Citrus Sinensis ID: 005813

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670------
MLKPHENLEQFCISGYEGKQFPTWLGDSSFSNLATLNFEDCSVCTTLPSVGQLHSLKHLAVRGMSRVKSLGSEFYGNDSPIPFPCLETLRFENMQEWEDWIPLRTGQGVEWFPKLRELHIIRCSKLQGTFPEHLPALEMLAIEGCEELLVSVASLPALCKFEIGGCKKVVWRSATDHLGSQNSVVCRDTSNQVFFTEPLKPRIPKLEELGINNMKNETHIWKSHNELLQDICSLKRLTIRRCPKIQSLVAEEEKDQQQQLCELSCRLEYLRLSECKGLVKLPQSSLSLSSLREIEICSCHSLVSFPEVALPSKLRKIEIRYCDALKSLPEAWMCDTNSSLEILHIYGCRSLTYIAAVQVPSSLKLLTIWHCDNIRTLTVEEGIQCSSGRRYTSSFLEELHIYCCDSLTCIFSKNELPATLESLEVGNLPPSLKSIRVGGCSKLESIAERLDNNTSLETISIDSCKNLVSFPEGGLPCAKLRTLAISNCKRLEALPKGLHNLTSLQQLTIGIGGALPSLEEEDDLPTNLQSLNIWGNMEIWKSMIERGRGFHRFSSLRRLTISRCDDDMVSFPLEDKRLGTTLPLPASLTSLGISNFPNLERLSSSIVDLQNLTELYLADCPKLKYFPEKGLPSSLLRLYIVGCPLIEEKCRKDGGQYWLETHIPVVLIDWKSVFGD
cccccccccEEEEEccccccccHHcccccccccEEEEEEccccccccccccccccccEEEEEcccccEEEcccccccccccccccccEEEEEccccccccccccccccccccccccEEEEccccccccccccccccccEEEEEccccccccccccccccEEEEcccccEEEcccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccHHHHHHHHHHHccccccccEEEEEcccccccccccccccccccEEEEcccccccccccccccccccEEEEccccccccccccccccccccccEEEEccccccEEEccccccccccEEEEEccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccEEEEEcccccccccccccccccccEEEEccccccccccccccccccccEEEEEcccccccccccccccccccEEEEcccccHHHHHHHccccccccccccEEEEccccccccccccccccccccccccccccEEEEEcccccccHHccccccccccEEEEEccccccccccccccccccEEEccccHHHHHccccccccccccccccEEEEccEEEccc
ccccccccEEEEEEcccccccccccccccccccEEEEEcccccccccccccccccccEEEEcccccEEEccHHHcccccccccccccEEEccccHHHHHcccccccccccccccccEEEEccccHHccccccccccHEEEEccccccccccccccccccEEEEcccccccccccccccccccEEEEcccccccccccccccccccccEEEEcccccHHcccHHcHHHccccccccEEEEcccccHccccccccccHHHHHccccccccEEEEccccccccccccccccccccEEEEcccccccccccccccccccEEEEccccccccccHHHcccccccccEEEEcccccccccccccccccccEEEEccccHHHcccHHHHHHHccccccccccccEEEccccccHHcccHHccccccccccccccccccccEEEEccccccccccccccccccccEEEEccccccccccccccccccccEEEEcccccHccccccccccccccEEEEccccccccccccccccccccEEEEcccHHHcccHHHccccccccccccEEEEccccccccccccHcccccHHccccccccEEEEcccccHHHccHHccccccccEEEEcccccccccccccccccccEEEEcccHHHHHccccccccccccccccEEEEcccEEccc
MLKPHENLEQFCISgyegkqfptwlgdssfsnlatlnfedcsvcttlpsvgqlhslKHLAVRGMSRVkslgsefygndspipfpcletlrfenMQEWedwiplrtgqgvewfpkLRELHIIRCSKlqgtfpehlpALEMLAIEGCEELLVSVASLPalckfeiggckKVVWRSatdhlgsqnsvvcrdtsnqvffteplkpripkleelginnmknETHIWKSHNELLQDICSlkrltirrcpkiqSLVAEEEKDQQQQLCELSCRLEYLRLSEckglvklpqsslslsslreieicschslvsfpevalpsklRKIEIRYCDALKslpeawmcdtnssleiLHIYGCRSLTYIAAvqvpsslklLTIWHcdnirtltveegiqcssgrrytsSFLEELHIYCCdsltcifsknelpatleslevgnlppslksirvggCSKLESIAERldnntsletisidscknlvsfpegglpcaKLRTLAISNCKRLealpkglhnltSLQQltigiggalpsleeeddlptnlqslnIWGNMEIWKSMIERGRGFHRFSSLRRltisrcdddmvsfpledkrlgttlplpasltslgisnfpnlerlsssivdlqnltelyladcpklkyfpekglpssLLRLYIVGcplieekcrkdggqywlethipvvlidwksvfgd
MLKPHENLEQFCISGYEGKQFPTWLGDSSFSNLATLNFEDCSVCTTLPSVGQLHSLKHLAVRGMSRVKSLGsefygndspIPFPCLETLRFENMQEWEDWIPLRTGQGVEWFPKLRELHIIRCSKLQGTFPEHLPALEMLAIEGCEELLVSVASLPALCKFEIGGCKKVVWRSATDhlgsqnsvvcrdtsnqvffteplkpripkleELGINNMKNETHIWKSHNELLQDICSLKRLTIRRCPKIQSLVAEEEKDQQQQLCELSCRLEYLRLSECKGLVKLPQSSLSLSSLREIEICSCHSLVSFPEVALPSKLRKIEIRYCDALKSLPEAWMCDTNSSLEILHIYGCRSLTYIAAVQVPSSLKLLTIWHCDNIRTLtveegiqcssgRRYTSSFLEELHIYCCDSLTCIFSKNELPATLESLEVGNLPPSLKSIRVGGCSKLESIAERldnntsletisIDSCKNLVSFPEGGLPCAKLRTLAISNCKRLEALPKGLHNLTSLQQLTIGIGGALPSLEEEDDLPTNLQSLNIWGNMEIWKSMIERGRGFHRFSSLrrltisrcdddmVSFPLEDKRLGTTLPLPASLTSLGISNFPNLERLSSSIVDLQNLTELYLADCPKLKYFPEKGLPSSLLRLYIVGCPLIEEKCRKDGGQYWLEthipvvlidwksvfgd
MLKPHENLEQFCISGYEGKQFPTWLGDSSFSNLATLNFEDCSVCTTLPSVGQLHSLKHLAVRGMSRVKSLGSEFYGNDSPIPFPCLETLRFENMQEWEDWIPLRTGQGVEWFPKLRELHIIRCSKLQGTFPEHLPALEMLAIEGCEELLVSVASLPALCKFEIGGCKKVVWRSATDHLGSQNSVVCRDTSNQVFFTEPLKPRIPKLEELGINNMKNETHIWKSHNELLQDICSLKRLTIRRCPKIQSLVAEEEKDQQQQLCELSCRLEYLRLSECKGLVKLPQsslslsslREIEICSCHSLVSFPEVALPSKLRKIEIRYCDALKSLPEAWMCDTNSSLEILHIYGCRSLTYIAAVQVPSSLKLLTIWHCDNIRTLTVEEGIQCSSGRRYTSSFLEELHIYCCDSLTCIFSKNELPATLESLEVGNLPPSLKSIRVGGCSKLESIAERLDNNTSLETISIDSCKNLVSFPEGGLPCAKLRTLAISNCKRLEALPKGLHNLTSLQQLTIGIGGALPSLEEEDDLPTNLQSLNIWGNMEIWKSMIERGRGFHRFSSLRRLTISRCDDDMVSFPLEDKRlgttlplpasltslgISNFPNLERLSSSIVDLQNLTELYLADCPKLKYFPEKGLPSSLLRLYIVGCPLIEEKCRKDGGQYWLETHIPVVLIDWKSVFGD
********EQFCISGYEGKQFPTWLGDSSFSNLATLNFEDCSVCTTLPSVGQLHSLKHLAVRGMSRVKSLGSEFYGNDSPIPFPCLETLRFENMQEWEDWIPLRTGQGVEWFPKLRELHIIRCSKLQGTFPEHLPALEMLAIEGCEELLVSVASLPALCKFEIGGCKKVVWRSATDHLGSQNSVVCRDTSNQVFFTEPLKPRIPKLEELGINNMKNETHIWKSHNELLQDICSLKRLTIRRCPKIQSLVA*******QQLCELSCRLEYLRLSECKGLVKLPQSSLSLSSLREIEICSCHSLVSFPEVALPSKLRKIEIRYCDALKSLPEAWMCDTNSSLEILHIYGCRSLTYIAAVQVPSSLKLLTIWHCDNIRTLTVEEGIQCSSGRRYTSSFLEELHIYCCDSLTCIFSKNELPATLESLEVGNLPPSLKSIRVGGCSKLESIAERLDNNTSLETISIDSCKNLVSFPEGGLPCAKLRTLAISNCKRLEALPKGLHNLTSLQQLTIGIGGALPSLE**DDLPTNLQSLNIWGNMEIWKSMIERGRGFHRFSSLRRLTISRCDDDMVSFPLEDKRLGTTLPLPASLTSLGISNFPNLERLSSSIVDLQNLTELYLADCPKLKYFPEKGLPSSLLRLYIVGCPLIEEKCRKDGGQYWLETHIPVVLIDWKSVF**
MLKPHENLEQFCISGYEGKQFPTWLGDSSFSNLATLNFEDCSVCTTLPSVGQLHSLKHLAVRGMSRVKSLGSEFYG*DS**PFPCLETLRFENMQEWEDWIPLRTGQGVEWFPKLRELHIIRCSKLQGTFPEHLPALEMLAIEGCEELLVSVASLPALCKFEIGGCKKVVW***********SVVCRDTSNQVFFTEPLKPRIPKLEELGINNMKNETHIWK**NELLQDICSLKRLTIRRCPKIQSLVAEEEKDQQQQLCELSCRLEYLRLSECKGLVKLPQSSLSLSSLREIEICSCHSLVSFPEVALPSKLRKIEIRYCDALKSLPEAWMCDTNSSLEILHIYGCRSLTYIAAVQVPSSLKLLTIWHCDNIRTLTVEEG****S**RYTSSFLEELHIYCCDSLTCIFSKNELPATLESLEVGNLPPSLKSIRVGGCSKLESIAERLDNNTSLETISIDSCKNLVSFPEGGLPCAKLRTLAISNCKRLEALPKGLHNLTSLQQLTIGIGGALPSLEEEDDLPTNLQSLNIWGNMEIWK********FHRFSSLRRLTISRCDDDMVSFPLEDKRLGTTLPLPASLTSLGISNFPNLERLSSSIVDLQNLTELYLADCPKLKYFPEKGLPSSLLRLYIVGCPLIEEKCRKDGGQYWLETHIPVVLIDWKSVFGD
MLKPHENLEQFCISGYEGKQFPTWLGDSSFSNLATLNFEDCSVCTTLPSVGQLHSLKHLAVRGMSRVKSLGSEFYGNDSPIPFPCLETLRFENMQEWEDWIPLRTGQGVEWFPKLRELHIIRCSKLQGTFPEHLPALEMLAIEGCEELLVSVASLPALCKFEIGGCKKVVWRSATDHLGSQNSVVCRDTSNQVFFTEPLKPRIPKLEELGINNMKNETHIWKSHNELLQDICSLKRLTIRRCPKIQSLVA********QLCELSCRLEYLRLSECKGLVKLPQSSLSLSSLREIEICSCHSLVSFPEVALPSKLRKIEIRYCDALKSLPEAWMCDTNSSLEILHIYGCRSLTYIAAVQVPSSLKLLTIWHCDNIRTLTVEEGIQCSSGRRYTSSFLEELHIYCCDSLTCIFSKNELPATLESLEVGNLPPSLKSIRVGGCSKLESIAERLDNNTSLETISIDSCKNLVSFPEGGLPCAKLRTLAISNCKRLEALPKGLHNLTSLQQLTIGIGGALPSLEEEDDLPTNLQSLNIWGNMEIWKSMIERGRGFHRFSSLRRLTISRCDDDMVSFPLEDKRLGTTLPLPASLTSLGISNFPNLERLSSSIVDLQNLTELYLADCPKLKYFPEKGLPSSLLRLYIVGCPLIEEKCRKDGGQYWLETHIPVVLIDWKSVFGD
*LKPHENLEQFCISGYEGKQFPTWLGDSSFSNLATLNFEDCSVCTTLPSVGQLHSLKHLAVRGMSRVKSLGSEFYGNDSPIPFPCLETLRFENMQEWEDWIPLRTGQGVEWFPKLRELHIIRCSKLQGTFPEHLPALEMLAIEGCEELLVSVASLPALCKFEIGGCKKVVWRSATDHLGSQNSVVCRDTSNQVFFTEPLKPRIPKLEELGINNMKNETHIWKSHNELLQDICSLKRLTIRRCPKIQSLVAEEEKDQQQQLCELSCRLEYLRLSECKGLVKLPQSSLSLSSLREIEICSCHSLVSFPEVALPSKLRKIEIRYCDALKSLPEAWMCDTNSSLEILHIYGCRSLTYIAAVQVPSSLKLLTIWHCDNIRTLTVEEGIQCSSGRRYTSSFLEELHIYCCDSLTCIFSKNELPATLESLEVGNLPPSLKSIRVGGCSKLESIAERLDNNTSLETISIDSCKNLVSFPEGGLPCAKLRTLAISNCKRLEALPKGLHNLTSLQQLTIGIGGALPSLEEEDDLPTNLQSLNIWGNMEIWKSMIERGRGFHRFSSLRRLTISRCDDDMVSFPLEDKRLGTTLPLPASLTSLGISNFPNLERLSSSIVDLQNLTELYLADCPKLKYFPEKGLPSSLLRLYIVGCPLIEEKCRKDGGQYWLETHIPVVLIDWKSVF**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLKPHENLEQFCISGYEGKQFPTWLGDSSFSNLATLNFEDCSVCTTLPSVGQLHSLKHLAVRGMSRVKSLGSEFYGNDSPIPFPCLETLRFENMQEWEDWIPLRTGQGVEWFPKLRELHIIRCSKLQGTFPEHLPALEMLAIEGCEELLVSVASLPALCKFEIGGCKKVVWRSATDHLGSQNSVVCRDTSNQVFFTEPLKPRIPKLEELGINNMKNETHIWKSHNELLQDICSLKRLTIRRCPKIQSLVAEEEKDQQQQLCELSCRLEYLRLSECKGLVKLPQSSLSLSSLREIEICSCHSLVSFPEVALPSKLRKIEIRYCDALKSLPEAWMCDTNSSLEILHIYGCRSLTYIAAVQVPSSLKLLTIWHCDNIRTLTVEEGIQCSSGRRYTSSFLEELHIYCCDSLTCIFSKNELPATLESLEVGNLPPSLKSIRVGGCSKLESIAERLDNNTSLETISIDSCKNLVSFPEGGLPCAKLRTLAISNCKRLEALPKGLHNLTSLQQLTIGIGGALPSLEEEDDLPTNLQSLNIWGNMEIWKSMIERGRGFHRFSSLRRLTISRCDDDMVSFPLEDKRLGTTLPLPASLTSLGISNFPNLERLSSSIVDLQNLTELYLADCPKLKYFPEKGLPSSLLRLYIVGCPLIEEKCRKDGGQYWLETHIPVVLIDWKSVFGD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query676 2.2.26 [Sep-21-2011]
Q9LRR51424 Putative disease resistan yes no 0.918 0.436 0.287 3e-53
Q9LRR41054 Putative disease resistan no no 0.211 0.135 0.42 6e-30
Q7XA39988 Putative disease resistan N/A no 0.371 0.254 0.251 2e-10
O23530 1301 Protein SUPPRESSOR OF npr no no 0.467 0.242 0.255 8e-09
Q7XA40992 Putative disease resistan N/A no 0.402 0.274 0.240 4e-08
Q7XA42979 Putative disease resistan N/A no 0.347 0.240 0.241 3e-07
Q7XBQ9970 Disease resistance protei N/A no 0.239 0.167 0.280 6e-07
P23799630 Putative adenylate cyclas N/A no 0.458 0.492 0.248 4e-06
P26337630 Putative adenylate cyclas N/A no 0.491 0.526 0.223 5e-06
P0CB161201 Putative disease resistan no no 0.844 0.475 0.219 6e-06
>sp|Q9LRR5|DRL21_ARATH Putative disease resistance protein At3g14460 OS=Arabidopsis thaliana GN=At3g14460 PE=3 SV=1 Back     alignment and function desciption
 Score =  210 bits (535), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 205/714 (28%), Positives = 321/714 (44%), Gaps = 93/714 (13%)

Query: 1    MLKPHENLEQFCISGYEGKQFPTWLGDSSFSNLATLNFEDCSVCTTLPSVGQLHSLKHLA 60
            ML+PH +L+ FCI  Y+G  FP WLGDSSF  + ++    C++C +LP VGQL SLK+L+
Sbjct: 754  MLEPHPHLKTFCIESYQGGAFPKWLGDSSFFGITSVTLSSCNLCISLPPVGQLPSLKYLS 813

Query: 61   VRGMSRVKSLGSEFY---GNDSPIPFPCLETLRFENMQEWEDWIPLRTGQGVEWFPKLRE 117
            +   + ++ +G +F+    N   +PF  L+ L+F  M  W++WI      G+  FP L++
Sbjct: 814  IEKFNILQKVGLDFFFGENNSRGVPFQSLQILKFYGMPRWDEWICPELEDGI--FPCLQK 871

Query: 118  LHIIRCSKLQGTFPEHLPALEMLAIEGCEELLV----------------SVASLPALCKF 161
            L I RC  L+  FPE LP+   + I  C    V                S AS+P++ + 
Sbjct: 872  LIIQRCPSLRKKFPEGLPSSTEVTISDCPLRAVSGGENSFRRSLTNIPESPASIPSMSRR 931

Query: 162  EI----GGCKKVVWRSATDHLGSQNSVVCRDTSNQVFFTEPLKPRIPKLEELGI------ 211
            E+    G  K     SA     S +S    D       +    P+  + E+         
Sbjct: 932  ELSSPTGNPKSDASTSAQPGFAS-SSQSNDDNEVTSTSSLSSLPKDRQTEDFDQYETQLG 990

Query: 212  ---NNMKNETHIWKSHNELLQDICS-----LKRLTIRRCPKIQSLVAEEEKDQQQQLCEL 263
                  +    I   ++  + DI S     + R ++   PK +  +       Q     +
Sbjct: 991  SLPQQFEEPAVISARYSGYISDIPSTLSPYMSRTSLVPDPKNEGSILPGSSSYQYHQYGI 1050

Query: 264  SCRLEYLRLSECKGLVKLPQSSLSLSSLREIEICSCHSLVSFPEVALPSKLRKIEIRYCD 323
               +   R SE    +K  Q     + +  +++     L+      LP  L+ + I  CD
Sbjct: 1051 KSSVPSPRSSEA---IKPSQYDDDETDMEYLKVTDISHLME-----LPQNLQSLHIDSCD 1102

Query: 324  ALKSLPEAWMCDTNSSLEILHIYGCRSLTYIAAVQVPSSLKLLTIWHCDNIRTLTVEEGI 383
             L SLPE  + ++  +L  L I  C SL        P++LK L I  C   + L   E +
Sbjct: 1103 GLTSLPEN-LTESYPNLHELLIIACHSLESFPGSHPPTTLKTLYIRDC---KKLNFTESL 1158

Query: 384  QCSSGRRYTSSFLEELHI-YCCDSLTCIFSKNELPATLESLEVGNLPPSLKSIRVGGCSK 442
            Q +  R Y+   LE L I   C +L         P +L         P L+S+ +  C  
Sbjct: 1159 QPT--RSYSQ--LEYLFIGSSCSNLV------NFPLSLF--------PKLRSLSIRDCES 1200

Query: 443  LESI---AERLDNNTSLETISIDSCKNLVSFPEGGLPCAKLRTLAISNCKRLEALPKGLH 499
             ++    A   D+  +LE++ I  C NL +FP+GGLP  KL ++ +SNCK+L+ALP+ L 
Sbjct: 1201 FKTFSIHAGLGDDRIALESLEIRDCPNLETFPQGGLPTPKLSSMLLSNCKKLQALPEKLF 1260

Query: 500  NLTSLQQLTIGIGGALPSLEE--EDDLPTNLQSLNIWGNMEIWKSMIERGR-GFHRFSSL 556
             LTSL  L I      P +E       P+NL++L I     +   +  R   G     +L
Sbjct: 1261 GLTSLLSLFI---IKCPEIETIPGGGFPSNLRTLCI----SLCDKLTPRIEWGLRDLENL 1313

Query: 557  RRLTISRCDDDMVSFPLEDKRLGTTLPLPASLTSLGISNFPNLERLS-SSIVDLQNLTEL 615
            R L I   ++D+ SFP E         LP S+ SL IS F NL+ L+     D + +  +
Sbjct: 1314 RNLEIDGGNEDIESFPEEGL-------LPKSVFSLRISRFENLKTLNRKGFHDTKAIETM 1366

Query: 616  YLADCPKLKYFPEKGLPSSLLRLYIVGCPLIEEKCRKDGGQYWLETHIPVVLID 669
             ++ C KL+   ++ LP  L  L I  C L+ E   +   +++   +IP V ID
Sbjct: 1367 EISGCDKLQISIDEDLP-PLSCLRISSCSLLTETFAEVETEFFKVLNIPYVEID 1419
Potential disease resistance protein.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9LRR4|R13L1_ARATH Putative disease resistance RPP13-like protein 1 OS=Arabidopsis thaliana GN=RPPL1 PE=3 SV=1 Back     alignment and function description
>sp|Q7XA39|RGA4_SOLBU Putative disease resistance protein RGA4 OS=Solanum bulbocastanum GN=RGA4 PE=2 SV=1 Back     alignment and function description
>sp|O23530|SNC1_ARATH Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1 OS=Arabidopsis thaliana GN=SNC1 PE=1 SV=3 Back     alignment and function description
>sp|Q7XA40|RGA3_SOLBU Putative disease resistance protein RGA3 OS=Solanum bulbocastanum GN=RGA3 PE=2 SV=2 Back     alignment and function description
>sp|Q7XA42|RGA1_SOLBU Putative disease resistance protein RGA1 OS=Solanum bulbocastanum GN=RGA1 PE=2 SV=2 Back     alignment and function description
>sp|Q7XBQ9|RGA2_SOLBU Disease resistance protein RGA2 OS=Solanum bulbocastanum GN=RGA2 PE=1 SV=1 Back     alignment and function description
>sp|P23799|ESAG8_TRYBB Putative adenylate cyclase regulatory protein OS=Trypanosoma brucei brucei GN=ESAG8 PE=2 SV=1 Back     alignment and function description
>sp|P26337|ESA8C_TRYEQ Putative adenylate cyclase regulatory protein OS=Trypanosoma equiperdum GN=ESAG8C PE=2 SV=1 Back     alignment and function description
>sp|P0CB16|DRL25_ARATH Putative disease resistance protein At4g19050 OS=Arabidopsis thaliana GN=At4g19050 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query676
400131587 1388 FB_MR5 [Malus x robusta] 0.915 0.445 0.393 1e-103
296085123 1278 unnamed protein product [Vitis vinifera] 0.896 0.474 0.367 5e-95
284026888 1424 CC-NBS-LRR protein [Quercus suber] 0.937 0.445 0.371 1e-91
45826061739 resistance protein [Quercus suber] 0.915 0.837 0.372 2e-90
356554923 1399 PREDICTED: putative disease resistance R 0.889 0.429 0.351 2e-90
359487253 1390 PREDICTED: putative disease resistance p 0.897 0.436 0.349 9e-89
225449649 1418 PREDICTED: putative disease resistance p 0.909 0.433 0.366 2e-85
225450023 1396 PREDICTED: putative disease resistance p 0.877 0.424 0.350 5e-85
147825318 1824 hypothetical protein VITISV_003723 [Viti 0.831 0.308 0.361 5e-82
359487255 1336 PREDICTED: putative disease resistance p 0.823 0.416 0.360 8e-82
>gi|400131587|emb|CCH50986.1| FB_MR5 [Malus x robusta] Back     alignment and taxonomy information
 Score =  382 bits (981), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 270/687 (39%), Positives = 376/687 (54%), Gaps = 68/687 (9%)

Query: 1    MLKPHENLEQFCISGYEGKQFPTWLGDSSFSNLATLNFEDCSVCTTLPSVGQLHSLKHLA 60
            ML+PH  L++  I  Y GK+F +W+G   FSN+  +  E+C+ C +LP +G+L  LK L 
Sbjct: 756  MLQPHTKLKELTIKSYAGKEFSSWVGVPLFSNMVLVRLEECNNCLSLPPLGKLPHLKELY 815

Query: 61   VRGMSRVKSLGSEFYGNDSPIPFPCLETLRFENMQEWEDWIPLRTGQGVEWFPKLRELHI 120
            +RGM+ V+S+G+EFYG +  +PFP LETL F +MQ W+ W+P +T      FP L+ L +
Sbjct: 816  IRGMNAVESVGAEFYG-ECSLPFPLLETLEFVDMQHWKVWLPFQTDHRGSVFPCLKTLLV 874

Query: 121  IRCSKLQGTFPEHLPALEMLAIEGCEELLVSVASLPALCKFEIGGCKKVVWRSATDHLGS 180
             +CSKL+G  PE+L +L  L I  CEELLVS+A+   L +  I GCK VV  +A      
Sbjct: 875  RKCSKLEGKLPENLDSLASLEIVKCEELLVSIANYKQLRQLNIDGCKGVVHTAAKVEFEL 934

Query: 181  QNSVVCRDTSNQVFFT--EPLKPRIPKLEELGINNMKNETHIWKSHNELLQDICSLKRLT 238
              S+   + S        E  +  +  + +L IN  +  T   K+   LLQ + SL RL 
Sbjct: 935  LESLYLSNISELTSLQTGELCRNGLNMVRDLKINGCEELTSSLKNEAILLQQLISLGRLE 994

Query: 239  IRRCPKIQSLVAEE---EKDQQQQLCELSCRLEYLRLSECKGLVKLPQSSLSLSSLREIE 295
            I       SL+ EE   E D+  QL  L C+LE+L+L +CK L+KLP+    LSSL+E+ 
Sbjct: 995  IED----NSLLVEELGKEADELLQLQILGCKLEFLKLKKCKNLLKLPEGLNQLSSLQELR 1050

Query: 296  ICSCHSLVSFPEVALPSKLRKIEIRYCDALKSLPEAWMCDTNSSLEILHIYGCRSLTYIA 355
            I  C SLVSFP+V LP  L+ IEI                            C SL Y A
Sbjct: 1051 IHECSSLVSFPDVGLPPSLKDIEIT--------------------------ECHSLIYFA 1084

Query: 356  AVQVPSSLKLLTIWHCDNIRTLTVEEGI-QCSSGRRYTSSFLEELHIYCCDSLTCIFSKN 414
              Q+P +L+ + I  C ++R+L   E +  CSS    + + LE L+I  C SLT +   +
Sbjct: 1085 KSQIPQNLRRIQIRDCRSLRSLVDNEAVGSCSSS---SHNCLEYLNIERCQSLTLLSLSD 1141

Query: 415  ELPATLESLEVGNLPPSLKSIRVGGCSKLESIAER--LDNNTS--LETISIDSCKNLVSF 470
            +L   L  L++ +            C +LE +A      NNT+  LE   I  C+NL S 
Sbjct: 1142 QLVRALRELDIYD------------CEQLEFLAPDGLFCNNTNYFLENFRIRRCQNLKSL 1189

Query: 471  PE--GGLPCAKLRTLAISNCKRLEALPKGLHNLTSLQQLTIGIGGALPSLEEEDDLPTNL 528
            P   GG+  + LR + I++C RLEALP+ +HN  SL++L I     L         P NL
Sbjct: 1190 PRLSGGIRGSNLREIRITDCDRLEALPEDMHNFNSLEKLIIDYREGLTC-----SFPANL 1244

Query: 529  QSLNIWGNMEIWKSMIERGRGFHRFSSLRRLTISRCDDDMVSFPLEDKRLGTTLPLPASL 588
             SL IW  ++  KS+ E   G HR +SLR L I   D DMVSFP +  R+ T LP   SL
Sbjct: 1245 TSLMIW-KVKSCKSLWELEWGLHRLTSLRYLWIGGEDPDMVSFPPDMVRMETLLP--KSL 1301

Query: 589  TSLGISNFPNLERLSSSIVD-LQNLTELYLADCPKLKYFPEKGLPSSLLRLYIVGCPLIE 647
            T L I  FPNL++LSS     L +L  L L DCPKL   P++GLP SL  L I GCP+++
Sbjct: 1302 TELSIGGFPNLKKLSSKGFQFLTSLESLELWDCPKLASIPKEGLPLSLTELCIYGCPVLK 1361

Query: 648  EKCRKDGGQYWLE-THIPVVLIDWKSV 673
            E+C+   G+YW + +HIP + IDWK +
Sbjct: 1362 ERCQPGKGRYWHKISHIPYIDIDWKMI 1388

Source: Malus x robusta

Species: Malus x robusta

Genus: Malus

Family: Rosaceae

Order: Rosales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|296085123|emb|CBI28618.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|284026888|gb|ADB66335.1| CC-NBS-LRR protein [Quercus suber] Back     alignment and taxonomy information
>gi|45826061|gb|AAS77675.1| resistance protein [Quercus suber] Back     alignment and taxonomy information
>gi|356554923|ref|XP_003545790.1| PREDICTED: putative disease resistance RPP13-like protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|359487253|ref|XP_003633548.1| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225449649|ref|XP_002262753.1| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225450023|ref|XP_002272823.1| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera] gi|451798994|gb|AGF69195.1| disease resistance protein At3g14460-like protein 2 [Vitis labrusca] Back     alignment and taxonomy information
>gi|147825318|emb|CAN73260.1| hypothetical protein VITISV_003723 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359487255|ref|XP_002269744.2| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query676
TAIR|locus:20916621424 AT3G14460 [Arabidopsis thalian 0.220 0.104 0.396 1.6e-46
TAIR|locus:20916721054 AT3G14470 [Arabidopsis thalian 0.211 0.135 0.426 4.8e-31
TAIR|locus:21634261187 TAO1 "target of AVRB operation 0.371 0.211 0.287 4.9e-16
TAIR|locus:20981101219 AT3G44670 [Arabidopsis thalian 0.315 0.174 0.275 2.3e-11
TAIR|locus:2094498 1981 AT3G25510 [Arabidopsis thalian 0.516 0.176 0.255 3.6e-11
TAIR|locus:2147992 1189 AT5G11250 [Arabidopsis thalian 0.334 0.190 0.270 9.8e-11
TAIR|locus:2175991 1294 AT5G17680 [Arabidopsis thalian 0.343 0.179 0.265 1.1e-10
TAIR|locus:20534051215 AT2G14080 [Arabidopsis thalian 0.494 0.274 0.267 2.1e-09
TAIR|locus:21302801041 AT4G16960 [Arabidopsis thalian 0.272 0.176 0.277 2.3e-08
TAIR|locus:2175075 1068 AT5G41750 [Arabidopsis thalian 0.224 0.142 0.310 4.8e-08
TAIR|locus:2091662 AT3G14460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 311 (114.5 bits), Expect = 1.6e-46, Sum P(2) = 1.6e-46
 Identities = 61/154 (39%), Positives = 91/154 (59%)

Query:     1 MLKPHENLEQFCISGYEGKQFPTWLGDSSFSNLATLNFEDCSVCTTLPSVGQLHSLKHLA 60
             ML+PH +L+ FCI  Y+G  FP WLGDSSF  + ++    C++C +LP VGQL SLK+L+
Sbjct:   754 MLEPHPHLKTFCIESYQGGAFPKWLGDSSFFGITSVTLSSCNLCISLPPVGQLPSLKYLS 813

Query:    61 VRGMSRVKSLGSEFY---GNDSPIPFPCLETLRFENMQEWEDWIPLRTGQGVEWFPKLRE 117
             +   + ++ +G +F+    N   +PF  L+ L+F  M  W++WI      G+  FP L++
Sbjct:   814 IEKFNILQKVGLDFFFGENNSRGVPFQSLQILKFYGMPRWDEWICPELEDGI--FPCLQK 871

Query:   118 LHIIRCSKLQGTFPEHLPALEMLAIEGCEELLVS 151
             L I RC  L+  FPE LP+   + I  C    VS
Sbjct:   872 LIIQRCPSLRKKFPEGLPSSTEVTISDCPLRAVS 905
GO:0005634 "nucleus" evidence=ISM
GO:0006952 "defense response" evidence=IEA;ISS
GO:0043531 "ADP binding" evidence=IEA
TAIR|locus:2091672 AT3G14470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2163426 TAO1 "target of AVRB operation1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098110 AT3G44670 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094498 AT3G25510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2147992 AT5G11250 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175991 AT5G17680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053405 AT2G14080 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2130280 AT4G16960 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175075 AT5G41750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query676
PLN03210 1153 PLN03210, PLN03210, Resistant to P 5e-12
PLN03210 1153 PLN03210, PLN03210, Resistant to P 1e-08
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information 
 Score = 69.1 bits (169), Expect = 5e-12
 Identities = 68/215 (31%), Positives = 101/215 (46%), Gaps = 18/215 (8%)

Query: 432 LKSIRVGGCSKLESIAERLDNNTSLETISIDSCKNLVSFPEGGLPCAKLRTLAISNCKRL 491
           L++I + G   L+ I + L   T+LET+ +  C +LV  P       KL  L +S C+ L
Sbjct: 636 LRNIDLRGSKNLKEIPD-LSMATNLETLKLSDCSSLVELPSSIQYLNKLEDLDMSRCENL 694

Query: 492 EALPKGLHNLTSLQQLTIGIGGALPSLEEEDDLPTNLQSLNIWGNMEIWKSMIERGRGFH 551
           E LP G+ NL SL +L +     L S     D+ TN+  L++        + IE      
Sbjct: 695 EILPTGI-NLKSLYRLNLSGCSRLKSFP---DISTNISWLDLDE------TAIEEFPSNL 744

Query: 552 RFSSLRRLTISRCDDDMVSFPLEDK-RLGTTL--PLPASLTSLGISNFPNLERLSSSIVD 608
           R  +L  L +     +M S  L ++ +  T L   L  SLT L +S+ P+L  L SSI +
Sbjct: 745 RLENLDELILC----EMKSEKLWERVQPLTPLMTMLSPSLTRLFLSDIPSLVELPSSIQN 800

Query: 609 LQNLTELYLADCPKLKYFPEKGLPSSLLRLYIVGC 643
           L  L  L + +C  L+  P      SL  L + GC
Sbjct: 801 LHKLEHLEIENCINLETLPTGINLESLESLDLSGC 835

syringae 6; Provisional. Length = 1153
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 676
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.91
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.89
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.87
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.86
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.84
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.83
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.83
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.82
KOG0472565 consensus Leucine-rich repeat protein [Function un 99.8
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.8
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.57
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.46
KOG0617264 consensus Ras suppressor protein (contains leucine 99.32
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.31
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.31
KOG4341483 consensus F-box protein containing LRR [General fu 99.26
KOG4341483 consensus F-box protein containing LRR [General fu 99.25
KOG0617264 consensus Ras suppressor protein (contains leucine 99.19
KOG4237 498 consensus Extracellular matrix protein slit, conta 99.18
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 99.12
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.04
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.97
KOG4237498 consensus Extracellular matrix protein slit, conta 98.85
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.78
PRK15386 426 type III secretion protein GogB; Provisional 98.74
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.73
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.58
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.56
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.54
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.47
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.42
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.41
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.38
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.33
PRK15386 426 type III secretion protein GogB; Provisional 98.17
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.15
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.13
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.1
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.06
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.04
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.02
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.98
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 97.78
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.58
PLN03150623 hypothetical protein; Provisional 97.5
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.48
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.45
PLN03150623 hypothetical protein; Provisional 97.27
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.22
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.19
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.14
KOG2982 418 consensus Uncharacterized conserved protein [Funct 97.13
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.11
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 97.09
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.99
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 96.94
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 96.72
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.66
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 96.61
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 96.23
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.02
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 95.99
KOG2123 388 consensus Uncharacterized conserved protein [Funct 95.97
KOG3864221 consensus Uncharacterized conserved protein [Funct 95.15
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 94.06
KOG3864221 consensus Uncharacterized conserved protein [Funct 93.93
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 93.71
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 93.6
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 93.4
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 92.73
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.3
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 89.67
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 89.13
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 82.94
smart0037026 LRR Leucine-rich repeats, outliers. 82.26
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 82.26
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=2.3e-33  Score=330.84  Aligned_cols=392  Identities=15%  Similarity=0.135  Sum_probs=227.2

Q ss_pred             CCCcceEeecCCCCchhhhhccchhhccCCCccEEEeccCCCccccchhhhhhHHHHHhhcCCcceEEEecCCCCccccc
Q 005813          203 IPKLEELGINNMKNETHIWKSHNELLQDICSLKRLTIRRCPKIQSLVAEEEKDQQQQLCELSCRLEYLRLSECKGLVKLP  282 (676)
Q Consensus       203 ~~~L~~L~l~~~~~l~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~l~~~~~~~~l~~l~~~~~~L~~L~l~~~~~l~~l~  282 (676)
                      +++|+.|.++++.....    .+..+..+++|++|++.+|.....++.     .+..+    ++|++|++++|.....+|
T Consensus       211 l~~L~~L~L~~n~l~~~----~p~~l~~l~~L~~L~L~~n~l~~~~p~-----~l~~l----~~L~~L~L~~n~l~~~~p  277 (968)
T PLN00113        211 MKSLKWIYLGYNNLSGE----IPYEIGGLTSLNHLDLVYNNLTGPIPS-----SLGNL----KNLQYLFLYQNKLSGPIP  277 (968)
T ss_pred             cCCccEEECcCCccCCc----CChhHhcCCCCCEEECcCceeccccCh-----hHhCC----CCCCEEECcCCeeeccCc
Confidence            44555555555443321    122234555555555555422112221     13333    555555555544333444


Q ss_pred             ccccCCCCCceEeecCCCCCCCCCC-ccCCCCccEEeeccccCcCcCchhhccCCCCCccEEeecccccccccccc-cCC
Q 005813          283 QSSLSLSSLREIEICSCHSLVSFPE-VALPSKLRKIEIRYCDALKSLPEAWMCDTNSSLEILHIYGCRSLTYIAAV-QVP  360 (676)
Q Consensus       283 ~~~~~l~~L~~L~l~~~~~l~~~~~-~~~~~~L~~L~l~~~~~l~~~~~~~~~~~l~~L~~L~l~~c~~l~~~~~~-~~~  360 (676)
                      ..+..+++|++|++++|.....+|. ...+++|+.|++++|......+..+  ..+++|+.|++++|.--..++.. ...
T Consensus       278 ~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~--~~l~~L~~L~L~~n~l~~~~p~~l~~~  355 (968)
T PLN00113        278 PSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVAL--TSLPRLQVLQLWSNKFSGEIPKNLGKH  355 (968)
T ss_pred             hhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhH--hcCCCCCEEECcCCCCcCcCChHHhCC
Confidence            4555555555555555443333333 2234555555555554333333333  44555555555553222122211 112


Q ss_pred             CCCcEEEEeccCCccccccccccccccCCccccCCcCeeeeecCCCccccccCCCcchhhhccccCCCCCCcceEEEcCC
Q 005813          361 SSLKLLTIWHCDNIRTLTVEEGIQCSSGRRYTSSFLEELHIYCCDSLTCIFSKNELPATLESLEVGNLPPSLKSIRVGGC  440 (676)
Q Consensus       361 ~~L~~L~l~~~~~l~~l~~~~~~~~~~~~~~~~~~L~~L~l~~c~~l~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~  440 (676)
                      ++|+.|+++++.--..++  .       .....++|+.|++.++.-...      .|..+..      .++|+.|++++|
T Consensus       356 ~~L~~L~Ls~n~l~~~~p--~-------~~~~~~~L~~L~l~~n~l~~~------~p~~~~~------~~~L~~L~L~~n  414 (968)
T PLN00113        356 NNLTVLDLSTNNLTGEIP--E-------GLCSSGNLFKLILFSNSLEGE------IPKSLGA------CRSLRRVRLQDN  414 (968)
T ss_pred             CCCcEEECCCCeeEeeCC--h-------hHhCcCCCCEEECcCCEeccc------CCHHHhC------CCCCCEEECcCC
Confidence            335555555432211111  0       011233566666665432111      1111211      267888888887


Q ss_pred             CChhhHHHhhccCCccceeeccCCCCccccCCCCCCCCCccEEEeecCcCcccccccccCCCCccceeeeccCCCCCCCc
Q 005813          441 SKLESIAERLDNNTSLETISIDSCKNLVSFPEGGLPCAKLRTLAISNCKRLEALPKGLHNLTSLQQLTIGIGGALPSLEE  520 (676)
Q Consensus       441 ~~l~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~c~~l~~~~~  520 (676)
                      ......|..+..+++|+.|++++|.....++..+..+++|+.|++++|.....+|..+ ..++|+.|++++|......+.
T Consensus       415 ~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~-~~~~L~~L~ls~n~l~~~~~~  493 (968)
T PLN00113        415 SFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSF-GSKRLENLDLSRNQFSGAVPR  493 (968)
T ss_pred             EeeeECChhHhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCccc-ccccceEEECcCCccCCccCh
Confidence            7666677778888899999998886555566666678899999999887766666544 457889999998877667776


Q ss_pred             CCCCCCccceeeccCcchhhhhhhhccccccccccccEEEEecCCCccc-ccccccccccCCCCCCCCccEEeecCCCCc
Q 005813          521 EDDLPTNLQSLNIWGNMEIWKSMIERGRGFHRFSSLRRLTISRCDDDMV-SFPLEDKRLGTTLPLPASLTSLGISNFPNL  599 (676)
Q Consensus       521 ~~~~~~~L~~L~l~~~~~~~~~~~~~~~~l~~l~~L~~L~l~~n~~~l~-~i~~~~~~l~~~~~~~~~L~~L~l~~c~~l  599 (676)
                      .+..+++|++|++++|......+    ..+.++++|+.|++++|  .+. .+|...       ..+++|+.|++++|.-.
T Consensus       494 ~~~~l~~L~~L~Ls~N~l~~~~p----~~~~~l~~L~~L~Ls~N--~l~~~~p~~~-------~~l~~L~~L~Ls~N~l~  560 (968)
T PLN00113        494 KLGSLSELMQLKLSENKLSGEIP----DELSSCKKLVSLDLSHN--QLSGQIPASF-------SEMPVLSQLDLSQNQLS  560 (968)
T ss_pred             hhhhhhccCEEECcCCcceeeCC----hHHcCccCCCEEECCCC--cccccCChhH-------hCcccCCEEECCCCccc
Confidence            77888899999999988776555    34778889999999987  554 333332       24488999999985444


Q ss_pred             ccchhhcCCCCCccEEEeCCCCCccccCCCCCccccceeeecCCh
Q 005813          600 ERLSSSIVDLQNLTELYLADCPKLKYFPEKGLPSSLLRLYIVGCP  644 (676)
Q Consensus       600 ~~l~~~~~~~~~L~~L~l~~c~~l~~i~~~~l~~~L~~L~i~~c~  644 (676)
                      ..+|..+..+++|+.|++++|+-...+|..+....+....+.+++
T Consensus       561 ~~~p~~l~~l~~L~~l~ls~N~l~~~~p~~~~~~~~~~~~~~~n~  605 (968)
T PLN00113        561 GEIPKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNI  605 (968)
T ss_pred             ccCChhHhcCcccCEEeccCCcceeeCCCcchhcccChhhhcCCc
Confidence            578888888999999999998766667765443444444455555

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query676
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-10
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 7e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-13
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-10
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-08
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 6e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-07
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 8e-12
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-07
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 8e-07
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-11
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-08
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-10
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-07
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-10
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-07
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 9e-10
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-08
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-08
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 1e-07
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-09
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-09
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-08
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-04
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-08
1o6v_A 466 Internalin A; bacterial infection, extracellular r 8e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-06
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-06
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-06
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-06
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 6e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-06
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-05
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-05
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-05
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 4e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 7e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-04
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-04
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 9e-04
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
 Score = 91.5 bits (228), Expect = 3e-20
 Identities = 62/389 (15%), Positives = 101/389 (25%), Gaps = 99/389 (25%)

Query: 267 LEYLRLSECKGLVKLPQSSLSLSSLREIEICSCHSLVSFPEVALPSKLRKIEIRYCDALK 326
            E L       L                +    HS          S   +IE R   ALK
Sbjct: 14  RENLYFQGSTALRPYHDVLSQWQRHYNADRNRWHSAWRQAN----SNNPQIETRTGRALK 69

Query: 327 SLPEAWMCDTNSSLEILHIYGCRSLTYIAAVQVPSSLKLLTIWHCDNIRTLTVEEGIQCS 386
           +  +     T      L +     L        P     L+                   
Sbjct: 70  ATADLLEDATQPGRVALELRSV-PLPQF-----PDQAFRLS------------------- 104

Query: 387 SGRRYTSSFLEELHIYCCDSLTCIFSKNELPATLESLEVGNLPPSLKSIRVGGCSKLESI 446
                    L+ + I     L       ELP       +      L+++ +     L ++
Sbjct: 105 --------HLQHMTIDAA-GLM------ELPD-----TMQQF-AGLETLTLARN-PLRAL 142

Query: 447 AERLDNNTSLETISIDSCKNLVSFPE---------GGLPCAKLRTLAISNCKRLEALPKG 497
              + +   L  +SI +C  L   PE                L++L +     + +LP  
Sbjct: 143 PASIASLNRLRELSIRACPELTELPEPLASTDASGEHQGLVNLQSLRLEWTG-IRSLPAS 201

Query: 498 LHNLTSLQQLTIGIGGALPSLEEEDDLPTNLQSLNIWGNMEIWKSMIERGRGFHRFSSLR 557
           + NL +L+ L I     L +      L   +  L                        L 
Sbjct: 202 IANLQNLKSLKIR-NSPLSA------LGPAIHHL----------------------PKLE 232

Query: 558 RLTISRCDDDMVSFPLEDKRLGTTLPLPASLTSLGISNFPNLERLSSSIVDLQNLTELYL 617
            L +  C   + ++P             A L  L + +  NL  L   I  L  L +L L
Sbjct: 233 ELDLRGC-TALRNYPPIFGGR-------APLKRLILKDCSNLLTLPLDIHRLTQLEKLDL 284

Query: 618 ADCPKLKYFPEK-GLPSSLLRLYIVGCPL 645
             C  L   P       +   + +     
Sbjct: 285 RGCVNLSRLPSLIAQLPANCIILVPPHLQ 313
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Length = 329 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query676
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.98
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.97
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.97
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.97
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.97
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.96
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.96
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.96
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.95
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.95
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.94
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.94
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.94
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.94
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.93
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.93
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.92
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.92
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.91
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.91
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.91
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.9
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.9
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.9
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.89
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.89
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.89
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.88
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.88
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.87
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.86
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.85
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.84
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.83
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.83
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.82
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.82
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.82
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.81
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.8
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.8
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.79
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.79
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.78
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.77
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.76
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.76
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.75
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.73
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.73
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.73
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.72
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.72
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.72
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.71
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.7
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.69
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.69
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.68
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.68
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.66
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.64
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.63
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.62
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.6
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.6
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.6
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.59
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.59
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.58
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.58
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.57
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.57
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.57
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.56
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.54
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.52
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.52
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.5
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.49
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.49
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.48
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.48
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.43
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.41
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.38
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.38
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.36
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.36
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.32
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.32
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.3
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.29
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.29
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.28
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.27
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.26
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.26
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.25
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.25
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.24
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.22
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.21
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.21
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.21
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.2
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.18
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.16
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.15
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.11
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.02
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.01
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.96
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.95
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.92
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.92
4fdw_A401 Leucine rich hypothetical protein; putative cell s 98.92
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.91
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.89
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.86
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.83
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.82
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 98.81
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.79
1w8a_A192 SLIT protein; signaling protein, secreted protein, 98.79
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.78
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.76
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.71
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.69
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.64
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.47
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.45
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.45
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.45
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.45
4gt6_A394 Cell surface protein; leucine rich repeats, putati 98.38
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.29
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.27
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.25
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.13
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.11
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.08
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.01
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 97.99
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.97
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 97.89
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.28
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 96.9
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 95.79
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 95.51
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 93.44
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 93.26
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 89.09
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 87.81
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=5.5e-42  Score=392.57  Aligned_cols=133  Identities=20%  Similarity=0.177  Sum_probs=95.0

Q ss_pred             CCCCCCccceeeccCcchhhhhhhhccccccccccccEEEEecCCCccc-ccccccccccCCCCCCCCccEEeecCCCCc
Q 005813          521 EDDLPTNLQSLNIWGNMEIWKSMIERGRGFHRFSSLRRLTISRCDDDMV-SFPLEDKRLGTTLPLPASLTSLGISNFPNL  599 (676)
Q Consensus       521 ~~~~~~~L~~L~l~~~~~~~~~~~~~~~~l~~l~~L~~L~l~~n~~~l~-~i~~~~~~l~~~~~~~~~L~~L~l~~c~~l  599 (676)
                      .++.+++|++|++++|......+    ..+.++++|+.|++++|  .+. .+|...+.+       ++|+.|++++ +++
T Consensus       627 ~~~~l~~L~~LdLs~N~l~g~ip----~~l~~l~~L~~L~Ls~N--~l~g~ip~~l~~L-------~~L~~LdLs~-N~l  692 (768)
T 3rgz_A          627 TFDNNGSMMFLDMSYNMLSGYIP----KEIGSMPYLFILNLGHN--DISGSIPDEVGDL-------RGLNILDLSS-NKL  692 (768)
T ss_dssp             SCSSSBCCCEEECCSSCCBSCCC----GGGGGCTTCCEEECCSS--CCCSCCCGGGGGC-------TTCCEEECCS-SCC
T ss_pred             hhhccccccEEECcCCcccccCC----HHHhccccCCEEeCcCC--ccCCCCChHHhCC-------CCCCEEECCC-Ccc
Confidence            45567889999999998876655    35899999999999998  665 677666555       8999999999 566


Q ss_pred             c-cchhhcCCCCCccEEEeCCCCCccccCCCCCccccceeeecCChhh----HHHHhhcCCccccc-cccceEE
Q 005813          600 E-RLSSSIVDLQNLTELYLADCPKLKYFPEKGLPSSLLRLYIVGCPLI----EEKCRKDGGQYWLE-THIPVVL  667 (676)
Q Consensus       600 ~-~l~~~~~~~~~L~~L~l~~c~~l~~i~~~~l~~~L~~L~i~~c~~l----~~~~~~~~~~~~~~-~~i~~~~  667 (676)
                      . .+|..+..+++|++|++++|+--..+|..+...++....+.|||.+    -..|....+++|++ +|+|++.
T Consensus       693 ~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~~~~~~~~~~~~~gN~~Lcg~~l~~C~~~~~~~~~~~~~~~~~~  766 (768)
T 3rgz_A          693 DGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLPRCDPSNADGYAHHQRSHHHH  766 (768)
T ss_dssp             EECCCGGGGGCCCCSEEECCSSEEEEECCSSSSGGGSCGGGGCSCTEEESTTSCCCCSCC--------------
T ss_pred             cCcCChHHhCCCCCCEEECcCCcccccCCCchhhccCCHHHhcCCchhcCCCCcCCCCCccCCCCCCCCccccC
Confidence            5 7888999999999999999965556787665666777777777643    12799999999999 9999874
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query676
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.82
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.79
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.69
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.61
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.59
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.59
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.59
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.59
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.55
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.55
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.49
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.49
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.42
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.39
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.39
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.37
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.36
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.35
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.33
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.32
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.26
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.24
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.07
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.04
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.01
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.95
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 98.9
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.9
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.88
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.83
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.68
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.58
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.5
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.48
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.46
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.41
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 96.88
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.35
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 96.16
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.01
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 94.8
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 94.72
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]

Probab=99.82  E-value=1.1e-18  Score=180.56  Aligned_cols=342  Identities=18%  Similarity=0.198  Sum_probs=204.4

Q ss_pred             ccCCCccEEEeccCCCccccchhhhhhHHHHHhhcCCcceEEEecCCCCcccccccccCCCCCceEeecCCCCCCCCCCc
Q 005813          229 QDICSLKRLTIRRCPKIQSLVAEEEKDQQQQLCELSCRLEYLRLSECKGLVKLPQSSLSLSSLREIEICSCHSLVSFPEV  308 (676)
Q Consensus       229 ~~~~~L~~L~l~~c~~l~~l~~~~~~~~l~~l~~~~~~L~~L~l~~~~~l~~l~~~~~~l~~L~~L~l~~~~~l~~~~~~  308 (676)
                      ..+.+|++|++.++ .++.+.+      ++.+    ++|++|++++|. +++++. +.++++|++|++++|. +..+++.
T Consensus        41 ~~l~~l~~L~l~~~-~I~~l~g------l~~L----~nL~~L~Ls~N~-l~~l~~-l~~L~~L~~L~L~~n~-i~~i~~l  106 (384)
T d2omza2          41 TDLDQVTTLQADRL-GIKSIDG------VEYL----NNLTQINFSNNQ-LTDITP-LKNLTKLVDILMNNNQ-IADITPL  106 (384)
T ss_dssp             HHHTTCCEEECCSS-CCCCCTT------GGGC----TTCCEEECCSSC-CCCCGG-GTTCTTCCEEECCSSC-CCCCGGG
T ss_pred             HHhCCCCEEECCCC-CCCCccc------cccC----CCCCEEeCcCCc-CCCCcc-ccCCcccccccccccc-ccccccc
Confidence            34566777777774 4555422      3333    777777777763 555553 6677777777777754 5556556


Q ss_pred             cCCCCccEEeeccccCcCcCchhhccCCCCCccEEeecccccccccccccCCCCCcEEEEe-ccCCcccccccccccccc
Q 005813          309 ALPSKLRKIEIRYCDALKSLPEAWMCDTNSSLEILHIYGCRSLTYIAAVQVPSSLKLLTIW-HCDNIRTLTVEEGIQCSS  387 (676)
Q Consensus       309 ~~~~~L~~L~l~~~~~l~~~~~~~~~~~l~~L~~L~l~~c~~l~~~~~~~~~~~L~~L~l~-~~~~l~~l~~~~~~~~~~  387 (676)
                      ..+++|+.|+++++. +..++..   .....+....... ..+............+..... ....+..+.         
T Consensus       107 ~~l~~L~~L~~~~~~-~~~~~~~---~~~~~~~~~~~~~-~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~---------  172 (384)
T d2omza2         107 ANLTNLTGLTLFNNQ-ITDIDPL---KNLTNLNRLELSS-NTISDISALSGLTSLQQLSFGNQVTDLKPLA---------  172 (384)
T ss_dssp             TTCTTCCEEECCSSC-CCCCGGG---TTCTTCSEEEEEE-EEECCCGGGTTCTTCSEEEEEESCCCCGGGT---------
T ss_pred             ccccccccccccccc-ccccccc---ccccccccccccc-ccccccccccccccccccccccccchhhhhc---------
Confidence            667777777776665 4444333   2333444443332 122222221111111111111 001111111         


Q ss_pred             CCccccCCcCeeeeecCCCccccccCCCcchhhhccccCCCCCCcceEEEcCCCChhhHHHhhccCCccceeeccCCCCc
Q 005813          388 GRRYTSSFLEELHIYCCDSLTCIFSKNELPATLESLEVGNLPPSLKSIRVGGCSKLESIAERLDNNTSLETISIDSCKNL  467 (676)
Q Consensus       388 ~~~~~~~~L~~L~l~~c~~l~~~~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~~L~~L~l~~~~~l  467 (676)
                          .............. ...       ....      .-.++++.+.++++......+  ...+++|++|++++| .+
T Consensus       173 ----~~~~~~~~~~~~~~-~~~-------~~~~------~~l~~~~~l~l~~n~i~~~~~--~~~~~~L~~L~l~~n-~l  231 (384)
T d2omza2         173 ----NLTTLERLDISSNK-VSD-------ISVL------AKLTNLESLIATNNQISDITP--LGILTNLDELSLNGN-QL  231 (384)
T ss_dssp             ----TCTTCCEEECCSSC-CCC-------CGGG------GGCTTCSEEECCSSCCCCCGG--GGGCTTCCEEECCSS-CC
T ss_pred             ----cccccccccccccc-ccc-------cccc------ccccccceeeccCCccCCCCc--ccccCCCCEEECCCC-CC
Confidence                00011111111110 000       0000      012678888888765433322  456788999999888 56


Q ss_pred             cccCCCCCCCCCccEEEeecCcCcccccccccCCCCccceeeeccCCCCCCCcCCCCCCccceeeccCcchhhhhhhhcc
Q 005813          468 VSFPEGGLPCAKLRTLAISNCKRLEALPKGLHNLTSLQQLTIGIGGALPSLEEEDDLPTNLQSLNIWGNMEIWKSMIERG  547 (676)
Q Consensus       468 ~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~l~~L~~L~l~~c~~l~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~  547 (676)
                      ++++ .+..+++|+.|++.+|. +..++ .+..+++|++|+++++. +..++ .+..++.++.+++.+|......     
T Consensus       232 ~~~~-~l~~l~~L~~L~l~~n~-l~~~~-~~~~~~~L~~L~l~~~~-l~~~~-~~~~~~~l~~l~~~~n~l~~~~-----  301 (384)
T d2omza2         232 KDIG-TLASLTNLTDLDLANNQ-ISNLA-PLSGLTKLTELKLGANQ-ISNIS-PLAGLTALTNLELNENQLEDIS-----  301 (384)
T ss_dssp             CCCG-GGGGCTTCSEEECCSSC-CCCCG-GGTTCTTCSEEECCSSC-CCCCG-GGTTCTTCSEEECCSSCCSCCG-----
T ss_pred             CCcc-hhhcccccchhccccCc-cCCCC-cccccccCCEeeccCcc-cCCCC-cccccccccccccccccccccc-----
Confidence            5554 35567889999998876 44443 36788899999998764 44444 4677888889998888765532     


Q ss_pred             ccccccccccEEEEecCCCcccccccccccccCCCCCCCCccEEeecCCCCcccchhhcCCCCCccEEEeCCCCCccccC
Q 005813          548 RGFHRFSSLRRLTISRCDDDMVSFPLEDKRLGTTLPLPASLTSLGISNFPNLERLSSSIVDLQNLTELYLADCPKLKYFP  627 (676)
Q Consensus       548 ~~l~~l~~L~~L~l~~n~~~l~~i~~~~~~l~~~~~~~~~L~~L~l~~c~~l~~l~~~~~~~~~L~~L~l~~c~~l~~i~  627 (676)
                       .+..+++++.|++++|  .+..++. .       ..+++|++|++++ +.++.++ .+..+++|++|++++| +++.++
T Consensus       302 -~~~~~~~l~~L~ls~n--~l~~l~~-l-------~~l~~L~~L~L~~-n~l~~l~-~l~~l~~L~~L~l~~N-~l~~l~  367 (384)
T d2omza2         302 -PISNLKNLTYLTLYFN--NISDISP-V-------SSLTKLQRLFFAN-NKVSDVS-SLANLTNINWLSAGHN-QISDLT  367 (384)
T ss_dssp             -GGGGCTTCSEEECCSS--CCSCCGG-G-------GGCTTCCEEECCS-SCCCCCG-GGGGCTTCCEEECCSS-CCCBCG
T ss_pred             -ccchhcccCeEECCCC--CCCCCcc-c-------ccCCCCCEEECCC-CCCCCCh-hHcCCCCCCEEECCCC-cCCCCh
Confidence             3678889999999997  7777653 1       1448899999999 4788887 6888999999999988 678876


Q ss_pred             CCCCccccceeeecCC
Q 005813          628 EKGLPSSLLRLYIVGC  643 (676)
Q Consensus       628 ~~~l~~~L~~L~i~~c  643 (676)
                      +-.-.++|+.|+|++|
T Consensus       368 ~l~~l~~L~~L~L~~N  383 (384)
T d2omza2         368 PLANLTRITQLGLNDQ  383 (384)
T ss_dssp             GGTTCTTCSEEECCCE
T ss_pred             hhccCCCCCEeeCCCC
Confidence            5333578999999876
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure