAGGTDPENGKNKRLLEIFNGWCDNVVDLINATDEEAILRRDIYDR 354

Query:   355 TPIFTWGRGRVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIV 414
              P F WG+GRVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEK+ ++S +S TP+DIV
Sbjct:   355 PPTFNWGKGRVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKSWQESAKSGTPMDIV 414

Query:   415 SALKSYERARRLRVAVIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRF 474
             S+L+ YE+ R LRV+VIHGLAR AA+MA+TY+ YLGVGLGPLSFLTK RIPHPGRVGGRF
Sbjct:   415 SSLRRYEKERILRVSVIHGLARMAAIMATTYRPYLGVGLGPLSFLTKLRIPHPGRVGGRF 474

Query:   475 FIDLAMPLMLSWVLGGNSIGQLVISYDHICISSKLEGRSPCCKLSDKASDNLRTWFRDDD 534
             FI   MPLMLSWVLGGNS              +KLEGR   C+LSDKA+D LR WF DDD
Sbjct:   475 FIKYGMPLMLSWVLGGNS--------------TKLEGRPLSCRLSDKANDQLRRWFEDDD 520

Query:   535 ALERAMNGEWFLVPSGSENVVSQPIYL 561
             ALE+AM GEW+L+P+ S +  SQPI L
Sbjct:   521 ALEQAMGGEWYLLPTSSGD--SQPIRL 545
GO:0009414 "response to water deprivation" evidence=IMP
GO:0009688 "abscisic acid biosynthetic process" evidence=IMP
GO:0016123 "xanthophyll biosynthetic process" evidence=IMP
GO:0050891 "multicellular organismal water homeostasis" evidence=IMP
GO:0052662 "zeaxanthin epoxidase activity" evidence=IMP
TAIR|locus:2158083 ABA1 "ABA DEFICIENT 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|A6T923 hpxO "FAD-dependent urate hydroxylase" [Klebsiella pneumoniae subsp. pneumoniae MGH 78578 (taxid:272620)] Back     alignment and assigned GO terms
UNIPROTKB|B6D1N4 hpxO "FAD-dependent urate hydroxylase" [Klebsiella pneumoniae (taxid:573)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_3692 SPO_3692 "monooxygenase, putative" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
UNIPROTKB|B5B0J6 hpxO "FAD-dependent urate hydroxylase" [Klebsiella oxytoca (taxid:571)] Back     alignment and assigned GO terms
UNIPROTKB|Q88FY2 nicC "6-hydroxynicotinate 3-monooxygenase" [Pseudomonas putida KT2440 (taxid:160488)] Back     alignment and assigned GO terms
UNIPROTKB|P86491 P86491 "6-hydroxynicotinate 3-monooxygenase" [Pseudomonas fluorescens (taxid:294)] Back     alignment and assigned GO terms
TAIR|locus:2060584 CTF2B "AT2G29720" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2058723 CTF2A "AT2G35660" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O81360ABA2_PRUAR1, ., 1, 4, ., 1, 3, ., 9, 00.73560.96750.9924N/Ano
Q0JCU7ZEP_ORYSJ1, ., 1, 4, ., 1, 3, ., 9, 00.72300.86130.8861yesno
Q40412ABA2_NICPL1, ., 1, 4, ., 1, 3, ., 9, 00.68970.96310.9849N/Ano
P93236ABA2_SOLLC1, ., 1, 4, ., 1, 3, ., 9, 00.68750.96900.9820N/Ano
Q96375ABA2_CAPAN1, ., 1, 4, ., 1, 3, ., 9, 00.66810.92620.9515N/Ano
Q9FGC7ZEP_ARATH1, ., 1, 4, ., 1, 3, ., 9, 00.67930.96900.9850yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.14.13.24LOW CONFIDENCE prediction!
3rd Layer1.14.130.983
3rd Layer1.14.13.900.979

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query678
PLN02927668 PLN02927, PLN02927, antheraxanthin epoxidase/zeaxa 0.0
PRK08163396 PRK08163, PRK08163, salicylate hydroxylase; Provis 9e-49
COG0654387 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydrox 2e-44
PRK06753373 PRK06753, PRK06753, hypothetical protein; Provisio 1e-43
PRK06847375 PRK06847, PRK06847, hypothetical protein; Provisio 6e-42
PRK07538413 PRK07538, PRK07538, hypothetical protein; Provisio 4e-32
PRK06475400 PRK06475, PRK06475, salicylate hydroxylase; Provis 2e-24
cd00060102 cd00060, FHA, Forkhead associated domain (FHA); fo 1e-17
TIGR03219414 TIGR03219, salicylate_mono, salicylate 1-monooxyge 1e-16
PRK07236386 PRK07236, PRK07236, hypothetical protein; Provisio 1e-16
pfam0049867 pfam00498, FHA, FHA domain 4e-14
PRK07588391 PRK07588, PRK07588, hypothetical protein; Provisio 4e-13
COG0644396 COG0644, FixC, Dehydrogenases (flavoproteins) [Ene 3e-12
pfam01494349 pfam01494, FAD_binding_3, FAD binding domain 9e-10
TIGR01988387 TIGR01988, Ubi-OHases, Ubiquinone biosynthesis hyd 1e-09
smart0024052 smart00240, FHA, Forkhead associated domain 1e-08
COG1716191 COG1716, COG1716, FOG: FHA domain [Signal transduc 2e-08
PRK07045388 PRK07045, PRK07045, putative monooxygenase; Review 2e-07
PRK05868372 PRK05868, PRK05868, hypothetical protein; Validate 6e-07
PRK06126545 PRK06126, PRK06126, hypothetical protein; Provisio 7e-07
PRK07333403 PRK07333, PRK07333, 2-octaprenyl-6-methoxyphenyl h 2e-06
TIGR02032295 TIGR02032, GG-red-SF, geranylgeranyl reductase fam 4e-06
TIGR01984382 TIGR01984, UbiH, 2-polyprenyl-6-methoxyphenol 4-hy 2e-05
pfam1345066 pfam13450, NAD_binding_8, NAD(P)-binding Rossmann- 4e-05
PRK08255 765 PRK08255, PRK08255, salicylyl-CoA 5-hydroxylase; R 5e-05
TIGR03354 396 TIGR03354, VI_FHA, type VI secretion system FHA do 4e-04
COG3456 430 COG3456, COG3456, Predicted component of the type 4e-04
TIGR01988387 TIGR01988, Ubi-OHases, Ubiquinone biosynthesis hyd 6e-04
PRK06183500 PRK06183, mhpA, 3-(3-hydroxyphenyl)propionate hydr 7e-04
TIGR03364365 TIGR03364, HpnW_proposed, FAD dependent oxidoreduc 8e-04
PRK06185407 PRK06185, PRK06185, hypothetical protein; Provisio 0.002
COG1233487 COG1233, COG1233, Phytoene dehydrogenase and relat 0.002
>gnl|CDD|178515 PLN02927, PLN02927, antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information 
 Score =  958 bits (2477), Expect = 0.0
 Identities = 471/685 (68%), Positives = 551/685 (80%), Gaps = 28/685 (4%)

Query: 1   MVSSMFYNSVNLSTAV--FSRTHFPVPVYKHSCIEFSRYDHCINYKFRTGTSG--QSKNP 56
           M S++F  S+N S +   F+RTH   PV K   ++ S +      K   G SG    K  
Sbjct: 1   MGSTLFCYSINPSPSKLDFTRTHVFSPVAKQFYLDLSSFSG----KPGGGLSGFRSRKAL 56

Query: 57  TQMKAAVA----ESPTNNSDSENKKLRILVAGGGIGGLVFALAAKRKGFEVLVFEKDMSA 112
             +KAA A    E        + KK R+LVAGGGIGGLVFALAAK+KGF+VLVFEKD+SA
Sbjct: 57  LGVKAATALVEKEEKREAVTEKKKKSRVLVAGGGIGGLVFALAAKKKGFDVLVFEKDLSA 116

Query: 113 IRGEGQYRGPIQIQSNALAALEAIDLDVAEEVMRAGCVTGDRINGLVDGISGSWYIKFDT 172
           IRGEG+YRGPIQIQSNALAALEAID+DVAE+VM AGC+TGDRINGLVDGISGSWY+KFDT
Sbjct: 117 IRGEGKYRGPIQIQSNALAALEAIDIDVAEQVMEAGCITGDRINGLVDGISGSWYVKFDT 176

Query: 173 FTPAAEKGLPVTRVISRMTLQQILAKAVGDEIILNESNVIDFKDHGDKVSVVLENGQCYA 232
           FTPAA +GLPVTRVISRMTLQQILA+AVG+++I NESNV+DF+D GDKV+VVLENGQ Y 
Sbjct: 177 FTPAASRGLPVTRVISRMTLQQILARAVGEDVIRNESNVVDFEDSGDKVTVVLENGQRYE 236

Query: 233 GDLLIGADGIWSKVRKNLFGPQEAIYSGYTCYTGIADFVPADIESVGYRVFLGHKQYFVS 292
           GDLL+GADGIWSKVR NLFG  EA YSGYTCYTGIADF+PADIESVGYRVFLGHKQYFVS
Sbjct: 237 GDLLVGADGIWSKVRNNLFGRSEATYSGYTCYTGIADFIPADIESVGYRVFLGHKQYFVS 296

Query: 293 SDVGAGKMQWYAFHKEPAGGVDGPEGKKERLLKIFEGWCDNVVDLILATDEEAILRRDIY 352
           SDVG GKMQWYAFH+EPAGG D P G K+RL +IF+GWCDNV+DL+ AT+E+AILRRDIY
Sbjct: 297 SDVGGGKMQWYAFHEEPAGGADAPNGMKKRLFEIFDGWCDNVLDLLHATEEDAILRRDIY 356

Query: 353 DRTPIFTWGRGRVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPID 412
           DR+P FTWG+GRVTLLGDS+HAMQPN+GQGGCMAIED +QLA+EL++A K+S E+ TP+D
Sbjct: 357 DRSPGFTWGKGRVTLLGDSIHAMQPNMGQGGCMAIEDSFQLALELDEAWKQSVETNTPVD 416

Query: 413 IVSALKSYERARRLRVAVIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGG 472
           +VS+LK YE +RRLRVA+IH +AR AA+MASTYKAYLGVGLGPLSFLTKFR+PHPGRVGG
Sbjct: 417 VVSSLKRYEESRRLRVAIIHAMARMAAIMASTYKAYLGVGLGPLSFLTKFRVPHPGRVGG 476

Query: 473 RFFIDLAMPLMLSWVLGGNSIGQLVISYDHICISSKLEGRSPCCKLSDKASDNLRTWFRD 532
           RFF+D+AMPLML WVLGGN              S KLEGR P C+L+DKA D LR WF D
Sbjct: 477 RFFVDIAMPLMLDWVLGGN--------------SEKLEGRPPSCRLTDKADDRLREWFED 522

Query: 533 DDALERAMNGEWFLVPSGSENVVSQPIYLSVSHENEPYLIGSESHEDFSRTSIVIPSAQV 592
           DDALER + GEW+L+P G +  VS+ + L+   E++P ++GSE  +DF    IVIPS+QV
Sbjct: 523 DDALERTIKGEWYLIPHGDDCCVSETLCLT-KDEDQPCIVGSEPDQDFPGMRIVIPSSQV 581

Query: 593 SKMHARISYKDGAFYLIDLQSEHGTYVTDNEGRRYRVSSNFPARFRPSDTIEFGSDKKAI 652
           SKMHAR+ YKDGAF+L+DL+SEHGTYVTDNEGRRYR + NFPARFR SD IEFGSDKKA 
Sbjct: 582 SKMHARVIYKDGAFFLMDLRSEHGTYVTDNEGRRYRATPNFPARFRSSDIIEFGSDKKAA 641

Query: 653 FRVKVI-GTPPNNNSERKEAGEILQ 676
           FRVKVI  TP +         ++LQ
Sbjct: 642 FRVKVIRKTPKSTRKNESNNDKLLQ 666

Length = 668
>gnl|CDD|181262 PRK08163, PRK08163, salicylate hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|223727 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>gnl|CDD|168661 PRK06753, PRK06753, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|235874 PRK06847, PRK06847, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|236046 PRK07538, PRK07538, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|180582 PRK06475, PRK06475, salicylate hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|238017 cd00060, FHA, Forkhead associated domain (FHA); found in eukaryotic and prokaryotic proteins Back     alignment and domain information
>gnl|CDD|132263 TIGR03219, salicylate_mono, salicylate 1-monooxygenase Back     alignment and domain information
>gnl|CDD|235980 PRK07236, PRK07236, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215951 pfam00498, FHA, FHA domain Back     alignment and domain information
>gnl|CDD|169028 PRK07588, PRK07588, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|223717 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|216530 pfam01494, FAD_binding_3, FAD binding domain Back     alignment and domain information
>gnl|CDD|233671 TIGR01988, Ubi-OHases, Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>gnl|CDD|214578 smart00240, FHA, Forkhead associated domain Back     alignment and domain information
>gnl|CDD|224630 COG1716, COG1716, FOG: FHA domain [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|136171 PRK07045, PRK07045, putative monooxygenase; Reviewed Back     alignment and domain information
>gnl|CDD|180297 PRK05868, PRK05868, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|235704 PRK06126, PRK06126, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|180935 PRK07333, PRK07333, 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|233693 TIGR02032, GG-red-SF, geranylgeranyl reductase family Back     alignment and domain information
>gnl|CDD|233669 TIGR01984, UbiH, 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>gnl|CDD|205628 pfam13450, NAD_binding_8, NAD(P)-binding Rossmann-like domain Back     alignment and domain information
>gnl|CDD|236203 PRK08255, PRK08255, salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>gnl|CDD|234178 TIGR03354, VI_FHA, type VI secretion system FHA domain protein Back     alignment and domain information
>gnl|CDD|225987 COG3456, COG3456, Predicted component of the type VI protein secretion system, contains a FHA domain [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|233671 TIGR01988, Ubi-OHases, Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>gnl|CDD|235727 PRK06183, mhpA, 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>gnl|CDD|132407 TIGR03364, HpnW_proposed, FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>gnl|CDD|235729 PRK06185, PRK06185, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|224154 COG1233, COG1233, Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 678
PLN02927668 antheraxanthin epoxidase/zeaxanthin epoxidase 100.0
PRK06126545 hypothetical protein; Provisional 100.0
PRK06184502 hypothetical protein; Provisional 100.0
PRK06183538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 100.0
PRK08132547 FAD-dependent oxidoreductase; Provisional 100.0
PRK08244493 hypothetical protein; Provisional 100.0
PRK07190487 hypothetical protein; Provisional 100.0
PRK08294634 phenol 2-monooxygenase; Provisional 100.0
PRK06834488 hypothetical protein; Provisional 100.0
PRK08013400 oxidoreductase; Provisional 100.0
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 100.0
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 100.0
PRK06753373 hypothetical protein; Provisional 100.0
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 100.0
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 100.0
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 100.0
PRK07588391 hypothetical protein; Provisional 100.0
PRK06475400 salicylate hydroxylase; Provisional 100.0
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 100.0
PRK07045388 putative monooxygenase; Reviewed 100.0
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 100.0
PRK06185407 hypothetical protein; Provisional 100.0
PRK08163396 salicylate hydroxylase; Provisional 100.0
PRK07236386 hypothetical protein; Provisional 100.0
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 100.0
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 100.0
PRK07538413 hypothetical protein; Provisional 100.0
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 100.0
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 100.0
PRK05868372 hypothetical protein; Validated 100.0
PRK06996398 hypothetical protein; Provisional 100.0
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 100.0
PRK06847375 hypothetical protein; Provisional 100.0
PRK09126392 hypothetical protein; Provisional 100.0
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 100.0
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 100.0
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 100.0
KOG2614420 consensus Kynurenine 3-monooxygenase and related f 100.0
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 100.0
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 100.0
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 100.0
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 100.0
PLN02985514 squalene monooxygenase 100.0
PTZ00367567 squalene epoxidase; Provisional 100.0
KOG3855481 consensus Monooxygenase involved in coenzyme Q (ub 99.96
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 99.96
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 99.96
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 99.96
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 99.96
PRK11445351 putative oxidoreductase; Provisional 99.95
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 99.94
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 99.93
PRK10157428 putative oxidoreductase FixC; Provisional 99.92
PRK10015429 oxidoreductase; Provisional 99.92
KOG1298509 consensus Squalene monooxygenase [Lipid transport 99.9
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 99.9
PLN02463447 lycopene beta cyclase 99.86
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 99.85
PLN02697529 lycopene epsilon cyclase 99.84
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 99.82
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 99.72
PF08491276 SE: Squalene epoxidase; InterPro: IPR013698 This d 99.68
PF0049868 FHA: FHA domain; InterPro: IPR000253 The forkhead- 99.66
cd00060102 FHA Forkhead associated domain (FHA); found in euk 99.31
TIGR03354 396 VI_FHA type VI secretion system FHA domain protein 99.29
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 99.27
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 99.2
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 99.18
COG2081408 Predicted flavoproteins [General function predicti 99.16
COG1716191 FOG: FHA domain [Signal transduction mechanisms] 99.15
PRK11259376 solA N-methyltryptophan oxidase; Provisional 99.11
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 99.08
KOG1882293 consensus Transcriptional regulator SNIP1, contain 99.07
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 99.07
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 99.04
smart0024052 FHA Forkhead associated domain. Found in eukaryoti 99.03
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 99.01
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 98.99
COG3456 430 Predicted component of the type VI protein secreti 98.96
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 98.96
PRK05192618 tRNA uridine 5-carboxymethylaminomethyl modificati 98.94
PRK11728393 hydroxyglutarate oxidase; Provisional 98.94
PRK13369502 glycerol-3-phosphate dehydrogenase; Provisional 98.92
KOG2415621 consensus Electron transfer flavoprotein ubiquinon 98.9
PRK12266508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 98.9
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 98.9
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 98.88
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 98.85
PF01134392 GIDA: Glucose inhibited division protein A; InterP 98.79
COG0579429 Predicted dehydrogenase [General function predicti 98.77
KOG1881 793 consensus Anion exchanger adaptor protein Kanadapt 98.7
PLN02172461 flavin-containing monooxygenase FMO GS-OX 98.69
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 98.67
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 98.66
PRK05257494 malate:quinone oxidoreductase; Validated 98.66
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 98.64
PRK13339497 malate:quinone oxidoreductase; Reviewed 98.6
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 98.59
TIGR00275400 flavoprotein, HI0933 family. The model when search 98.59
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 98.57
PLN02464627 glycerol-3-phosphate dehydrogenase 98.56
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 98.55
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 98.55
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 98.54
KOG1399448 consensus Flavin-containing monooxygenase [Seconda 98.54
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 98.53
PRK11101546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 98.52
PTZ00383497 malate:quinone oxidoreductase; Provisional 98.51
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 98.51
PRK07804541 L-aspartate oxidase; Provisional 98.51
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 98.5
PRK12416463 protoporphyrinogen oxidase; Provisional 98.48
PLN02661357 Putative thiazole synthesis 98.47
TIGR00551488 nadB L-aspartate oxidase. L-aspartate oxidase is t 98.47
PRK11883451 protoporphyrinogen oxidase; Reviewed 98.46
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 98.45
PRK06481506 fumarate reductase flavoprotein subunit; Validated 98.43
KOG1880 337 consensus Nuclear inhibitor of phosphatase-1 [Gene 98.43
PRK09231582 fumarate reductase flavoprotein subunit; Validated 98.43
TIGR00136617 gidA glucose-inhibited division protein A. GidA, t 98.42
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 98.41
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 98.39
PRK08274466 tricarballylate dehydrogenase; Validated 98.39
TIGR01176580 fum_red_Fp fumarate reductase, flavoprotein subuni 98.39
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 98.38
TIGR01812566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 98.37
COG0578532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 98.32
PRK06069577 sdhA succinate dehydrogenase flavoprotein subunit; 98.31
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 98.27
PRK08401466 L-aspartate oxidase; Provisional 98.26
PLN02568539 polyamine oxidase 98.25
PRK06175433 L-aspartate oxidase; Provisional 98.25
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 98.25
PRK05945575 sdhA succinate dehydrogenase flavoprotein subunit; 98.24
PRK07121492 hypothetical protein; Validated 98.23
PRK09897534 hypothetical protein; Provisional 98.2
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 98.19
KOG2820399 consensus FAD-dependent oxidoreductase [General fu 98.18
PRK07573640 sdhA succinate dehydrogenase flavoprotein subunit; 98.17
PRK08071510 L-aspartate oxidase; Provisional 98.17
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 98.16
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 98.14
PRK14694468 putative mercuric reductase; Provisional 98.13
PRK06854608 adenylylsulfate reductase subunit alpha; Validated 98.11
PRK10262321 thioredoxin reductase; Provisional 98.1
COG1231450 Monoamine oxidase [Amino acid transport and metabo 98.09
PTZ00139617 Succinate dehydrogenase [ubiquinone] flavoprotein 98.08
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 98.08
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 98.07
PRK07057591 sdhA succinate dehydrogenase flavoprotein subunit; 98.07
PRK06452566 sdhA succinate dehydrogenase flavoprotein subunit; 98.07
PRK05976472 dihydrolipoamide dehydrogenase; Validated 98.05
PLN00128635 Succinate dehydrogenase [ubiquinone] flavoprotein 98.04
PRK08641589 sdhA succinate dehydrogenase flavoprotein subunit; 98.03
PLN02507499 glutathione reductase 98.03
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 98.01
PRK07803626 sdhA succinate dehydrogenase flavoprotein subunit; 98.01
PLN02529738 lysine-specific histone demethylase 1 98.0
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 97.99
PRK09078598 sdhA succinate dehydrogenase flavoprotein subunit; 97.98
PRK06327475 dihydrolipoamide dehydrogenase; Validated 97.98
PRK06263543 sdhA succinate dehydrogenase flavoprotein subunit; 97.97
PRK08275554 putative oxidoreductase; Provisional 97.95
PRK07843557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.95
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 97.93
PRK08958588 sdhA succinate dehydrogenase flavoprotein subunit; 97.91
PRK08205583 sdhA succinate dehydrogenase flavoprotein subunit; 97.91
PRK12842574 putative succinate dehydrogenase; Reviewed 97.9
PRK09077536 L-aspartate oxidase; Provisional 97.89
PLN02815594 L-aspartate oxidase 97.88
COG1233487 Phytoene dehydrogenase and related proteins [Secon 97.87
PRK08626657 fumarate reductase flavoprotein subunit; Provision 97.83
PRK06134581 putative FAD-binding dehydrogenase; Reviewed 97.82
PRK13748561 putative mercuric reductase; Provisional 97.8
PRK12834549 putative FAD-binding dehydrogenase; Reviewed 97.8
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 97.77
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 97.76
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 97.72
PRK07395553 L-aspartate oxidase; Provisional 97.72
PLN02546558 glutathione reductase 97.71
PRK12844557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.68
PRK07512513 L-aspartate oxidase; Provisional 97.67
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 97.67
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 97.66
PRK14727479 putative mercuric reductase; Provisional 97.66
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 97.65
PRK07845466 flavoprotein disulfide reductase; Reviewed 97.65
TIGR01811603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 97.65
COG0029518 NadB Aspartate oxidase [Coenzyme metabolism] 97.64
PTZ00153659 lipoamide dehydrogenase; Provisional 97.64
PRK06370463 mercuric reductase; Validated 97.64
PRK12843578 putative FAD-binding dehydrogenase; Reviewed 97.63
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 97.62
PRK06116450 glutathione reductase; Validated 97.62
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 97.61
PRK07208479 hypothetical protein; Provisional 97.61
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 97.61
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 97.6
COG0445621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 97.6
PRK07846451 mycothione reductase; Reviewed 97.6
PRK12839572 hypothetical protein; Provisional 97.59
KOG0029501 consensus Amine oxidase [Secondary metabolites bio 97.59
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 97.58
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 97.56
PRK12845564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.56
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 97.56
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 97.56
PRK09564444 coenzyme A disulfide reductase; Reviewed 97.56
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 97.55
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 97.54
TIGR02061614 aprA adenosine phosphosulphate reductase, alpha su 97.54
PTZ00318424 NADH dehydrogenase-like protein; Provisional 97.54
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 97.53
PRK13512438 coenzyme A disulfide reductase; Provisional 97.52
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 97.52
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 97.51
PRK06116450 glutathione reductase; Validated 97.51
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 97.5
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 97.49
KOG2665453 consensus Predicted FAD-dependent oxidoreductase [ 97.49
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 97.48
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 97.46
PLN02852491 ferredoxin-NADP+ reductase 97.46
TIGR02730493 carot_isom carotene isomerase. Members of this fam 97.44
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 97.44
PRK06292460 dihydrolipoamide dehydrogenase; Validated 97.44
PLN02507499 glutathione reductase 97.44
COG3349485 Uncharacterized conserved protein [Function unknow 97.42
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 97.41
PRK07845466 flavoprotein disulfide reductase; Reviewed 97.41
PRK065671028 putative bifunctional glutamate synthase subunit b 97.4
PRK07233434 hypothetical protein; Provisional 97.39
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 97.39
PRK12779944 putative bifunctional glutamate synthase subunit b 97.37
PRK12831464 putative oxidoreductase; Provisional 97.36
PTZ00058561 glutathione reductase; Provisional 97.35
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 97.33
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 97.33
TIGR02053463 MerA mercuric reductase. This model represents the 97.32
PLN02576496 protoporphyrinogen oxidase 97.32
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 97.32
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 97.31
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 97.3
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 97.28
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 97.28
PTZ00188506 adrenodoxin reductase; Provisional 97.28
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 97.28
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 97.28
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 97.27
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 97.27
KOG0615 475 consensus Serine/threonine protein kinase Chk2 and 97.25
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 97.25
COG1148622 HdrA Heterodisulfide reductase, subunit A and rela 97.24
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 97.24
TIGR02053463 MerA mercuric reductase. This model represents the 97.24
PLN02268435 probable polyamine oxidase 97.23
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 97.23
PTZ00052499 thioredoxin reductase; Provisional 97.21
PLN02328808 lysine-specific histone demethylase 1 homolog 97.21
KOG2852380 consensus Possible oxidoreductase [General functio 97.21
PRK098531019 putative selenate reductase subunit YgfK; Provisio 97.21
PRK06327475 dihydrolipoamide dehydrogenase; Validated 97.19
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 97.17
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 97.16
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 97.16
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 97.16
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 97.15
PRK06370463 mercuric reductase; Validated 97.15
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 97.14
PRK127751006 putative trifunctional 2-polyprenylphenol hydroxyl 97.14
PRK05976472 dihydrolipoamide dehydrogenase; Validated 97.13
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 97.12
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 97.12
COG4529474 Uncharacterized protein conserved in bacteria [Fun 97.11
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 97.11
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 97.1
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 97.1
PLN02487569 zeta-carotene desaturase 97.09
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 97.08
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 97.03
PRK12837513 3-ketosteroid-delta-1-dehydrogenase; Provisional 97.03
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 97.03
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 97.02
PRK12814652 putative NADPH-dependent glutamate synthase small 97.02
KOG2844 856 consensus Dimethylglycine dehydrogenase precursor 97.01
PRK14989 847 nitrite reductase subunit NirD; Provisional 97.01
KOG1335506 consensus Dihydrolipoamide dehydrogenase [Energy p 97.0
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 96.99
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biog 96.98
PRK13977576 myosin-cross-reactive antigen; Provisional 96.97
PRK13512438 coenzyme A disulfide reductase; Provisional 96.97
PRK14989 847 nitrite reductase subunit NirD; Provisional 96.96
PRK12835584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 96.96
PTZ00052499 thioredoxin reductase; Provisional 96.96
KOG0245 1221 consensus Kinesin-like protein [Cytoskeleton] 96.95
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 96.94
TIGR02462544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 96.94
PLN02676487 polyamine oxidase 96.92
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 96.9
PRK02106560 choline dehydrogenase; Validated 96.9
KOG2311679 consensus NAD/FAD-utilizing protein possibly invol 96.89
PRK07846451 mycothione reductase; Reviewed 96.85
PRK06292460 dihydrolipoamide dehydrogenase; Validated 96.84
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 96.83
PRK12770352 putative glutamate synthase subunit beta; Provisio 96.81
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 96.81
COG3573552 Predicted oxidoreductase [General function predict 96.8
PLN02612567 phytoene desaturase 96.77
PTZ00058561 glutathione reductase; Provisional 96.76
PRK14694468 putative mercuric reductase; Provisional 96.73
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 96.73
COG1053562 SdhA Succinate dehydrogenase/fumarate reductase, f 96.72
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 96.7
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 96.67
PRK12771564 putative glutamate synthase (NADPH) small subunit; 96.67
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 96.65
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 96.63
PRK14727479 putative mercuric reductase; Provisional 96.62
PRK09564444 coenzyme A disulfide reductase; Reviewed 96.59
PTZ00318424 NADH dehydrogenase-like protein; Provisional 96.57
PRK13748561 putative mercuric reductase; Provisional 96.45
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 96.39
KOG2404477 consensus Fumarate reductase, flavoprotein subunit 96.33
PRK13984604 putative oxidoreductase; Provisional 96.33
COG2907447 Predicted NAD/FAD-binding protein [General functio 96.32
TIGR02500 410 type_III_yscD type III secretion apparatus protein 96.31
PLN02546558 glutathione reductase 96.31
PTZ00153659 lipoamide dehydrogenase; Provisional 96.3
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 96.28
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 96.27
PLN03000881 amine oxidase 96.24
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri 96.23
COG2303542 BetA Choline dehydrogenase and related flavoprotei 96.12
KOG1276491 consensus Protoporphyrinogen oxidase [Coenzyme tra 96.12
PLN02976 1713 amine oxidase 96.09
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 96.09
TIGR01810532 betA choline dehydrogenase. This enzyme is a membe 96.08
KOG1800468 consensus Ferredoxin/adrenodoxin reductase [Nucleo 96.03
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 96.02
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 96.01
KOG03992142 consensus Glutamate synthase [Amino acid transport 95.99
KOG0685498 consensus Flavin-containing amine oxidase [Coenzym 95.95
COG1206439 Gid NAD(FAD)-utilizing enzyme possibly involved in 95.93
KOG2853509 consensus Possible oxidoreductase [General functio 95.91
PLN02785587 Protein HOTHEAD 95.9
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 95.72
KOG2293547 consensus Daxx-interacting protein MSP58/p78, cont 95.69
KOG0404322 consensus Thioredoxin reductase [Posttranslational 95.65
PRK10262321 thioredoxin reductase; Provisional 95.61
KOG1335506 consensus Dihydrolipoamide dehydrogenase [Energy p 95.28
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 95.26
KOG0042680 consensus Glycerol-3-phosphate dehydrogenase [Ener 95.19
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 95.18
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 95.02
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 94.98
KOG1336478 consensus Monodehydroascorbate/ferredoxin reductas 94.91
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 94.83
KOG3851446 consensus Sulfide:quinone oxidoreductase/flavo-bin 94.77
COG0569225 TrkA K+ transport systems, NAD-binding component [ 94.66
KOG1892 1629 consensus Actin filament-binding protein Afadin [C 94.41
KOG1346659 consensus Programmed cell death 8 (apoptosis-induc 94.17
KOG4254561 consensus Phytoene desaturase [Coenzyme transport 94.11
PRK06249313 2-dehydropantoate 2-reductase; Provisional 94.1
COG1251793 NirB NAD(P)H-nitrite reductase [Energy production 94.09
PRK01438480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.99
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 93.96
PRK02705459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.92
TIGR01663 526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 93.6
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 93.44
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.41
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.4
PF00996438 GDI: GDP dissociation inhibitor; InterPro: IPR0182 93.36
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.24
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en 93.21
KOG1238623 consensus Glucose dehydrogenase/choline dehydrogen 93.17
PRK06719157 precorrin-2 dehydrogenase; Validated 93.03
TIGR02730493 carot_isom carotene isomerase. Members of this fam 93.03
PRK05708305 2-dehydropantoate 2-reductase; Provisional 92.99
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.97
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.8
KOG2960328 consensus Protein involved in thiamine biosynthesi 92.76
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 92.57
cd02929370 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) 92.56
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.53
PRK12921305 2-dehydropantoate 2-reductase; Provisional 92.5
KOG4716503 consensus Thioredoxin reductase [Posttranslational 92.46
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 92.45
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 92.43
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.4
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 92.35
KOG3923342 consensus D-aspartate oxidase [Amino acid transpor 92.28
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 92.26
KOG0241 1714 consensus Kinesin-like protein [Cytoskeleton] 92.16
PF13478136 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2 92.13
PLN02612567 phytoene desaturase 91.96
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 91.95
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 91.95
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 91.84
PRK06718202 precorrin-2 dehydrogenase; Reviewed 91.81
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 91.53
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 91.49
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 91.35
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 91.28
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 91.26
PRK04148134 hypothetical protein; Provisional 91.24
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 91.16
PRK15116268 sulfur acceptor protein CsdL; Provisional 91.07
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 91.06
PRK08229341 2-dehydropantoate 2-reductase; Provisional 91.05
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 91.03
PRK07233434 hypothetical protein; Provisional 90.91
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 90.79
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 90.78
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 90.72
PTZ00082321 L-lactate dehydrogenase; Provisional 90.68
TIGR03377516 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase 90.57
PRK14620326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 90.54
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 90.45
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 90.37
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 90.34
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 90.33
PRK14619308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 90.27
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 90.18
KOG1336478 consensus Monodehydroascorbate/ferredoxin reductas 90.18
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 90.15
PRK12770352 putative glutamate synthase subunit beta; Provisio 90.14
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 90.02
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 89.99
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 89.82
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 89.81
PRK07417279 arogenate dehydrogenase; Reviewed 89.53
TIGR01372985 soxA sarcosine oxidase, alpha subunit family, hete 89.48
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 89.44
PRK12831464 putative oxidoreductase; Provisional 89.44
PRK07502307 cyclohexadienyl dehydrogenase; Validated 89.23
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 89.19
TIGR02964246 xanthine_xdhC xanthine dehydrogenase accessory pro 89.02
PRK06223307 malate dehydrogenase; Reviewed 88.85
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 88.71
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 88.7
TIGR03467419 HpnE squalene-associated FAD-dependent desaturase. 88.52
PRK15057388 UDP-glucose 6-dehydrogenase; Provisional 88.46
PLN02353473 probable UDP-glucose 6-dehydrogenase 88.44
PRK07531495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 88.37
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 88.37
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 88.14
PRK08268507 3-hydroxy-acyl-CoA dehydrogenase; Validated 88.13
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 88.06
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 87.98
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 87.96
cd01483143 E1_enzyme_family Superfamily of activating enzymes 87.95
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 87.85
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 87.62
TIGR02279503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 87.55
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 87.52
PRK08306296 dipicolinate synthase subunit A; Reviewed 87.46
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 87.43
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 87.39
PRK02472447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 87.37
COG5044434 MRS6 RAB proteins geranylgeranyltransferase compon 87.21
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 87.11
PRK04308445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 87.11
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 86.96
PTZ00117319 malate dehydrogenase; Provisional 86.92
PRK12549284 shikimate 5-dehydrogenase; Reviewed 86.49
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 86.45
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 86.42
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 86.42
PRK08328231 hypothetical protein; Provisional 86.37
TIGR00561511 pntA NAD(P) transhydrogenase, alpha subunit. In so 86.32
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 86.31
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 86.25
PRK09496453 trkA potassium transporter peripheral membrane com 86.22
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 86.21
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 86.07
KOG2304298 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid t 86.04
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 86.0
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 85.99
PLN02576496 protoporphyrinogen oxidase 85.96
TIGR03736244 PRTRC_ThiF PRTRC system ThiF family protein. A nov 85.87
TIGR03862376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 85.84
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 85.76
PRK11730715 fadB multifunctional fatty acid oxidation complex 85.7
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 85.68
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 85.61
PRK01710458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 85.59
TIGR02437714 FadB fatty oxidation complex, alpha subunit FadB. 85.53
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 85.5
PRK10669558 putative cation:proton antiport protein; Provision 85.13
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 85.07
PRK03369488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 84.97
PRK00683418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 84.84
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 84.82
PRK08223287 hypothetical protein; Validated 84.66
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 84.59
PLN02976 1713 amine oxidase 84.53
TIGR01505291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 84.46
TIGR02441737 fa_ox_alpha_mit fatty acid oxidation complex, alph 84.38
PF01593450 Amino_oxidase: Flavin containing amine oxidoreduct 84.19
PLN02676487 polyamine oxidase 83.71
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information 
Probab=100.00  E-value=3e-84  Score=716.67  Aligned_cols=660  Identities=71%  Similarity=1.179  Sum_probs=535.5

Q ss_pred             CcccccccCCCcccce--eecccCcccccCCcccccccccccccccccccccCCCcccccccccccCCCCCCC----CCC
Q 005770            1 MVSSMFYNSVNLSTAV--FSRTHFPVPVYKHSCIEFSRYDHCINYKFRTGTSGQSKNPTQMKAAVAESPTNNS----DSE   74 (678)
Q Consensus         1 ~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~   74 (678)
                      |++++|++++|.+++.  +||+|+|.+...+...++.++..|+..+......+  .+...++...+..+..+.    ...
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~   78 (668)
T PLN02927          1 MGSTLFCYSINPSPSKLDFTRTHVFSPVAKQFYLDLSSFSGKPGGGLSGFRSR--KALLGVKAATALVEKEEKREAVTEK   78 (668)
T ss_pred             CCccccccCCCccchhhhccccCCCCcccccchhhhccccccCccccccccch--hhhcchhhhhhhccccccccccccc
Confidence            8999999999999999  99999999999999999999999886433322222  222223333322222211    123


Q ss_pred             CCCCeEEEECCCHHHHHHHHHHHHcCCcEEEEecccccccCCcccccceeeChhHHHHHHhcChhHHHHHHHhccccccc
Q 005770           75 NKKLRILVAGGGIGGLVFALAAKRKGFEVLVFEKDMSAIRGEGQYRGPIQIQSNALAALEAIDLDVAEEVMRAGCVTGDR  154 (678)
Q Consensus        75 ~~~~~v~ivG~G~~G~~~a~~l~~~g~~~~~~e~~~~~~~~~g~~~~~~~l~~~~~~~L~~l~~gl~~~~~~~~~~~~~~  154 (678)
                      .+..+|+||||||+||++|+.|+++|++|+||||++...+..|.+++++.++++++++|+++++++.+++.+.+......
T Consensus        79 ~~~~~VlIVGgGIaGLalAlaL~r~Gi~V~V~Er~~~~~r~~G~~~~~I~L~pngl~aLe~LGl~~~e~l~~~g~~~~~~  158 (668)
T PLN02927         79 KKKSRVLVAGGGIGGLVFALAAKKKGFDVLVFEKDLSAIRGEGKYRGPIQIQSNALAALEAIDIDVAEQVMEAGCITGDR  158 (668)
T ss_pred             cCCCCEEEECCCHHHHHHHHHHHhcCCeEEEEeccccccccccccCcccccCHHHHHHHHHcCcchHHHHHhhcCcccce
Confidence            45689999999999999999999999999999998644344444445688999999999999766778887776543333


Q ss_pred             eeeeeecCCCceeeeccCCCcccccCCCeEEEeCHHHHHHHHHHhcCCceEEeCCeEEEEEEeCCeEEEEEcCCcEEecc
Q 005770          155 INGLVDGISGSWYIKFDTFTPAAEKGLPVTRVISRMTLQQILAKAVGDEIILNESNVIDFKDHGDKVSVVLENGQCYAGD  234 (678)
Q Consensus       155 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~r~~l~~~L~~~~~~~~i~~~~~v~~~~~~~~~v~v~~~dg~~i~a~  234 (678)
                      +..+.++..+.+...++...+....+.+..+.|+|..|+++|.+.++...++++++|+++++++++|++++.+|+++++|
T Consensus       159 i~~~~d~~~G~~~~~~~~~~~~~~~g~p~~~~I~R~~L~~~L~~alg~~~i~~g~~V~~I~~~~d~VtV~~~dG~ti~aD  238 (668)
T PLN02927        159 INGLVDGISGSWYVKFDTFTPAASRGLPVTRVISRMTLQQILARAVGEDVIRNESNVVDFEDSGDKVTVVLENGQRYEGD  238 (668)
T ss_pred             eeeeeecCCCceEeeccccccccccCCCeEEEEeHHHHHHHHHhhCCCCEEEcCCEEEEEEEeCCEEEEEECCCCEEEcC
Confidence            33334444455555554332223345566789999999999999887766889999999999999999999999999999


Q ss_pred             EEEEecCCCchhhhhhcCCCCccccccEEEEEEecCCCCCcCCcceEEEecCceEEEEeeCCCCeEEEEEEEeCCCCCCC
Q 005770          235 LLIGADGIWSKVRKNLFGPQEAIYSGYTCYTGIADFVPADIESVGYRVFLGHKQYFVSSDVGAGKMQWYAFHKEPAGGVD  314 (678)
Q Consensus       235 ~vVgADG~~S~VR~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~w~~~~~~~~~~~~  314 (678)
                      +||||||++|.+|+.+++.....|.++.+|.++.+..+.+.....+..|.++..+++.++..++.+.|+.+...+.....
T Consensus       239 lVVGADG~~S~vR~~l~g~~~~~~sG~~~~rgi~~~~p~~~~~~~~~~~~G~~~~~v~~~v~~g~~~~~~f~~~p~~~~~  318 (668)
T PLN02927        239 LLVGADGIWSKVRNNLFGRSEATYSGYTCYTGIADFIPADIESVGYRVFLGHKQYFVSSDVGGGKMQWYAFHEEPAGGAD  318 (668)
T ss_pred             EEEECCCCCcHHHHHhcCCCCCcccceEEEEEEcCCCcccccccceEEEEcCCeEEEEEcCCCCeEEEEEEEECCccccc
Confidence            99999999999999997666678888889888877655444444455677777777777777777788777655433222


Q ss_pred             CcchhHHHHHHHhccCChhHHHHHHcCChhhhhhcccccCCCCccccCCcEEEEccccCCCCCCCcchhhHHHHHHHHHH
Q 005770          315 GPEGKKERLLKIFEGWCDNVVDLILATDEEAILRRDIYDRTPIFTWGRGRVTLLGDSVHAMQPNLGQGGCMAIEDGYQLA  394 (678)
Q Consensus       315 ~~~~~~~~l~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~grv~LvGDAAH~~~P~~GqG~n~gl~Da~~La  394 (678)
                      .+....+.+.+.+..|.+.+.+++...+...+..+.++.+.+..+|..|||+|+|||||.|+|+.|||+|+||+||..|+
T Consensus       319 ~~~~~~e~L~~~f~~w~~~v~elI~~t~~~~i~~~~iyd~~p~~~W~~grVvLiGDAAH~~~P~~GqG~n~AieDa~~La  398 (668)
T PLN02927        319 APNGMKKRLFEIFDGWCDNVLDLLHATEEDAILRRDIYDRSPGFTWGKGRVTLLGDSIHAMQPNMGQGGCMAIEDSFQLA  398 (668)
T ss_pred             cchhHHHHHHHHhccCCHHHHHHHHhCccccceeeeEEeccCCCccccCcEEEEcCccCCCCCccccchHHHHHHHHHHH
Confidence            34456788889999999988887776655555666777776777899999999999999999999999999999999999


Q ss_pred             HHHHHHhhccCCCCChhhHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHhHhhhhhcCCCCcccccccccccCCCCcchhh
Q 005770          395 VELEKACKKSNESKTPIDIVSALKSYERARRLRVAVIHGLARSAAVMASTYKAYLGVGLGPLSFLTKFRIPHPGRVGGRF  474 (678)
Q Consensus       395 ~~L~~~~~~~~~~~~~~~~~~~L~~Ye~eRr~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~l~~~~~~~~~~  474 (678)
                      ++|..++++....+.+.+.+.+|+.|+++|++++..++..+++...+...++.+.+.++.|+.+++.++++.++++..|+
T Consensus       399 ~~L~~~~~~~~~~~~~~~~~~aL~~Ye~~R~~rv~~i~~~ar~a~~~~~~~~~y~~~~~~p~~~~~~~~~~~~~~~~~~~  478 (668)
T PLN02927        399 LELDEAWKQSVETNTPVDVVSSLKRYEESRRLRVAIIHAMARMAAIMASTYKAYLGVGLGPLSFLTKFRVPHPGRVGGRF  478 (668)
T ss_pred             HHHHHhhccccccCCcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCHHHHHHhcCCCCCCceeeee
Confidence            99998765432222344678999999999999999999999999999988887777889999999999999999999999


Q ss_pred             HHhhhhhhhhHhhhccccccceeeecccccccccCCCCCCccccCcccchhhhhhhcCChhhhHhcCCceEEEecCCCCC
Q 005770          475 FIDLAMPLMLSWVLGGNSIGQLVISYDHICISSKLEGRSPCCKLSDKASDNLRTWFRDDDALERAMNGEWFLVPSGSENV  554 (678)
Q Consensus       475 ~~~~~~~~~~~~~~~~~y~~~~~i~~~~s~~~~~~~~~~~~~~~~~~pG~~p~~~~~~g~~~~~~~~~~~~Ll~~~~~~~  554 (678)
                      |+..+|+.|+.|..|.+              ++.++|+++.++..+.+-+-...|+.|+.++...+++.|+|+..++...
T Consensus       479 ~~~~~~~~~~~~~~~~~--------------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~w~l~~~~~~~~  544 (668)
T PLN02927        479 FVDIAMPLMLDWVLGGN--------------SEKLEGRPPSCRLTDKADDRLREWFEDDDALERTIKGEWYLIPHGDDCC  544 (668)
T ss_pred             eeecccHHHhhhhhcCC--------------ccccCCCCCccccccchhHHHHHHhcccHHHHHhhcCCeEEEecCCCCc
Confidence            99999999999998765              4456788888999999988555699999999999999999999987764


Q ss_pred             cCcceeeecccCCCcEEeCCCCCCCCCcceEEeCCCcccccceEEEEeCCEEEEEeCCCCCceEecCCCCceeecCCCCc
Q 005770          555 VSQPIYLSVSHENEPYLIGSESHEDFSRTSIVIPSAQVSKMHARISYKDGAFYLIDLQSEHGTYVTDNEGRRYRVSSNFP  634 (678)
Q Consensus       555 ~~~~l~~~~~~~~~~~~iGR~~~~~~~~~~~~~~~~~vSr~Ha~i~~~~~~~~i~Dl~S~nGt~v~~~~~~~~~~~~~~~  634 (678)
                      ..+++.+. +.++.+++|||.++++.++..|+|+++.||+.||+|.++++.|+|+||+|+|||||||.+++++++.|+.+
T Consensus       545 ~~~~~~l~-~~~~~p~~iG~~~~~~~~~~~i~i~~~~vS~~Ha~i~~~~~~~~~~Dl~S~nGT~v~~~~~~r~~~~p~~~  623 (668)
T PLN02927        545 VSETLCLT-KDEDQPCIVGSEPDQDFPGMRIVIPSSQVSKMHARVIYKDGAFFLMDLRSEHGTYVTDNEGRRYRATPNFP  623 (668)
T ss_pred             ccceeeee-cCCCCCeEecCCCCcCCCCceEEecCCccChhHeEEEEECCEEEEEECCCCCccEEeCCCCceEecCCCCc
Confidence            56777776 66788999999999887778889999999999999999999999999999999999999999899999999


Q ss_pred             EEeCCCCEEEECCCceEEEEEEeccCCCCCccccccc--hhhhhcC
Q 005770          635 ARFRPSDTIEFGSDKKAIFRVKVIGTPPNNNSERKEA--GEILQAV  678 (678)
Q Consensus       635 ~~l~~gd~i~~g~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~  678 (678)
                      +.|++||+|+||+...+.||++....+|... ++++-  .++||+|
T Consensus       624 ~~l~~~d~I~~g~~~~~~fr~~~~~~~~~~~-~~~~~~~~~~~~~~  668 (668)
T PLN02927        624 ARFRSSDIIEFGSDKKAAFRVKVIRKTPKST-RKNESNNDKLLQTA  668 (668)
T ss_pred             eEeCCCCEEEeCCCcceeEEEEeecCCCcch-hhcccchhhhhhcC
Confidence            9999999999999877779999998888876 44443  5899986

>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>KOG2614 consensus Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion; General function prediction only] Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>KOG3855 consensus Monooxygenase involved in coenzyme Q (ubiquinone) biosynthesis [Coenzyme transport and metabolism; Energy production and conversion] Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>KOG1298 consensus Squalene monooxygenase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PF08491 SE: Squalene epoxidase; InterPro: IPR013698 This domain is found in squalene epoxidase (SE) and related proteins which are found in taxonomically diverse groups of eukaryotes and also in bacteria Back     alignment and domain information
>PF00498 FHA: FHA domain; InterPro: IPR000253 The forkhead-associated (FHA) domain [] is a phosphopeptide recognition domain found in many regulatory proteins Back     alignment and domain information
>cd00060 FHA Forkhead associated domain (FHA); found in eukaryotic and prokaryotic proteins Back     alignment and domain information
>TIGR03354 VI_FHA type VI secretion system FHA domain protein Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>COG1716 FOG: FHA domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>KOG1882 consensus Transcriptional regulator SNIP1, contains FHA domain [Signal transduction mechanisms] Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>smart00240 FHA Forkhead associated domain Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>COG3456 Predicted component of the type VI protein secretion system, contains a FHA domain [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>KOG2415 consensus Electron transfer flavoprotein ubiquinone oxidoreductase [Energy production and conversion] Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>KOG1881 consensus Anion exchanger adaptor protein Kanadaptin, contains FHA domain [General function prediction only] Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>KOG1880 consensus Nuclear inhibitor of phosphatase-1 [General function prediction only] Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>KOG2820 consensus FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>KOG2665 consensus Predicted FAD-dependent oxidoreductase [Function unknown] Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>KOG2852 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>KOG2844 consensus Dimethylglycine dehydrogenase precursor [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>KOG0245 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>KOG2311 consensus NAD/FAD-utilizing protein possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>KOG2404 consensus Fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>TIGR02500 type_III_yscD type III secretion apparatus protein, YscD/HrpQ family Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>KOG1800 consensus Ferredoxin/adrenodoxin reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2853 consensus Possible oxidoreductase [General function prediction only] Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>KOG2293 consensus Daxx-interacting protein MSP58/p78, contains FHA domain [Transcription; Signal transduction mechanisms] Back     alignment and domain information
>KOG0404 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>KOG1335 consensus Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>KOG3851 consensus Sulfide:quinone oxidoreductase/flavo-binding protein [Energy production and conversion] Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1892 consensus Actin filament-binding protein Afadin [Cytoskeleton] Back     alignment and domain information
>KOG1346 consensus Programmed cell death 8 (apoptosis-inducing factor) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4254 consensus Phytoene desaturase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG1238 consensus Glucose dehydrogenase/choline dehydrogenase/mandelonitrile lyase (GMC oxidoreductase family) [General function prediction only] Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>KOG2960 consensus Protein involved in thiamine biosynthesis and DNA damage tolerance [General function prediction only] Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd02929 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) and histamine dehydrogenase (HD) FMN-binding domain Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>KOG4716 consensus Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>KOG3923 consensus D-aspartate oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>KOG0241 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>PF13478 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2WE7_A Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>KOG1336 consensus Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR02964 xanthine_xdhC xanthine dehydrogenase accessory protein XdhC Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>TIGR03467 HpnE squalene-associated FAD-dependent desaturase Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG5044 MRS6 RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>KOG2304 consensus 3-hydroxyacyl-CoA dehydrogenase [Lipid transport and metabolism] Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query678
3rp8_A407 Crystal Structure Of Klebsiella Pneumoniae R204q Hp 3e-23
3rp6_A407 Crystal Structure Of Klebsiella Pneumoniae Hpxo Com 1e-22
3c96_A410 Crystal Structure Of The Flavin-Containing Monooxyg 4e-18
2rgj_A402 Crystal Structure Of Flavin-Containing Monooxygenas 6e-17
3gmc_A415 Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-C 1e-09
3alh_A379 Higher Resolution And Native Structure Of 2-Methyl- 1e-09
3alk_A379 Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-C 3e-09
3all_A379 Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-C 3e-09
3gmb_A415 Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-C 3e-08
4hb9_A412 Crystal Structure Of A Putative Fad Containing Mono 4e-08
3alm_A379 Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-C 3e-05
>pdb|3RP8|A Chain A, Crystal Structure Of Klebsiella Pneumoniae R204q Hpxo Complexed With Fad Length = 407 Back     alignment and structure 
Iteration: 1

 Score =  107 bits (266), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 81/254 (31%), Positives = 122/254 (48%), Gaps = 15/254 (5%)
Query: 187 ISRMTLQQILAKAVGDEIILNESNVIDFKDHGDKVSVVLENGQCYAGDLLIGADGIWSKV 246
           +SR  LQ+ +    G + +     V   ++  D V+V   +G   +GDLLI ADG  S +
Sbjct: 124 VSRAELQREMLDYWGRDSVQFGKRVTRCEEDADGVTVWFTDGSSASGDLLIAADGSHSAL 183
Query: 247 RKNLFG--PQEAIYSGYTCYTGIADFVPADIESVGYRVFLGHKQYFVSSDVGAGKMQWYA 304
           R  + G  PQ   Y+GY  + G+ +   A      +  F+G  +      V AG+  ++ 
Sbjct: 184 RPWVLGFTPQRR-YAGYVNWNGLVEIDEALAPGDQWTTFVGEGKQVSLMPVSAGRFYFFF 242
Query: 305 FHKEPAGGVDGPEGKKERLLKIFEGWCDNVVDLILATDEEAILRRDIYDRTPIFTWGRGR 364
               PAG  +  +  +  L + F GW   V  LI A D +   R +I+D  P     RGR
Sbjct: 243 DVPLPAGLAEDRDTLRADLSRYFAGWAPPVQKLIAALDPQTTNRIEIHDIEPFSRLVRGR 302
Query: 365 VTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSALKSYE--R 422
           V LLGD+ H+  P++GQGGC A+ED    AV L    +++       DI +AL+ YE  R
Sbjct: 303 VALLGDAGHSTTPDIGQGGCAAMED----AVVLGAVFRQTR------DIAAALREYEAQR 352
Query: 423 ARRLRVAVIHGLAR 436
             R+R  V+    R
Sbjct: 353 CDRVRDLVLKARKR 366
>pdb|3RP6|A Chain A, Crystal Structure Of Klebsiella Pneumoniae Hpxo Complexed With Fad Length = 407 Back     alignment and structure
>pdb|3C96|A Chain A, Crystal Structure Of The Flavin-Containing Monooxygenase Phzs From Pseudomonas Aeruginosa. Northeast Structural Genomics Consortium Target Par240 Length = 410 Back     alignment and structure
>pdb|2RGJ|A Chain A, Crystal Structure Of Flavin-Containing Monooxygenase Phzs Length = 402 Back     alignment and structure
>pdb|3GMC|A Chain A, Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-Carboxylic Acid Oxygenase With Substrate Bound Length = 415 Back     alignment and structure
>pdb|3ALH|A Chain A, Higher Resolution And Native Structure Of 2-Methyl-3-Hydroxypyridine- 5-Carboxylic Acid Oxygenase Length = 379 Back     alignment and structure
>pdb|3ALK|A Chain A, Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-Carboxylic Acid Oxygenase, Mutant Y270f Length = 379 Back     alignment and structure
>pdb|3ALL|A Chain A, Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-Carboxylic Acid Oxygenase, Mutant Y270a Length = 379 Back     alignment and structure
>pdb|3GMB|A Chain A, Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-Carboxylic Acid Oxygenase Length = 415 Back     alignment and structure
>pdb|4HB9|A Chain A, Crystal Structure Of A Putative Fad Containing Monooxygenase From Photorhabdus Luminescens Subsp. Laumondii Tto1 (Target Psi-012791) Length = 412 Back     alignment and structure
>pdb|3ALM|A Chain A, Crystal Structure Of 2-Methyl-3-Hydroxypyridine-5-Carboxylic Acid Oxygenase, Mutant C294a Length = 379 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query678
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 1e-129
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 6e-95
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 7e-93
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 4e-82
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 1e-80
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 4e-38
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 4e-22
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 1e-21
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 3e-17
3i3l_A591 Alkylhalidase CMLS; flavin-dependent halogenase, c 2e-16
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 5e-16
2r0c_A549 REBC; flavin adenine dinucleotide, monooxygenase, 5e-14
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 1e-12
3atr_A453 Conserved archaeal protein; saturating double bond 2e-12
3va4_A132 Mediator of DNA damage checkpoint protein 1; cell 1e-11
2jpe_A140 Nuclear inhibitor of protein phosphatase 1; FHA do 2e-11
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 5e-11
3ihg_A535 RDME; flavoenzyme, anthracycline, polyketide biosy 2e-10
3els_A158 PRE-mRNA leakage protein 1; intrinsically unstruct 3e-10
1uht_A118 Expressed protein; FHA domain, beta-sandwich, anti 5e-10
3elv_A205 PRE-mRNA leakage protein 1; intrinsically unstruct 9e-10
3fmw_A570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 1e-09
2pie_A138 E3 ubiquitin-protein ligase RNF8; FHA domain, comp 2e-09
3gqs_A106 Adenylate cyclase-like protein; FHA domain, struct 2e-09
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 2e-09
1r21_A128 Antigen KI-67; beta sandwich, cell cycle; NMR {Hom 2e-09
2xt9_B115 Putative signal transduction protein GARA; lyase-s 3e-09
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 4e-09
2kb3_A143 Oxoglutarate dehydrogenase inhibitor; forkhead-ass 6e-09
2csw_A145 Ubiquitin ligase protein RNF8; 11-stranded beta sa 1e-08
2kfu_A162 RV1827 PThr 22; FHA domain, phosphorylation, intra 1e-08
3po8_A100 RV0020C protein, putative uncharacterized protein 1e-08
1mzk_A139 Kinase associated protein phosphatase; beta sandwi 2e-08
1g6g_A127 Protein kinase RAD53; beta-sandwich, phosphopeptid 2e-08
1g3g_A164 Protien kinase SPK1; FHA domain, RAD53, phosphopep 2e-08
3oun_A157 Putative uncharacterized protein TB39.8; peptidogl 4e-08
2jqj_A151 DNA damage response protein kinase DUN1; protein/p 9e-08
2dkh_A639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 1e-07
3hx1_A131 SLR1951 protein; P74513_SYNY3, adenylate cyclase-l 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 4e-06
1lgp_A116 Cell cycle checkpoint protein CHFR; FHA, tungstate 5e-06
1wln_A120 Afadin; beta sandwich, FHA domain, structural geno 1e-05
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 2e-05
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 3e-05
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 4e-05
3fm8_A124 Kinesin-like protein KIF13B; kinesin, GAP, GTPase 5e-05
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 6e-05
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 8e-05
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 9e-05
1gxc_A149 CHK2, CDS1, serine/threonine-protein kinase CHK2; 1e-04
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 1e-04
1pn0_A665 Phenol 2-monooxygenase; two dimers, TLS refinement 1e-04
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 2e-04
3utf_A513 UDP-galactopyranose mutase; nucleotide binding, fl 2e-04
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 2e-04
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 3e-04
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 3e-04
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 3e-04
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 4e-04
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 8e-04
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Length = 407 Back     alignment and structure
 Score =  388 bits (998), Expect = e-129
 Identities = 103/377 (27%), Positives = 160/377 (42%), Gaps = 20/377 (5%)

Query: 64  AESPTNNSDSENKKLRILVAGGGIGGLVFALAAKRKGFEVLVFEKDMSAIRGEGQYRGPI 123
               +  +      ++ +V G GIGGL  A+A K+ G +  V+E     I+  G     I
Sbjct: 10  HHHSSGENLYFQGHMKAIVIGAGIGGLSAAVALKQSGIDCDVYEAV-KEIKPVG---AAI 65

Query: 124 QIQSNALAALEAIDLDVAEEVMRAGCVTGDRINGLVDGISGSWYIKFDTFTPAAEKGLPV 183
            +  N +  +    L + + +   G     R     D  SG    +F    P  E+    
Sbjct: 66  SVWPNGVKCMAH--LGMGDIMETFGGPL--RRMAYRDFRSGENMTQFS-LAPLIERTGSR 120

Query: 184 TRVISRMTLQQILAKAVGDEIILNESNVIDFKDHGDKVSVVLENGQCYAGDLLIGADGIW 243
              +SR  LQ+ +    G + +     V   ++  D V+V   +G   +GDLLI ADG  
Sbjct: 121 PCPVSRAELQREMLDYWGRDSVQFGKRVTRCEEDADGVTVWFTDGSSASGDLLIAADGSH 180

Query: 244 SKVRKNLFGPQ-EAIYSGYTCYTGIADFVPADIESVGYRVFLGHKQYFVSSDVGAGKMQW 302
           S +R  + G   +  Y+GY  + G+ +   A      +  F+G  +      V AG+  +
Sbjct: 181 SALRPWVLGFTPQRRYAGYVNWNGLVEIDEALAPGDQWTTFVGEGKQVSLMPVSAGRFYF 240

Query: 303 YAFHKEPAGGVDGPEGKKERLLKIFEGWCDNVVDLILATDEEAILRRDIYDRTPIFTWGR 362
           +     PAG  +  +  +  L + F GW   V  LI A D +   R +I+D  P     R
Sbjct: 241 FFDVPLPAGLAEDRDTLRADLSRYFAGWAPPVQKLIAALDPQTTNRIEIHDIEPFSRLVR 300

Query: 363 GRVTLLGDSVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSALKSYER 422
           GRV LLGD+ H+  P++GQGGC A+ED   L     +            DI +AL+ YE 
Sbjct: 301 GRVALLGDAGHSTTPDIGQGGCAAMEDAVVLGAVFRQT----------RDIAAALREYEA 350

Query: 423 ARRLRVAVIHGLARSAA 439
            R  RV  +   AR   
Sbjct: 351 QRCDRVRDLVLKARKRC 367
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Length = 398 Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Length = 379 Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Length = 397 Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Length = 410 Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Length = 381 Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Length = 399 Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Length = 430 Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Length = 394 Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Length = 591 Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Length = 421 Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Length = 549 Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Length = 512 Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Length = 453 Back     alignment and structure
>3va4_A Mediator of DNA damage checkpoint protein 1; cell cycle, FHA domain, DNA-damage, CHK2 and MDC1 dimerizati; HET: TPO; 1.54A {Mus musculus} PDB: 3va1_A* 3umz_A 3unm_A 3unn_A* 3uot_A* 3un0_B Length = 132 Back     alignment and structure
>2jpe_A Nuclear inhibitor of protein phosphatase 1; FHA domain, NIPP1, mRNA splicing, transcription; NMR {Mus musculus} Length = 140 Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Length = 535 Back     alignment and structure
>3els_A PRE-mRNA leakage protein 1; intrinsically unstructured domain, forkhead-associated domai domain, PRE-mRNA retention and splicing; 1.80A {Saccharomyces cerevisiae} Length = 158 Back     alignment and structure
>1uht_A Expressed protein; FHA domain, beta-sandwich, antiparallel beta-sheets, phosphopeptide binding motif, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.26.1.2 Length = 118 Back     alignment and structure
>3elv_A PRE-mRNA leakage protein 1; intrinsically unstructured domain, forkhead-associated domai domain, PRE-mRNA retention and splicing; 2.40A {Saccharomyces cerevisiae} PDB: 2jkd_A Length = 205 Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Length = 570 Back     alignment and structure
>2pie_A E3 ubiquitin-protein ligase RNF8; FHA domain, complex, ligase, signaling protein; HET: TPO; 1.35A {Homo sapiens} SCOP: b.26.1.2 Length = 138 Back     alignment and structure
>3gqs_A Adenylate cyclase-like protein; FHA domain, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.20A {Chlamydia trachomatis} Length = 106 Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Length = 499 Back     alignment and structure
>1r21_A Antigen KI-67; beta sandwich, cell cycle; NMR {Homo sapiens} SCOP: b.26.1.2 PDB: 2aff_A* Length = 128 Back     alignment and structure
>2xt9_B Putative signal transduction protein GARA; lyase-signaling protein complex, KDH, KGD; HET: TPP; 2.20A {Mycobacterium smegmatis} Length = 115 Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Length = 500 Back     alignment and structure
>2kb3_A Oxoglutarate dehydrogenase inhibitor; forkhead-associated domain, kinase substrate, GARA, FHA, cytoplasm, phosphoprotein; HET: TPO; NMR {Corynebacterium glutamicum} PDB: 2kb4_A Length = 143 Back     alignment and structure
>2csw_A Ubiquitin ligase protein RNF8; 11-stranded beta sandwich, ring finger protein 8, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.26.1.2 Length = 145 Back     alignment and structure
>2kfu_A RV1827 PThr 22; FHA domain, phosphorylation, intramolecular interaction, glutamate metabolism, phosphoprotein, protein binding; HET: TPO; NMR {Mycobacterium tuberculosis} PDB: 2kkl_A Length = 162 Back     alignment and structure
>3po8_A RV0020C protein, putative uncharacterized protein TB39.8; FHA domain, synthetic peptide, peptide binding protein; 1.50A {Mycobacterium tuberculosis} PDB: 3poa_A* 2lc1_A Length = 100 Back     alignment and structure
>1g6g_A Protein kinase RAD53; beta-sandwich, phosphopeptide complex, cell cycle; HET: TPO; 1.60A {Saccharomyces cerevisiae} SCOP: b.26.1.2 Length = 127 Back     alignment and structure
>1g3g_A Protien kinase SPK1; FHA domain, RAD53, phosphopeptide, phosphoprotein, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 PDB: 1j4o_A 1j4p_A* 1j4q_A* 1k3j_A 1k3n_A* 1k3q_A* 2a0t_A* 2jqi_A* Length = 164 Back     alignment and structure
>3oun_A Putative uncharacterized protein TB39.8; peptidoglycan, Ser/Thr kinase, pseudokinase, FHA domain, REG phosphorylation; HET: TPO; 2.71A {Mycobacterium tuberculosis} Length = 157 Back     alignment and structure
>2jqj_A DNA damage response protein kinase DUN1; protein/phosphopeptide, cell cycle; HET: DNA; NMR {Saccharomyces cerevisiae} PDB: 2jql_A* Length = 151 Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Length = 639 Back     alignment and structure
>3hx1_A SLR1951 protein; P74513_SYNY3, adenylate cyclase-like protein, NESG, structural genomics, PSI-2, protein structure initiative; 2.50A {Synechocystis SP} Length = 131 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Length = 397 Back     alignment and structure
>1lgp_A Cell cycle checkpoint protein CHFR; FHA, tungstate, domain swapping; 2.00A {Homo sapiens} SCOP: b.26.1.2 PDB: 1lgq_A Length = 116 Back     alignment and structure
>1wln_A Afadin; beta sandwich, FHA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.26.1.2 Length = 120 Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Length = 504 Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Length = 566 Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Length = 571 Back     alignment and structure
>3fm8_A Kinesin-like protein KIF13B; kinesin, GAP, GTPase activation, structural genomics consort ATP-binding, cytoskeleton, microtubule, motor protein, NUCL binding; 2.30A {Homo sapiens} PDB: 3mdb_A* Length = 124 Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Length = 478 Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Length = 421 Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Length = 729 Back     alignment and structure
>1gxc_A CHK2, CDS1, serine/threonine-protein kinase CHK2; phosphoprotein-binding domain, checkpoint kinase, transferase; HET: TPO; 2.7A {Homo sapiens} SCOP: b.26.1.2 Length = 149 Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Length = 384 Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Length = 665 Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Length = 690 Back     alignment and structure
>3utf_A UDP-galactopyranose mutase; nucleotide binding, flavin adenine dinucleotide BIND isomerase; HET: FDA; 2.25A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Length = 513 Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Length = 671 Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Length = 510 Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Length = 572 Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Length = 399 Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Length = 367 Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Length = 475 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query678
3ihg_A535 RDME; flavoenzyme, anthracycline, polyketide biosy 100.0
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 100.0
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 100.0
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 100.0
2r0c_A549 REBC; flavin adenine dinucleotide, monooxygenase, 100.0
3fmw_A570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 100.0
1pn0_A665 Phenol 2-monooxygenase; two dimers, TLS refinement 100.0
4hb9_A412 Similarities with probable monooxygenase; flavin, 100.0
2dkh_A639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 100.0
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 100.0
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 100.0
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 100.0
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 100.0
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 100.0
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 100.0
3i3l_A591 Alkylhalidase CMLS; flavin-dependent halogenase, c 100.0
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 100.0
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 100.0
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 99.97
3atr_A453 Conserved archaeal protein; saturating double bond 99.97
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 99.97
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 99.97
2pyx_A526 Tryptophan halogenase; structural genomics, JOI fo 99.96
2gmh_A584 Electron transfer flavoprotein-ubiquinone oxidored 99.95
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 99.94
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 99.94
2aqj_A538 Tryptophan halogenase, pRNA; flavin-dependent halo 99.94
2e4g_A550 Tryptophan halogenase; flavin-binding, rebeccamyci 99.94
2bry_A497 NEDD9 interacting protein with calponin homology a 99.87
4h87_A130 Kanadaptin; FHA domain of PF00498, mRNA processing 99.8
1uht_A118 Expressed protein; FHA domain, beta-sandwich, anti 99.74
3va4_A132 Mediator of DNA damage checkpoint protein 1; cell 99.72
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 99.72
3gqs_A106 Adenylate cyclase-like protein; FHA domain, struct 99.71
2xt9_B115 Putative signal transduction protein GARA; lyase-s 99.71
2pie_A138 E3 ubiquitin-protein ligase RNF8; FHA domain, comp 99.7
3po8_A100 RV0020C protein, putative uncharacterized protein 99.69
3els_A158 PRE-mRNA leakage protein 1; intrinsically unstruct 99.68
2kb3_A143 Oxoglutarate dehydrogenase inhibitor; forkhead-ass 99.68
1mzk_A139 Kinase associated protein phosphatase; beta sandwi 99.68
2jpe_A140 Nuclear inhibitor of protein phosphatase 1; FHA do 99.68
2jqj_A151 DNA damage response protein kinase DUN1; protein/p 99.68
2kfu_A162 RV1827 PThr 22; FHA domain, phosphorylation, intra 99.67
1lgp_A116 Cell cycle checkpoint protein CHFR; FHA, tungstate 99.66
3elv_A205 PRE-mRNA leakage protein 1; intrinsically unstruct 99.66
1r21_A128 Antigen KI-67; beta sandwich, cell cycle; NMR {Hom 99.66
1gxc_A149 CHK2, CDS1, serine/threonine-protein kinase CHK2; 99.66
2csw_A145 Ubiquitin ligase protein RNF8; 11-stranded beta sa 99.65
1dmz_A158 Protein (protein kinase SPK1); beta-sandwich, anti 99.64
3oun_A157 Putative uncharacterized protein TB39.8; peptidogl 99.63
1g3g_A164 Protien kinase SPK1; FHA domain, RAD53, phosphopep 99.62
3hx1_A131 SLR1951 protein; P74513_SYNY3, adenylate cyclase-l 99.62
1wln_A120 Afadin; beta sandwich, FHA domain, structural geno 99.61
1g6g_A127 Protein kinase RAD53; beta-sandwich, phosphopeptid 99.61
1qu5_A182 Protein kinase SPK1; FHA, RAD53, transferase; NMR 99.6
3fm8_A124 Kinesin-like protein KIF13B; kinesin, GAP, GTPase 99.52
4ejq_A154 Kinesin-like protein KIF1A; homodimer, FHA domain, 99.49
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 99.47
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 99.47
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 99.42
3huf_A 325 DNA repair and telomere maintenance protein NBS1; 99.4
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 99.37
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 99.34
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 99.3
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 99.28
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 99.25
4a0e_A123 YSCD, type III secretion protein; transport protei 99.24
3dme_A369 Conserved exported protein; structural genomics, P 99.23
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 99.21
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 99.2
3uv0_A102 Mutator 2, isoform B; FHA, protein binding, dimeri 99.19
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 99.18
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 99.16
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 99.14
3kt9_A102 Aprataxin; FHA domain, beta sandwich, beta sheet, 99.12
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 99.12
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 99.12
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 99.1
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 99.09
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 99.05
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 99.05
3ces_A651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 99.04
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 99.04
2cul_A232 Glucose-inhibited division protein A-related PROT 99.02
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 99.02
3da1_A561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 99.01
2gqf_A401 Hypothetical protein HI0933; structural genomics, 99.0
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 98.98
3cp8_A641 TRNA uridine 5-carboxymethylaminomethyl modificati 98.98
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 98.97
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 98.97
2zxi_A637 TRNA uridine 5-carboxymethylaminomethyl modificat 98.97
2ywl_A180 Thioredoxin reductase related protein; uncharacter 98.97
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 98.96
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 98.95
2brf_A110 Bifunctional polynucleotide phosphatase/kinase; hy 98.95
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 98.94
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 98.89
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 98.88
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 98.87
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 98.87
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 98.86
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 98.86
4egx_A184 Kinesin-like protein KIF1A; FHA domain, transport 98.86
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 98.84
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 98.84
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 98.81
1yj5_C143 5' polynucleotide kinase-3' phosphatase FHA domai; 98.8
1kf6_A602 Fumarate reductase flavoprotein; respiration, fuma 98.79
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 98.79
3i6u_A 419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 98.79
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 98.79
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 98.78
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 98.77
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 98.76
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 98.76
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 98.75
4fk1_A304 Putative thioredoxin reductase; structural genomic 98.75
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 98.74
1ujx_A119 Polynucleotide kinase 3'-phosphatase; DNA repair, 98.74
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 98.74
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 98.73
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 98.72
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 98.71
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 98.71
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 98.69
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 98.68
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 98.67
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 98.67
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 98.61
1chu_A540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 98.61
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 98.61
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 98.6
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 98.6
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 98.58
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 98.58
2h88_A621 Succinate dehydrogenase flavoprotein subunit; comp 98.54
2wdq_A588 Succinate dehydrogenase flavoprotein subunit; succ 98.51
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 98.51
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 98.49
2rgh_A571 Alpha-glycerophosphate oxidase; flavoprotein oxida 98.48
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 98.48
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 98.47
2bs2_A660 Quinol-fumarate reductase flavoprotein subunit A; 98.42
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 98.41
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 98.39
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 98.39
1ojt_A482 Surface protein; redox-active center, glycolysis, 98.36
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 98.36
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 98.34
1wv3_A238 Similar to DNA segregation ATPase and related prot 98.33
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 98.3
4gut_A776 Lysine-specific histone demethylase 1B; histone de 98.29
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 98.25
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 98.25
1jnr_A643 Adenylylsulfate reductase; oxidoreductase; HET: FA 98.22
3gyx_A662 Adenylylsulfate reductase; oxidoreductase; HET: FA 98.2
3r9u_A315 Thioredoxin reductase; structural genomics, center 98.2
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 98.17
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 98.16
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 98.13
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 98.12
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 98.08
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 98.07
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 98.04
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 98.03
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 98.02
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 98.02
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 98.01
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 97.99
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 97.99
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 97.98
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 97.98
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 97.96
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 97.95
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 97.93
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 97.92
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 97.91
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 97.91
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 97.89
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 97.88
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 97.88
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 97.87
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 97.87
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 97.86
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 97.84
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 97.83
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 97.83
3ayj_A721 Pro-enzyme of L-phenylalanine oxidase; amino acid 97.82
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 97.81
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 97.81
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 97.8
1fec_A490 Trypanothione reductase; redox-active center, oxid 97.8
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 97.8
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 97.76
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 97.75
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 97.73
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 97.72
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 97.71
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 97.7
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 97.7
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 97.69
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 97.68
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 97.67
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 97.63
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 97.58
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 97.58
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 97.58
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 97.57
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 97.56
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 97.56
1ojt_A482 Surface protein; redox-active center, glycolysis, 97.55
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.55
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 97.54
4dna_A463 Probable glutathione reductase; structural genomic 97.54
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 97.54
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 97.52
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 97.48
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 97.48
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 97.47
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 97.46
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 97.46
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 97.45
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 97.45
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 97.45
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 97.45
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 97.44
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 97.44
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 97.44
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 97.43
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 97.43
1fec_A490 Trypanothione reductase; redox-active center, oxid 97.43
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 97.43
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 97.42
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 97.41
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 97.41
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 97.41
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 97.41
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 97.41
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 97.41
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 97.39
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 97.39
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 97.39
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 97.38
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 97.37
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 97.37
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 97.37
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 97.36
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 97.35
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 97.35
3pl8_A623 Pyranose 2-oxidase; substrate complex, H167A mutan 97.35
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 97.35
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.34
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 97.31
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 97.3
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 97.29
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 97.29
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 97.27
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.24
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 97.24
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 97.22
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 97.2
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.19
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 97.19
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 97.19
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 97.17
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 97.15
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 97.1
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 97.1
1kdg_A546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 97.09
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 97.09
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 97.09
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 97.08
4dna_A463 Probable glutathione reductase; structural genomic 97.02
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 97.02
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 96.97
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 96.97
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 96.97
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 96.97
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 96.95
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 96.91
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 96.88
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 96.86
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 96.79
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 96.78
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 96.78
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 96.74
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 96.73
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 96.73
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 96.73
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 96.68
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 96.65
3q9t_A577 Choline dehydrogenase and related flavoproteins; g 96.64
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 96.63
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 96.57
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 96.52
3qvp_A583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 96.44
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 96.43
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 96.38
1gpe_A587 Protein (glucose oxidase); oxidoreductase(flavopro 96.31
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 96.27
3fim_B566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 96.18
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 96.14
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 96.14
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 96.13
3r9u_A315 Thioredoxin reductase; structural genomics, center 96.12
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 96.12
2jbv_A546 Choline oxidase; alcohol oxidation, flavoenyzme ox 96.08
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 95.95
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 95.9
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 95.86
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 95.83
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 95.75
1vg0_A650 RAB proteins geranylgeranyltransferase component A 95.74
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 95.71
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 95.6
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 95.59
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 95.56
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 95.55
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 95.54
1lss_A140 TRK system potassium uptake protein TRKA homolog; 95.53
1id1_A153 Putative potassium channel protein; RCK domain, E. 95.45
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 95.13
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 95.13
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 95.03
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 94.54
3c85_A183 Putative glutathione-regulated potassium-efflux S 94.54
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 94.54
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 94.34
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 94.21
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 94.11
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 94.1
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 94.05
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 94.05
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 93.99
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 93.97
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 93.94
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 93.92
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 93.87
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 93.72
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 93.58
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 93.48
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 93.12
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 93.11
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 92.97
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 92.96
3tl2_A315 Malate dehydrogenase; center for structural genomi 92.85
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 92.65
2gag_A965 Heterotetrameric sarcosine oxidase alpha-subunit; 92.57
2y0c_A478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 92.53
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 92.51
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 92.5
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 92.49
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 92.48
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 92.48
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 92.44
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 92.37
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 92.33
3vtf_A444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 92.32
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 92.31
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 92.19
4g65_A461 TRK system potassium uptake protein TRKA; structur 92.19
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 92.16
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 92.12
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 92.04
2x5o_A439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 92.01
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 91.93
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 91.83
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 91.75
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 91.71
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 91.66
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 91.6
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 91.57
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 91.53
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 91.41
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 91.4
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 91.29
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 91.23
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 91.23
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 91.19
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 91.17
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 91.15
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 91.05
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 91.02
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 90.96
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 90.96
3pid_A432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 90.9
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 90.87
3qha_A296 Putative oxidoreductase; seattle structural genomi 90.79
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 90.75
1mv8_A436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 90.66
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 90.63
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 90.57
3mog_A483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 90.53
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 90.5
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 90.45
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 90.43
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 90.36
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 90.28
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 90.28
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 90.27
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 90.22
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 90.2
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 90.14
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 90.0
1oju_A294 MDH, malate dehydrogenase; hyperthermophilic, oxid 89.91
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 89.8
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 89.79
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 89.77
3dfu_A232 Uncharacterized protein from 6-phosphogluconate de 89.73
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 89.73
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 89.64
3l6d_A306 Putative oxidoreductase; structural genomics, prot 89.56
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 89.45
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 89.43
2zyd_A480 6-phosphogluconate dehydrogenase, decarboxylating; 89.38
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 89.29
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 89.24
3ldh_A330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 89.24
2q3e_A467 UDP-glucose 6-dehydrogenase; hexamer, structural g 89.13
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 89.07
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 89.05
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 89.05
1vpd_A299 Tartronate semialdehyde reductase; structural geno 88.96
3ius_A286 Uncharacterized conserved protein; APC63810, silic 88.92
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 88.86
4ezb_A317 Uncharacterized conserved protein; structural geno 88.8
1dlj_A402 UDP-glucose dehydrogenase; rossmann fold, ternary 88.76
2o3j_A481 UDP-glucose 6-dehydrogenase; structural genomics, 88.75
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 88.74
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 88.66
1x0v_A354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 88.65
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 88.61
3tri_A280 Pyrroline-5-carboxylate reductase; amino acid bios 88.61
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 88.6
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 88.55
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 88.45
4gwg_A484 6-phosphogluconate dehydrogenase, decarboxylating; 88.36
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 88.35
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 88.3
2izz_A322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 88.24
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 88.12
2i6t_A303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 88.02
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 87.95
3ktd_A341 Prephenate dehydrogenase; structural genomics, joi 87.93
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 87.91
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 87.87
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 87.86
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 87.82
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 87.81
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 87.78
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 87.74
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 87.71
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 87.62
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 87.43
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 87.29
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 87.28
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 87.12
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 87.05
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 86.97
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 86.85
2iz1_A474 6-phosphogluconate dehydrogenase, decarboxylating; 86.83
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 86.63
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 86.58
2wtb_A725 MFP2, fatty acid multifunctional protein (ATMFP2); 86.58
2p4q_A497 6-phosphogluconate dehydrogenase, decarboxylating; 86.53
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 86.53
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 86.52
1pjq_A457 CYSG, siroheme synthase; rossman fold, nucleotide 86.49
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 86.46
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 86.45
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 86.34
3ojo_A431 CAP5O; rossmann fold, complex with cofactor NAD an 86.33
2pgd_A482 6-phosphogluconate dehydrogenase; oxidoreductase ( 86.19
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 86.18
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 86.17
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 86.15
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 86.09
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 86.09
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 85.82
1pgj_A478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 85.7
3c7a_A404 Octopine dehydrogenase; L) stereospecific opine de 85.52
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 85.51
4ffl_A363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 85.49
2rir_A300 Dipicolinate synthase, A chain; structural genomic 85.41
1wdk_A715 Fatty oxidation complex alpha subunit; alpha2BETA2 85.4
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 85.26
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 85.24
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 85.24
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 85.24
4e4t_A419 Phosphoribosylaminoimidazole carboxylase, ATPase; 85.22
1np3_A338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 85.21
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 85.21
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 85.13
2zqz_A326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 85.01
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 85.01
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 85.01
2we8_A386 Xanthine dehydrogenase; oxidoreductase; 2.30A {Myc 84.8
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 84.72
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 84.7
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
Probab=100.00  E-value=7.4e-44  Score=400.04  Aligned_cols=424  Identities=20%  Similarity=0.200  Sum_probs=266.1

Q ss_pred             CCCeEEEECCCHHHHHHHHHHHHcCCcEEEEecccccccCCcccccceeeChhHHHHHHhcChhHHHHHHHhccccccce
Q 005770           76 KKLRILVAGGGIGGLVFALAAKRKGFEVLVFEKDMSAIRGEGQYRGPIQIQSNALAALEAIDLDVAEEVMRAGCVTGDRI  155 (678)
Q Consensus        76 ~~~~v~ivG~G~~G~~~a~~l~~~g~~~~~~e~~~~~~~~~g~~~~~~~l~~~~~~~L~~l~~gl~~~~~~~~~~~~~~~  155 (678)
                      .++||+||||||+||++|+.|+++|++|+||||.+.....    ..+..++++++++|+++  |+++++.+.+.......
T Consensus         4 ~~~dVlIVGaG~aGl~~A~~La~~G~~v~viEr~~~~~~~----~~~~~l~~~~~~~l~~l--Gl~~~~~~~~~~~~~~~   77 (535)
T 3ihg_A            4 HEVDVLVVGAGLGGLSTAMFLARQGVRVLVVERRPGLSPY----PRAAGQNPRTMELLRIG--GVADEVVRADDIRGTQG   77 (535)
T ss_dssp             CSEEEEEECCSHHHHHHHHHHHTTTCCEEEECSSSSCCCC----CCSCCBCHHHHHHHHHT--TCHHHHHHSCCSSCTTS
T ss_pred             ccCcEEEECcCHHHHHHHHHHHHCCCCEEEEeCCCCCCCC----CccceECHHHHHHHHHc--CCHHHHHhhCCCccccc
Confidence            4689999999999999999999999999999998654322    22567999999999999  89999988765332211


Q ss_pred             e-e--eeecCCCceee----eccCCCcccccCCCe-EEEeCHHHHHHHHHHhcC--CceEEeCCeEEEEEEeCC----eE
Q 005770          156 N-G--LVDGISGSWYI----KFDTFTPAAEKGLPV-TRVISRMTLQQILAKAVG--DEIILNESNVIDFKDHGD----KV  221 (678)
Q Consensus       156 ~-~--~~~~~~~~~~~----~~~~~~~~~~~~~~~-~~~i~r~~l~~~L~~~~~--~~~i~~~~~v~~~~~~~~----~v  221 (678)
                      . .  ......+....    .++..........|. .+.++|..|++.|.+.+.  +..++++++|++++++++    +|
T Consensus        78 ~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~l~~~L~~~a~~~gv~i~~~~~v~~i~~~~~~~~~~v  157 (535)
T 3ihg_A           78 DFVIRLAESVRGEILRTVSESFDDMVAATEPCTPAGWAMLSQDKLEPILLAQARKHGGAIRFGTRLLSFRQHDDDAGAGV  157 (535)
T ss_dssp             CCEEEEESSSSSCEEEEEESCHHHHHHTTGGGCSCCCBCCCHHHHHHHHHHHHHHTTCEEESSCEEEEEEEECGGGCSEE
T ss_pred             ceeeeEEeccCCceeeeccccccccccccccCCCCcccccCHHHHHHHHHHHHHhCCCEEEeCCEEEEEEECCCCccccE
Confidence            0 0  11122222222    111000000011121 468899999999999873  356999999999999998    99


Q ss_pred             EEEEcCC---cEEeccEEEEecCCCchhhhhhc-CCCCccccccEEEEEEecCCCCCc-CC-cceEEEecCceEEEEeeC
Q 005770          222 SVVLENG---QCYAGDLLIGADGIWSKVRKNLF-GPQEAIYSGYTCYTGIADFVPADI-ES-VGYRVFLGHKQYFVSSDV  295 (678)
Q Consensus       222 ~v~~~dg---~~i~a~~vVgADG~~S~VR~~l~-~~~~~~~~~~~~~~~~~~~~~~~~-~~-~~~~~~~~~~~~~~~~~~  295 (678)
                      ++++.++   .+++||+||+|||++|.||+.++ ......+.+......+....+... .. ..+..+..++...++++.
T Consensus       158 ~v~~~~~~~~~~i~a~~vV~AdG~~S~vR~~lgi~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~p~  237 (535)
T 3ihg_A          158 TARLAGPDGEYDLRAGYLVGADGNRSLVRESLGIGRYGHGTLTHMVGVIFDADLSGIMEPGTTGWYYLHHPEFKGTFGPT  237 (535)
T ss_dssp             EEEEEETTEEEEEEEEEEEECCCTTCHHHHHTTCCEEEEEEEEEEEEEEEECCGGGTSCTTCCEEEEEECSSCEEEEEEC
T ss_pred             EEEEEcCCCeEEEEeCEEEECCCCcchHHHHcCCCcCCCCccceEEEEEEeccChhhccCCceEEEEEECCCceEEEEEe
Confidence            9999886   68999999999999999999983 333333332221111111111111 11 122333444444444555


Q ss_pred             CCCeEEEEEEEeCCC-CCCCCcchhHHHHHHHhccCChhHHHHHHcC----ChhhhhhcccccCCCCccccCCcEEEEcc
Q 005770          296 GAGKMQWYAFHKEPA-GGVDGPEGKKERLLKIFEGWCDNVVDLILAT----DEEAILRRDIYDRTPIFTWGRGRVTLLGD  370 (678)
Q Consensus       296 ~~~~~~w~~~~~~~~-~~~~~~~~~~~~l~~~~~~~~~~~~~~l~~~----~~~~~~~~~~~~~~~~~~~~~grv~LvGD  370 (678)
                      .+.. .|.+....+. ..........+.+.+.+..       .+...    .......|.+. ...+.+|..|||+|+||
T Consensus       238 ~~~~-~~~~~~~~~~~~~~~~~~~~~e~~~~~l~~-------~~~~~~~~~~~~~~~~~~~~-~~~a~~~~~grv~LvGD  308 (535)
T 3ihg_A          238 DRPD-RHTLFVEYDPDEGERPEDFTPQRCVELIGL-------ALDAPEVKPELVDIQGWEMA-ARIAERWREGRVFLAGD  308 (535)
T ss_dssp             SSTT-EEEEEEEECTTTTCCGGGCCHHHHHHHHHH-------HHTCSSCCCEEEEEEEEEEE-EEEESCSEETTEEECTT
T ss_pred             cCCC-EEEEEEeeCccccCccccCCHHHHHHHHHH-------HhCCCCCceeEEEeeEeeee-EEEECccccCCEEEEec
Confidence            5433 2333322221 1111112223333332221       11100    00111122222 23456899999999999


Q ss_pred             ccCCCCCCCcchhhHHHHHHHHHHHHHHHHhhccCCCCChhhHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHhHhhhhhc
Q 005770          371 SVHAMQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSALKSYERARRLRVAVIHGLARSAAVMASTYKAYLG  450 (678)
Q Consensus       371 AAH~~~P~~GqG~n~gl~Da~~La~~L~~~~~~~~~~~~~~~~~~~L~~Ye~eRr~~~~~~~~~~~~~~~~~~~~~~~~~  450 (678)
                      |||.|+|++|||||+||+||.+|+|+|+.++++.+       .+.+|++|+++|++++..++.++..........     
T Consensus       309 AAH~~~P~~GqG~n~ai~DA~~La~~La~~l~g~~-------~~~lL~~Ye~eR~p~a~~~~~~s~~~~~~~~~~-----  376 (535)
T 3ihg_A          309 AAKVTPPTGGMSGNAAVADGFDLAWKLAAVLQGQA-------GAGLLDTYEDERKVAAELVVAEALAIYAQRMAP-----  376 (535)
T ss_dssp             TTEECCSTTSCHHHHHHHHHHHHHHHHHHHHTTSS-------CTTHHHHHHHHHHHHHHHHHHHHHHHHHHHTCG-----
T ss_pred             ccccCCCccCCccccccccHHHHHHHHHHHhcCCC-------cHHHHHhhHHHHHHHHHHHHHHHHHhhHhhccc-----
Confidence            99999999999999999999999999999987642       267899999999999999988775432111000     


Q ss_pred             CCCCcccccccccccCCCCcchhhHHhhhhhhhhHhhhccccccceeeecccccccccCCCCCCccccCcccch-hhhhh
Q 005770          451 VGLGPLSFLTKFRIPHPGRVGGRFFIDLAMPLMLSWVLGGNSIGQLVISYDHICISSKLEGRSPCCKLSDKASD-NLRTW  529 (678)
Q Consensus       451 ~~~~~~~~~r~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~y~~~~~i~~~~s~~~~~~~~~~~~~~~~~~pG~-~p~~~  529 (678)
                       +     .... .            .+  .-...+..+||+|.+++++..+..+ .    ..........+||+ +||+|
T Consensus       377 -~-----~~~~-~------------~~--~~~~~~~~~~~~y~~~~~~~~~~~~-~----~~~~~~~~~~~pG~r~p~~~  430 (535)
T 3ihg_A          377 -H-----MAEV-W------------DK--SVGYPETLLGFRYRSSAVLATDDDP-A----RVENPLTPSGRPGFRGPHVL  430 (535)
T ss_dssp             -G-----GTTT-S------------CC--CCCHHHHHTSBCCCSTTCCCSCCCC-C----SBCCTTSCCCCTTSBCCCCE
T ss_pred             -c-----cCcc-c------------cc--ccccceeeeCcccCCCceecCCCCC-C----cccccCCCCCCCCCcCCCce
Confidence             0     0000 0            00  0112456689999999998665221 0    00011223348999 99999


Q ss_pred             h-cCC--hhhhHhcCCceEEEecCCC
Q 005770          530 F-RDD--DALERAMNGEWFLVPSGSE  552 (678)
Q Consensus       530 ~-~~g--~~~~~~~~~~~~Ll~~~~~  552 (678)
                      | .+|  .+++|+++.+|+||.+.+.
T Consensus       431 l~~~~~~~~~~dl~g~~f~ll~~~~~  456 (535)
T 3ihg_A          431 VSRHGERLSTVDLFGDGWTLLAGELG  456 (535)
T ss_dssp             EEETTEEEEGGGGCSSSEEEEECTTC
T ss_pred             eecCCceeeHHHhcCCceEEEecCCc
Confidence            9 566  5999999999999997543
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>4h87_A Kanadaptin; FHA domain of PF00498, mRNA processing, nucleus, structural joint center for structural genomics, JCSG, protein structu initiative; HET: SO4; 1.55A {Homo sapiens} Back     alignment and structure
>1uht_A Expressed protein; FHA domain, beta-sandwich, antiparallel beta-sheets, phosphopeptide binding motif, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.26.1.2 Back     alignment and structure
>3va4_A Mediator of DNA damage checkpoint protein 1; cell cycle, FHA domain, DNA-damage, CHK2 and MDC1 dimerizati; HET: TPO; 1.54A {Mus musculus} PDB: 3va1_A* 3umz_A 3unm_A 3unn_A* 3uot_A* 3un0_B Back     alignment and structure
>3gqs_A Adenylate cyclase-like protein; FHA domain, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.20A {Chlamydia trachomatis} Back     alignment and structure
>2xt9_B Putative signal transduction protein GARA; lyase-signaling protein complex, KDH, KGD; HET: TPP; 2.20A {Mycobacterium smegmatis} Back     alignment and structure
>2pie_A E3 ubiquitin-protein ligase RNF8; FHA domain, complex, ligase, signaling protein; HET: TPO; 1.35A {Homo sapiens} SCOP: b.26.1.2 Back     alignment and structure
>3po8_A RV0020C protein, putative uncharacterized protein TB39.8; FHA domain, synthetic peptide, peptide binding protein; 1.50A {Mycobacterium tuberculosis} SCOP: b.26.1.0 PDB: 3poa_A* 2lc1_A Back     alignment and structure
>3els_A PRE-mRNA leakage protein 1; intrinsically unstructured domain, forkhead-associated domai domain, PRE-mRNA retention and splicing; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2kb3_A Oxoglutarate dehydrogenase inhibitor; forkhead-associated domain, kinase substrate, GARA, FHA, cytoplasm, phosphoprotein; HET: TPO; NMR {Corynebacterium glutamicum} PDB: 2kb4_A Back     alignment and structure
>2jpe_A Nuclear inhibitor of protein phosphatase 1; FHA domain, NIPP1, mRNA splicing, transcription; NMR {Mus musculus} Back     alignment and structure
>2jqj_A DNA damage response protein kinase DUN1; protein/phosphopeptide, cell cycle; HET: DNA; NMR {Saccharomyces cerevisiae} PDB: 2jql_A* Back     alignment and structure
>2kfu_A RV1827 PThr 22; FHA domain, phosphorylation, intramolecular interaction, glutamate metabolism, phosphoprotein, protein binding; HET: TPO; NMR {Mycobacterium tuberculosis} PDB: 2kkl_A Back     alignment and structure
>1lgp_A Cell cycle checkpoint protein CHFR; FHA, tungstate, domain swapping; 2.00A {Homo sapiens} SCOP: b.26.1.2 PDB: 1lgq_A Back     alignment and structure
>3elv_A PRE-mRNA leakage protein 1; intrinsically unstructured domain, forkhead-associated domai domain, PRE-mRNA retention and splicing; 2.40A {Saccharomyces cerevisiae} PDB: 2jkd_A Back     alignment and structure
>1r21_A Antigen KI-67; beta sandwich, cell cycle; NMR {Homo sapiens} SCOP: b.26.1.2 PDB: 2aff_A* Back     alignment and structure
>1gxc_A CHK2, CDS1, serine/threonine-protein kinase CHK2; phosphoprotein-binding domain, checkpoint kinase, transferase; HET: TPO; 2.7A {Homo sapiens} SCOP: b.26.1.2 Back     alignment and structure
>2csw_A Ubiquitin ligase protein RNF8; 11-stranded beta sandwich, ring finger protein 8, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.26.1.2 Back     alignment and structure
>1dmz_A Protein (protein kinase SPK1); beta-sandwich, antiparallel beta-sheets, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 PDB: 1fhq_A 1fhr_A* 1j4k_A* 1j4l_A* 1k2m_A* 1k2n_A* Back     alignment and structure
>3oun_A Putative uncharacterized protein TB39.8; peptidoglycan, Ser/Thr kinase, pseudokinase, FHA domain, REG phosphorylation; HET: TPO; 2.71A {Mycobacterium tuberculosis} Back     alignment and structure
>1g3g_A Protien kinase SPK1; FHA domain, RAD53, phosphopeptide, phosphoprotein, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 PDB: 1j4o_A 1j4p_A* 1j4q_A* 1k3j_A 1k3n_A* 1k3q_A* 2a0t_A* 2jqi_A* Back     alignment and structure
>3hx1_A SLR1951 protein; P74513_SYNY3, adenylate cyclase-like protein, NESG, structural genomics, PSI-2, protein structure initiative; 2.50A {Synechocystis SP} Back     alignment and structure
>1wln_A Afadin; beta sandwich, FHA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.26.1.2 Back     alignment and structure
>1g6g_A Protein kinase RAD53; beta-sandwich, phosphopeptide complex, cell cycle; HET: TPO; 1.60A {Saccharomyces cerevisiae} SCOP: b.26.1.2 Back     alignment and structure
>1qu5_A Protein kinase SPK1; FHA, RAD53, transferase; NMR {Saccharomyces cerevisiae} SCOP: b.26.1.2 Back     alignment and structure
>3fm8_A Kinesin-like protein KIF13B; kinesin, GAP, GTPase activation, structural genomics consort ATP-binding, cytoskeleton, microtubule, motor protein, NUCL binding; 2.30A {Homo sapiens} PDB: 3mdb_A* Back     alignment and structure
>4ejq_A Kinesin-like protein KIF1A; homodimer, FHA domain, transport protein; 1.89A {Homo sapiens} PDB: 2eh0_A 2g1l_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>3huf_A DNA repair and telomere maintenance protein NBS1; NBS1, FHA domain, BRCT domain, phosphoprotein binding, phosp binding, DNA repair; HET: DNA TPO; 2.15A {Schizosaccharomyces pombe} PDB: 3hue_A* 3i0m_A* 3i0n_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>4a0e_A YSCD, type III secretion protein; transport protein, SAD phasing, type III secretion system; 2.04A {Yersinia pestis} PDB: 4d9v_A Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3uv0_A Mutator 2, isoform B; FHA, protein binding, dimerization; 1.90A {Drosophila melanogaster} Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>3kt9_A Aprataxin; FHA domain, beta sandwich, beta sheet, AMP hydrolase, alternative splicing, disease mutation, DNA damage, DNA repair, DNA-binding; 1.65A {Homo sapiens} SCOP: b.26.1.0 Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>2brf_A Bifunctional polynucleotide phosphatase/kinase; hydrolase/transferase, FHA, forkhead-associated, PNKP, PNK, polynucleotide kinase 3' phosphatase; 1.40A {Homo sapiens} SCOP: b.26.1.2 PDB: 2w3o_A* 1yjm_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>4egx_A Kinesin-like protein KIF1A; FHA domain, transport protein; 2.51A {Homo sapiens} Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>1yj5_C 5' polynucleotide kinase-3' phosphatase FHA domai; beta sandwich, P-loop, transferase; 2.80A {Mus musculus} SCOP: b.26.1.2 Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>1ujx_A Polynucleotide kinase 3'-phosphatase; DNA repair, FHA domain, beta-sandwich, antiparallel beta-sheets, phosphopeptide binding motif; NMR {Mus musculus} SCOP: b.26.1.2 Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1wv3_A Similar to DNA segregation ATPase and related proteins; structural genomics, unknown function; 1.75A {Staphylococcus aureus subsp} SCOP: b.26.1.4 b.26.1.4 Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>2we8_A Xanthine dehydrogenase; oxidoreductase; 2.30A {Mycobacterium smegmatis} PDB: 2we7_A Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 678
d1pn0a1360 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {So 3e-19
d1k0ia1292 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydr 1e-16
d3c96a1288 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Ps 2e-15
d3c96a1288 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Ps 1e-07
d2voua1265 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydr 4e-14
d2voua1265 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydr 4e-05
d1uhta_118 b.26.1.2 (A:) FHA domain containing protein At4G14 2e-09
d1mzka_122 b.26.1.2 (A:) Kinase associated protein phosphatas 5e-09
d1dmza_158 b.26.1.2 (A:) Phosphotyrosine binding domain of Ra 6e-07
d1y0pa2308 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 ( 1e-06
d2gqfa1253 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein H 2e-06
d2bi7a1314 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mu 5e-06
d2piea1127 b.26.1.2 (A:13-139) Ubiquitin ligase protein RNF8 5e-06
d1qo8a2317 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 ( 7e-06
d2i0za1251 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {B 9e-06
d2affa198 b.26.1.2 (A:3-100) Antigen ki-67 {Human (Homo sapi 1e-05
d1g6ga_127 b.26.1.2 (A:) Phosphotyrosine binding domain of Ra 2e-05
d2iida1370 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {M 2e-05
d1gxca_116 b.26.1.2 (A:) Chk2 kinase {Human (Homo sapiens) [T 3e-05
d2ivda1347 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen ox 3e-05
d1b5qa1347 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai 5e-05
d2g1la1102 b.26.1.2 (A:498-599) Kinesin-like protein kif1c {H 7e-05
d1seza1373 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen ox 9e-05
d1d5ta1336 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide di 9e-05
d1c0pa1268 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxida 1e-04
d1wlna1107 b.26.1.2 (A:8-114) Afadin {Mouse (Mus musculus) [T 1e-04
d2dw4a2449 c.3.1.2 (A:274-654,A:764-831) Lysine-specific hist 1e-04
d2bs2a2336 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wo 2e-04
d1i8ta1298 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mu 2e-04
d1d4ca2322 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 ( 2e-04
d2v5za1383 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {H 6e-04
d2bcgg1297 c.3.1.3 (G:5-301) Guanine nucleotide dissociation 6e-04
d1w4xa1298 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxy 8e-04
d1neka2330 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase 9e-04
d1v59a1233 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehyd 0.001
d1ryia1276 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO { 0.001
d3lada1229 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehyd 0.002
d1ojta1229 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide deh 0.002
d1vdca1192 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase 0.002
d1lvla1220 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehyd 0.003
d1gesa1217 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase 0.003
d1ebda1223 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehyd 0.003
d3grsa1221 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase 0.004
d2gmha1380 c.3.1.2 (A:4-236,A:336-482) Electron transfer flav 0.004
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Length = 360 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Phenol hydroxylase
species: Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]

 Score = 87.9 bits (216), Expect = 3e-19
 Identities = 48/392 (12%), Positives = 99/392 (25%), Gaps = 64/392 (16%)

Query: 80  ILVAGGGIGGLVFALA-----AKRKGFEVLVFEKDMSAIRGEGQYRGPIQIQSNALAALE 134
           +L+ G G  GL+ A        ++   +V + +K  S     G  +    +Q   L +L+
Sbjct: 10  VLIVGAGPAGLMAARVLSEYVRQKPDLKVRIIDKR-STKVYNG--QA-DGLQCRTLESLK 65

Query: 135 AIDLDVAEEVMRAGCVTGDRINGLVDGISGSWYIKFDTFTPAAEKGLPVTRVISRMTLQQ 194
              L +A++++         I       +G                     V+ +  +++
Sbjct: 66  N--LGLADKILSEANDM-STIALYNPDENGHIRRTDRIPDTLPGISRYHQVVLHQGRIER 122

Query: 195 ILAKAVGDEIILNESNVIDFKDHGDKVSVVLENGQCYAGDLLIGADGIWSKVRKNLFGPQ 254
            +  ++ +                          +    D     D     V   L    
Sbjct: 123 RILDSIAEI------------SDTRIKVERPLIPEKMEIDSSKAEDPEAYPVTMTLRYMS 170

Query: 255 EAIYSGYTCYTGIADFVPADIESVGYRVFLGHKQYFVSSDVGAGKMQWYAFHKEPAGGVD 314
           E   +         +                          G  +       +E A    
Sbjct: 171 EDESTPLQFGHKTEN--------------------------GLFRSNLQTQEEEDANYRL 204

Query: 315 GPEGKKERLLKIFEGWCDNVVDLILATDEEAILRRDIYDRTPIFTWGRGRVTLLGDSVHA 374
               +   +  +   +                    + ++         RV + GD+ H 
Sbjct: 205 PEGKEAGEIETVHCKYVIGCDGGHSWVRRTLGFEMIVTEK----FSKDERVFIAGDACHT 260

Query: 375 MQPNLGQGGCMAIEDGYQLAVELEKACKKSNESKTPIDIVSALKSYERARRLRVAVIHGL 434
             P  GQG   ++ D Y L  +L                   LK+YE  R+     +   
Sbjct: 261 HSPKAGQGMNTSMMDTYNLGWKLGLVLTG-------RAKRDILKTYEEERQPFAQALIDF 313

Query: 435 ARSAAVMASTY---KAYLGVGLGPLSFLTKFR 463
               + + S          +G+    F   F 
Sbjct: 314 DHQFSRLFSGRPAKDVADEMGVSMDVFKEAFV 345
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Length = 292 Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Length = 288 Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Length = 288 Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 265 Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 265 Back     information, alignment and structure
>d1uhta_ b.26.1.2 (A:) FHA domain containing protein At4G14490 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 118 Back     information, alignment and structure
>d1mzka_ b.26.1.2 (A:) Kinase associated protein phosphatase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 122 Back     information, alignment and structure
>d1dmza_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 158 Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 308 Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Length = 253 Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Length = 314 Back     information, alignment and structure
>d2piea1 b.26.1.2 (A:13-139) Ubiquitin ligase protein RNF8 {Human (Homo sapiens) [TaxId: 9606]} Length = 127 Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 317 Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Length = 251 Back     information, alignment and structure
>d2affa1 b.26.1.2 (A:3-100) Antigen ki-67 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1g6ga_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 127 Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Length = 370 Back     information, alignment and structure
>d1gxca_ b.26.1.2 (A:) Chk2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Length = 347 Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 Back     information, alignment and structure
>d2g1la1 b.26.1.2 (A:498-599) Kinesin-like protein kif1c {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 373 Back     information, alignment and structure
>d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Length = 336 Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Length = 268 Back     information, alignment and structure
>d1wlna1 b.26.1.2 (A:8-114) Afadin {Mouse (Mus musculus) [TaxId: 10090]} Length = 107 Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 449 Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 336 Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 298 Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Length = 322 Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 383 Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297 Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Length = 298 Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Length = 330 Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Length = 276 Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 229 Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 229 Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 192 Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 220 Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 217 Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 223 Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 380 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query678
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 99.96
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 99.95
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 99.92
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 99.88
d1uhta_118 FHA domain containing protein At4G14490 {Thale cre 99.75
d1mzka_122 Kinase associated protein phosphatase {Thale cress 99.73
d2ff4a399 Probable regulatory protein EmbR, C-terminal domai 99.72
d2piea1127 Ubiquitin ligase protein RNF8 {Human (Homo sapiens 99.69
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 99.65
d2affa198 Antigen ki-67 {Human (Homo sapiens) [TaxId: 9606]} 99.63
d1g6ga_127 Phosphotyrosine binding domain of Rad53 {Baker's y 99.61
d1gxca_116 Chk2 kinase {Human (Homo sapiens) [TaxId: 9606]} 99.59
d2brfa1101 Polynucleotide kinase 3'-phosphatase {Human (Homo 99.58
d1lgpa_113 Cell cycle checkpoint protein Chfr {Human (Homo sa 99.56
d1wlna1107 Afadin {Mouse (Mus musculus) [TaxId: 10090]} 99.55
d1dmza_158 Phosphotyrosine binding domain of Rad53 {Baker's y 99.49
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 99.46
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 99.45
d2g1la1102 Kinesin-like protein kif1c {Human (Homo sapiens) [ 99.43
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 99.23
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 99.19
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 99.18
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 99.17
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 99.1
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 99.04
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 98.96
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 98.95
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 98.88
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 98.76
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 98.76
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 98.66
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 98.66
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.65
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 98.64
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 98.58
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 98.58
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 98.56
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.55
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 98.53
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 98.52
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 98.52
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 98.51
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 98.5
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 98.49
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 98.48
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.47
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.46
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 98.44
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.41
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 98.4
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.37
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.28
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 98.28
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 98.26
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.23
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.23
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.22
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 98.22
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 98.18
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 98.17
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.17
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 98.15
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.15
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 98.14
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 98.12
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.09
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 98.08
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 98.07
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 98.04
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 98.01
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 98.01
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.0
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 98.0
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 97.98
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 97.96
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 97.95
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 97.93
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 97.93
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 97.93
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 97.87
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 97.84
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 97.81
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 97.76
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 97.71
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 97.68
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 97.68
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 97.67
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 97.64
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 97.56
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 97.56
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 97.43
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 97.43
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 97.39
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 97.39
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 97.21
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 97.1
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 97.07
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 96.96
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 96.93
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 96.81
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 96.66
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 96.61
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 96.38
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 96.28
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 96.22
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 95.69
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 95.59
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 95.47
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 95.36
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 95.34
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 95.24
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 94.87
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 94.82
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 94.8
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 94.72
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 94.63
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 94.59
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 94.56
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 94.5
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 94.42
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 94.41
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 94.19
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 94.14
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 94.11
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 93.92
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 93.81
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 93.54
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 93.44
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 93.42
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 93.28
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 93.18
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 93.14
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 93.1
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 93.09
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 93.08
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 92.98
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 92.86
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 92.62
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 92.44
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 92.42
d1vg0a1491 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 92.37
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 92.22
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 92.0
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 91.85
d2voua2128 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 91.69
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 91.59
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 91.54
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 91.44
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 91.41
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 91.07
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 91.05
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 91.02
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 90.88
d1id1a_153 Rck domain from putative potassium channel Kch {Es 90.59
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 90.18
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 90.09
d3c96a2111 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 90.06
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 90.03
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 90.03
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 90.01
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 89.94
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 89.94
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 89.89
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 89.55
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 89.14
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 88.98
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 88.76
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 88.17
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 88.17
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 87.78
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 87.55
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 86.74
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 86.7
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 86.09
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 86.07
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 85.84
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 85.79
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 85.6
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 85.42
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 85.35
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 85.33
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 84.85
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 84.78
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 83.89
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 83.83
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 83.25
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 83.23
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 82.88
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 82.22
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 82.21
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 82.05
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 81.99
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 81.96
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 81.42
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Monooxygenase PhzS
species: Pseudomonas aeruginosa [TaxId: 287]

Probab=99.96  E-value=8.7e-28  Score=243.84  Aligned_cols=246  Identities=34%  Similarity=0.475  Sum_probs=177.5

Q ss_pred             CCeEEEECCCHHHHHHHHHHHHcCC-cEEEEecccccccCCcccccceeeChhHHHHHHhcChhHHHHHHHhccccccce
Q 005770           77 KLRILVAGGGIGGLVFALAAKRKGF-EVLVFEKDMSAIRGEGQYRGPIQIQSNALAALEAIDLDVAEEVMRAGCVTGDRI  155 (678)
Q Consensus        77 ~~~v~ivG~G~~G~~~a~~l~~~g~-~~~~~e~~~~~~~~~g~~~~~~~l~~~~~~~L~~l~~gl~~~~~~~~~~~~~~~  155 (678)
                      ++||+||||||+||++|+.|+++|+ +|+|+||++.+.. .   ..++.++++++++|+++  ++.+.+.+.+.......
T Consensus         1 ~~~V~IvGaG~aGl~~A~~L~~~Gi~~V~V~Er~~~~~~-~---g~~i~l~~~~~~~l~~~--~~~~~~~~~~~~~~~~~   74 (288)
T d3c96a1           1 PIDILIAGAGIGGLSCALALHQAGIGKVTLLESSSEIRP-L---GVGINIQPAAVEALAEL--GLGPALAATAIPTHELR   74 (288)
T ss_dssp             CCEEEEECCSHHHHHHHHHHHHTTCSEEEEEESSSSCCC-C---SCEEEECHHHHHHHHHT--TCHHHHHHHSEEECEEE
T ss_pred             CCEEEEECcCHHHHHHHHHHHhCCCCeEEEEeCCCCCCC-C---ceEEEECHHHHHHHHHc--CchhhhHhhhcccccce
Confidence            3799999999999999999999997 8999999865432 1   23688999999999999  78888877654322211


Q ss_pred             eeeeecCCCceeeeccCCCcccccCCCeEEEeCHHHHHHHHHHh----cCCceEEeCCeEEEEEEeCCeEEEEEcCC---
Q 005770          156 NGLVDGISGSWYIKFDTFTPAAEKGLPVTRVISRMTLQQILAKA----VGDEIILNESNVIDFKDHGDKVSVVLENG---  228 (678)
Q Consensus       156 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~r~~l~~~L~~~----~~~~~i~~~~~v~~~~~~~~~v~v~~~dg---  228 (678)
                        ..+ ..+.....+.... ......+ .....+......+...    .....+.++++++.+++.++++++++.+|   
T Consensus        75 --~~~-~~g~~~~~~~~~~-~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~v~v~~~~g~~~  149 (288)
T d3c96a1          75 --YID-QSGATVWSEPRGV-EAGNAYP-QYSIHRGELQMILLAAVRERLGQQAVRTGLGVERIEERDGRVLIGARDGHGK  149 (288)
T ss_dssp             --EEC-TTSCEEEEEECGG-GGTCSSC-EEEEEHHHHHHHHHHHHHHHHCTTSEEESEEEEEEEEETTEEEEEEEETTSC
T ss_pred             --eEc-CCCCEEEeccccc-cccccCc-ccccchhhhHHHHHHHHHHhccCeeeecCcEEEEeeecCCcEEEEEEcCCCC
Confidence              122 2233332222111 1111222 3344555444444333    23445888999999999999999999876   


Q ss_pred             -cEEeccEEEEecCCCchhhhhhcCCCCccccccEEEEEEecCCCCCcCCcceEEEecCceEEEEeeCCCCeEEEEEEEe
Q 005770          229 -QCYAGDLLIGADGIWSKVRKNLFGPQEAIYSGYTCYTGIADFVPADIESVGYRVFLGHKQYFVSSDVGAGKMQWYAFHK  307 (678)
Q Consensus       229 -~~i~a~~vVgADG~~S~VR~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~w~~~~~  307 (678)
                       +++++|+||+|||.+|.||+.+.......+.                                                
T Consensus       150 ~~~~~ad~vi~ADG~~S~vr~~~~~~~~~~~~------------------------------------------------  181 (288)
T d3c96a1         150 PQALGADVLVGADGIHSAVRAHLHPDQRPLRD------------------------------------------------  181 (288)
T ss_dssp             EEEEEESEEEECCCTTCHHHHHHCTTCCCCCC------------------------------------------------
T ss_pred             eEEEeeceeeccCCccceeeeeeccccccccc------------------------------------------------
Confidence             4799999999999999999886211000000                                                


Q ss_pred             CCCCCCCCcchhHHHHHHHhccCChhHHHHHHcCChhhhhhcccccCCCCccccCCcEEEEccccCCCCCCCcchhhHHH
Q 005770          308 EPAGGVDGPEGKKERLLKIFEGWCDNVVDLILATDEEAILRRDIYDRTPIFTWGRGRVTLLGDSVHAMQPNLGQGGCMAI  387 (678)
Q Consensus       308 ~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~grv~LvGDAAH~~~P~~GqG~n~gl  387 (678)
                                                                      ....|..++++++|||+|.++|+.|||+|++|
T Consensus       182 ------------------------------------------------~~~~~~~~~~~~~gda~h~~~p~~g~G~~~ai  213 (288)
T d3c96a1         182 ------------------------------------------------PLPHWGRGRITLLGDAAHLMYPMGANGASQAI  213 (288)
T ss_dssp             ------------------------------------------------CCSCCCBTTEEECTHHHHCCCSSTTCTHHHHH
T ss_pred             ------------------------------------------------cccccccCcceecccccceeCCccccchhhhh
Confidence                                                            00125678999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHhhccCCCCChhhHHHHHHHHHHHHhHHHHHHHHHHHHHH
Q 005770          388 EDGYQLAVELEKACKKSNESKTPIDIVSALKSYERARRLRVAVIHGLARSAA  439 (678)
Q Consensus       388 ~Da~~La~~L~~~~~~~~~~~~~~~~~~~L~~Ye~eRr~~~~~~~~~~~~~~  439 (678)
                      +|+..|+++|.+.          .+...+|+.|+++|+|++..++..++...
T Consensus       214 ~d~~~l~~~l~~~----------~~~~~al~~y~~~r~pr~~~~~~~~~~~~  255 (288)
T d3c96a1         214 LDGIELAAALARN----------ADVAAALREYEEARRPTANKIILANRERE  255 (288)
T ss_dssp             HHHHHHHHHHHHC----------SSHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             hhHHHHHHHHhhC----------CCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            9999999999763          24578999999999999999887766433
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1uhta_ b.26.1.2 (A:) FHA domain containing protein At4G14490 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1mzka_ b.26.1.2 (A:) Kinase associated protein phosphatase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ff4a3 b.26.1.2 (A:284-382) Probable regulatory protein EmbR, C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2piea1 b.26.1.2 (A:13-139) Ubiquitin ligase protein RNF8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2affa1 b.26.1.2 (A:3-100) Antigen ki-67 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6ga_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gxca_ b.26.1.2 (A:) Chk2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2brfa1 b.26.1.2 (A:8-108) Polynucleotide kinase 3'-phosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lgpa_ b.26.1.2 (A:) Cell cycle checkpoint protein Chfr {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wlna1 b.26.1.2 (A:8-114) Afadin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dmza_ b.26.1.2 (A:) Phosphotyrosine binding domain of Rad53 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2g1la1 b.26.1.2 (A:498-599) Kinesin-like protein kif1c {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2voua2 d.16.1.2 (A:164-291) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3c96a2 d.16.1.2 (A:183-293) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure