Citrus Sinensis ID: 005862

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670---
MRDANEALRLASLRSALINYNVSPFLLSEIENQDMSETFKTITSPSENTLLHIAAAGSIHDHENMATTLARKYPFLITMQNSKRDTPLHVAARAGMLQTAKILVDCAKRSGMTSSSQIDVKGLMEMKNVRGNTALHEALNALLDAKKDKNKQKEERVTLLVSLARSLVSEDPNASYLKNVDCKSPLYLAVESKNEDILKYILEALPVNDDCATKLEGKSPVKVAIELQKLGLLKMMHDKQPALLLIQDEQMNTPMHWAASVDHLEGVRFLYEINPDSVLQRNEEGFYPFHLASANGRVRVMGEFFEKENMPPPTELLNTKGQNILHVAAKKGKSDTVRRILKASNIDTLINEMDDDGNTPLHLAALYGRHLAAAILVWDGRANQDIINFHGQTAYSIAKQKSAEINPEFFGNDDDADQLRVDNYKTTDKNMKDSGSKPNAYNMMMTLTVLFQHQLSRSGPTSFQSLLKFTGNTSNQRSVKKNDVNNRINTFIVVAALVAGASFASSVQMGSSSFSDSERSTTSTSILRSKVLTLKYFTAFNTIAMYTSITAALALCLALTVDPVLASINIWFASLLIVIALYASCVAFSDSTYMLKDRGQGFIVAMTVVQCFLLIPLAQLATHLLVPFRLKKPLILYNYRIHLWFWYFLDWIWSSPKRTPCCARCLHGKPPKE
ccccccHHHHHHHcccccccccHHHHHHcccccccccccccccccccccHHHHHHHcccccHHHHHHHHHHcccccccccccccccHHHHHHHHccHHHHHHHHHcHHHcccccccccccccHHHccccccccHHHHHHHHcHHcccccccccccHHcHHHHHHHHHHHccccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHccHHHHHHHHHHccccccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHccccccccccccccHHHHHHHHccccccHHHHHccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHccccEEEHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHEEEccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccc
cccccccccccHHHHHHccHHHHHHHHHccccHHHHHHHHHHcccccccHHHHHHHcccHHHHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHcccccccHHHHHHHcccccEEEcccccHHHHHHHHHHHHHHHHccccHcHccccccccHHHHHHHcccHHHHHHHHHccccccHHccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccEccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHccccHHHHHHHHHccccccHHHcccccHHHHHcccccHHHHHcccccHHHHcccHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEccHHHHHHHcccccccccHHHcccccccc
MRDANEALRLASLRSALInynvspfllseienqdmsetfktitspsenTLLHIAaagsihdheNMATTLARKYPFlitmqnskrdtpLHVAARAGMLQTAKILVDCakrsgmtsssqiDVKGLMEMKNVRGNTALHEALNALLDAKKDKNKQKEERVTLLVSLARSlvsedpnasylknvdcksplylavESKNEDILKYILEAlpvnddcatklegkspVKVAIELQKLGLLKMMHDKQPALLLIQDeqmntpmhwAASVDHLEGVRflyeinpdsvlqrneegfypfhlasaNGRVRVMGeffekenmppptellntkgQNILHVAAKKGKSDTVRRILKASNIDTLInemdddgntpLHLAALYGRHLAAAILVWDGRANQDIINFHGQTAYSIAKqksaeinpeffgndddadqlrvdnykttdknmkdsgskpnayNMMMTLTVLFQhqlsrsgptsFQSLLKFtgntsnqrsvkkndvnnrINTFIVVAALVAGAsfassvqmgsssfsdsersttstSILRSKVLTLKYFTAFNTIAMYTSITAALALCLALTVDPVLASINIWFASLLIVIALYASCvafsdstymlkdRGQGFIVAMTVVQCFLLIPLAQLAthllvpfrlkkplilyNYRIHLWFWYFLDwiwsspkrtpccarclhgkppke
MRDANEALRLASLRSALINYNVSPFLLSEIENQDMSETFKTITSPSENTLLHIAAAGSIHDHENMATTLARKYPFLITMQNSKRDTPLHVAARAGMLQTAKILVDcakrsgmtsssqidvkGLMEMKNVRGNTALHEALNALLdakkdknkqkEERVTLLVSLARslvsedpnasylknvdcKSPLYLAVESKNEDILKYILEALPVNDDcatklegkspvKVAIELQKLGLLKMMHDKQPALLLIQDEQMNTPMHWAASVDHLEGVRFLYEINPDSVLQRNEEGFYPFHLASANGRVRVMGEFFEKENMPPPTELLNTKGQNILHVaakkgksdtvrRILKASNIDTLINEMDDDGNTPLHLAALYGRHLAAAILVWDGRANQDIINFHGQTAYSIAKQKSAEINPEffgndddadqLRVDNYkttdknmkdsgskpNAYNMMMTLTVLFQHQLSRSGPTSFQSLLKftgntsnqrsvkkndvnnrINTFIVVAALVAGASFASSVQMGsssfsdsersttstsilrskVLTLKYFTAFNTIAMYTSITAALALCLALTVDPVLASINIWFASLLIVIALYASCVAFSDSTYMLKDRGQGFIVAMTVVQCFLLIPLAQLATHLLVPFRLKKPLILYNYRIHLWFWYFLDWIWSSPKRTPCCARCLHGKPPKE
MRDANEalrlaslrsalINYNVSPFLLSEIENQDMSETFKTITSPSENTLLHIAAAGSIHDHENMATTLARKYPFLITMQNSKRDTPLHVAARAGMLQTAKILVDCAKRSGMTSSSQIDVKGLMEMKNVRGNTALHEALNALLDAKKDKNKQKEERVTLLVSLARSLVSEDPNASYLKNVDCKSPLYLAVESKNEDILKYILEALPVNDDCATKLEGKSPVKVAIELQKLGLLKMMHDKQPALLLIQDEQMNTPMHWAASVDHLEGVRFLYEINPDSVLQRNEEGFYPFHLASANGRVRVMGEFFEKENMPPPTELLNTKGQNILHVAAKKGKSDTVRRILKASNIDTLINEMDDDGNTPLHLAALYGRHLAAAILVWDGRANQDIINFHGQTAYSIAKQKSAEINPEFFGNDDDADQLRVDNYKTTDKNMKDSGSKPNAYNMMMTLTVLFQHQLSRSGPTSFQSLLKFTGNTSNQRSVKKNDVNNRINTFIVVAALVAGASFASSVQMGsssfsdsersttstsILRSKVLTLKYFTAFNTIAMYTSITaalalclalTVDPVLASINIWFASLLIVIALYASCVAFSDSTYMLKDRGQGFIVAMTVVQCFLLIPLAQLATHLLVPFRLKKPLILYNYRIHLWFWYFLDWIWSSPKRTPCCARCLHGKPPKE
*********LASLRSALINYNVSPFLLSEIE****************NTLLHIAAAGSIHDHENMATTLARKYPFLITMQNSKRDTPLHVAARAGMLQTAKILVDCAK**************************************************LLVSLARSLVS**PNASYLKNVDCKSPLYLAVESKNEDILKYILEALPVNDDCATKLEGKSPVKVAIELQKLGLLKMMHDKQPALLLIQDEQMNTPMHWAASVDHLEGVRFLYEINPDSVLQRNEEGFYPFHLASANGRVRVMGEFF***************************************NIDTLINEMDDDGNTPLHLAALYGRHLAAAILVWDGRANQDIINFHGQTAYSIAK*****************************************YNMMMTLTVLFQHQ*****************************VNNRINTFIVVAALVAGASF*************************SKVLTLKYFTAFNTIAMYTSITAALALCLALTVDPVLASINIWFASLLIVIALYASCVAFSDSTYMLKDRGQGFIVAMTVVQCFLLIPLAQLATHLLVPFRLKKPLILYNYRIHLWFWYFLDWIWSSPKRTPCCARCL*******
MRDANEALRLASLRSALINYNVSPFLLSEIENQDMS*T**TITSPSENTLLHIAAAGSIHDHENMATTLARKYPFLITMQNSKRDTPLHVAARAGMLQTAKILVDCAKRSGMTSSSQIDVKGLMEMKNVRGNTALHEALNALLDAKKDKNKQKEERVTLLVSLARSLVSEDPNASYLKNVDCKSPLYLAVESKNEDILKYILEALPVNDDCATKLEGKSPVKVAIELQKLGLLKMMHDKQPALLLIQDEQMNTPMHWAASVDHLEGVRFLYEINPDSVLQRNEEGFYPFHLASANGRVRVMGEFFEKENMPPPTELLNTKGQNILHVAAKKGKSDTVRRILKASNIDTLINEMDDDGNTPLHLAALYGRHLAAAILVWDGRANQDIINFHGQTAYSIAKQKSAEINPEFFGNDDDADQLRVDNYKTTDKNMKDSGSKPNAYNMMMTLTVLFQHQLS*S***************************NRINTFIVVAALVAGASFASSVQMGSSSFSDSERSTTSTSILRSKVLTLKYFTAFNTIAMYTSITAALALCLALTVDPVLASINIWFASLLIVIALYASCVAFSDSTYMLKDRGQGFIVAMTVVQCFLLIPLAQLATHLLVPFRLKKPLILYNYRIHLWFWYFLDWIWSSPKRTPCCARC*HG*****
MRDANEALRLASLRSALINYNVSPFLLSEIENQDMSETFKTITSPSENTLLHIAAAGSIHDHENMATTLARKYPFLITMQNSKRDTPLHVAARAGMLQTAKILVDCAKRSGMTSSSQIDVKGLMEMKNVRGNTALHEALNALLDAKKDKNKQKEERVTLLVSLARSLVSEDPNASYLKNVDCKSPLYLAVESKNEDILKYILEALPVNDDCATKLEGKSPVKVAIELQKLGLLKMMHDKQPALLLIQDEQMNTPMHWAASVDHLEGVRFLYEINPDSVLQRNEEGFYPFHLASANGRVRVMGEFFEKENMPPPTELLNTKGQNILHVAAKKGKSDTVRRILKASNIDTLINEMDDDGNTPLHLAALYGRHLAAAILVWDGRANQDIINFHGQTAYSIAKQKSAEINPEFFGNDDDADQLRVDNYKTTDKNMKDSGSKPNAYNMMMTLTVLFQHQLSRSGPTSFQSLLKFTGNTSNQRSVKKNDVNNRINTFIVVAALVAGASFA********************SILRSKVLTLKYFTAFNTIAMYTSITAALALCLALTVDPVLASINIWFASLLIVIALYASCVAFSDSTYMLKDRGQGFIVAMTVVQCFLLIPLAQLATHLLVPFRLKKPLILYNYRIHLWFWYFLDWIWSSPKRTPCCARC********
******ALRLASLRSALINYNVSPFLLSEIENQDMSETFKTITSPSENTLLHIAAAGSIHDHENMATTLARKYPFLITMQNSKRDTPLHVAARAGMLQTAKILVDCAKRSGMTSSSQIDVKGLMEMKNVRGNTALHEALNALLDAKKDKNKQKEERVTLLVSLARSLVSEDPNASYLKNVDCKSPLYLAVESKNEDILKYILEALPVNDDCATKLEGKSPVKVAIELQKLGLLKMMHDKQPALLLIQDEQMNTPMHWAASVDHLEGVRFLYEINPDSVLQRNEEGFYPFHLASANGRVRVMGEFFEKENMPPPTELLNTKGQNILHVAAKKGKSDTVRRILKASNIDTLINEMDDDGNTPLHLAALYGRHLAAAILVWDGRANQDIINFHGQTAYSIAKQKSAEINPEFFGNDDDADQLRVDNYKTTDKNMKDSGSKPNAYNMMMTLTVLFQHQLSRSGPTSFQSLLKFTGNTSNQRSVKKNDVNNRINTFIVVAALVAGASFASSVQMGSSSFSDSERSTTSTSILRSKVLTLKYFTAFNTIAMYTSITAALALCLALTVDPVLASINIWFASLLIVIALYASCVAFSDSTYMLKDRGQGFIVAMTVVQCFLLIPLAQLATHLLVPFRLKKPLILYNYRIHLWFWYFLDWIWSSPKRTPCCARCLHGK****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRDANEALRLASLRSALINYNVSPFLLSEIENQDMSETFKTITSPSENTLLHIAAAGSIHDHENMATTLARKYPFLITMQNSKRDTPLHVAARAGMLQTAKILVDCAKRSGMTSSSQIDVKGLMEMKNVRGNTAxxxxxxxxxxxxxxxxxxxxxxVTLLVSLARSLVSEDPNASYLKNVDCKSPLYLAVESKNEDILKYILEALPVNDDCATKLEGKSPVKVAIELQKLGLLKMMHDKQPALLLIQDEQMNTPMHWAASVDHLEGVRFLYEINPDSVLQRNEEGFYPFHLASANGRVRVMGEFFEKENMPPPTELLNTKGQNILHVAAKKGKSDTVRRILKASNIDTLINEMDDDGNTPLHLAALYGRHLAAAILVWDGRANQDIINFHGQTAYSIAKQKSAEINPEFFGNDDDADQLRVDNYKTTDKNMKDSGSKPNAYNMMMTLTVLFQHQLSRSGPTSFQSLLKFTGNTSNQRSVKKNDVNNRINTFIVVAALVAGASFASSVQMGSSSFSDSERSTTSTSILRSKVLTLKYFTAFNTIAMYTSITAALALCLALTVDPVLASINIWFASLLIVIALYASCVAFSDSTYMLKDRGQGFIVAMTVVQCFLLIPLAQLATHLLVPFRLKKPLILYNYRIHLWFWYFLDWIWSSPKRTPCCARCLHGKPPKE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query673 2.2.26 [Sep-21-2011]
Q9ZU96532 Ankyrin repeat-containing no no 0.502 0.635 0.235 6e-16
Q6AWW5524 Ankyrin repeat-containing no no 0.613 0.788 0.221 8e-15
O89019 1062 Inversin OS=Mus musculus yes no 0.451 0.286 0.256 7e-12
Q86YT61006 E3 ubiquitin-protein liga yes no 0.319 0.213 0.305 8e-12
Q80SY41006 E3 ubiquitin-protein liga no no 0.319 0.213 0.305 9e-12
Q7Z020 1296 Transient receptor potent yes no 0.344 0.179 0.28 1e-11
P16157 1881 Ankyrin-1 OS=Homo sapiens no no 0.419 0.149 0.266 2e-11
Q54KA7 986 Ankyrin repeat, PH and SE yes no 0.451 0.308 0.256 2e-11
Q502K3 1071 Serine/threonine-protein no no 0.463 0.291 0.240 2e-11
Q8UVC3 1106 Inversin OS=Gallus gallus no no 0.420 0.255 0.259 7e-11
>sp|Q9ZU96|Y2168_ARATH Ankyrin repeat-containing protein At2g01680 OS=Arabidopsis thaliana GN=At2g01680 PE=1 SV=1 Back     alignment and function desciption
 Score = 86.7 bits (213), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 92/391 (23%), Positives = 162/391 (41%), Gaps = 53/391 (13%)

Query: 177 LKNVDCKSPLYLAVESKNEDILKYILEALPVNDDCATKLEGKSPVK---VAIELQKLGLL 233
           ++N   ++ +Y++     EDI +Y++    +      K+  KS +    VA +   LG++
Sbjct: 54  VQNDAGETAVYISAAENLEDIFRYLIRFSSLE---TVKIRSKSDMNAFHVAAKRGHLGIV 110

Query: 234 KMMHDKQPALLLIQDEQMNTPMHWAASVDHLEGVRFLYEINPDSVLQRNEEGFYPFHLAS 293
           K +    P L  I D    +P++ AA  DHLE V  + +++P   +   + G    H A 
Sbjct: 111 KELLRLWPELCRICDASNTSPLYAAAVQDHLEIVNAMLDVDPSCAMIVRKNGKTSLHTAG 170

Query: 294 ANGRVRVMGEFFEKENMPPPTELLNTKGQNILHVAAKKGKSDTVRRILKASNIDTLINEM 353
             G +R++    EK+       + + KGQ  LH+A K    + V  IL+A    T++NE 
Sbjct: 171 RYGLLRIVKALIEKD--AAIVGVKDKKGQTALHMAVKGRSLEVVEEILQADY--TILNER 226

Query: 354 DDDGNTPLHLAALYGRHLAAAILVWDGRANQDIINFHGQTAYSIA-----KQKSAEINP- 407
           D  GNT LH+A    R    ++L+       + IN   +TA  +A      + + EIN  
Sbjct: 227 DRKGNTALHIATRKARPQITSLLLTFTAIEVNAINNQKETAMDLADKLQYSESALEINEA 286

Query: 408 ---------EFFGNDDDADQLRVDNYKTTDKNMKDSGSKPNAYNMMMTLTVLFQHQLSRS 458
                     F G +D+A  L     K    ++K                   Q QL ++
Sbjct: 287 LVEAGAKHGRFIGREDEARAL-----KRAVSDIKHE----------------VQSQLLQN 325

Query: 459 GPTSFQSLLKFTGNTSNQRSVKKNDVNNRINTFIVVAALVAGASFASSVQMGSSSFSDSE 518
             T+     + +G     R + +  V N  N+  VVA L A  +F +   +    F++  
Sbjct: 326 EKTN----RRVSGIAKELRKLHREAVQNTTNSITVVAVLFASIAFLAIFNLPGQYFTEGS 381

Query: 519 RSTTSTSILRSKVLTLKYFTAFNTIAMYTSI 549
               +    R+     + F   N  +++ S+
Sbjct: 382 HVGQANIAGRTG---FRVFCLLNATSLFISL 409

Arabidopsis thaliana (taxid: 3702)
>sp|Q6AWW5|Y5262_ARATH Ankyrin repeat-containing protein At5g02620 OS=Arabidopsis thaliana GN=At5g02620 PE=1 SV=1 Back     alignment and function description
>sp|O89019|INVS_MOUSE Inversin OS=Mus musculus GN=Invs PE=1 SV=2 Back     alignment and function description
>sp|Q86YT6|MIB1_HUMAN E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens GN=MIB1 PE=1 SV=1 Back     alignment and function description
>sp|Q80SY4|MIB1_MOUSE E3 ubiquitin-protein ligase MIB1 OS=Mus musculus GN=Mib1 PE=1 SV=1 Back     alignment and function description
>sp|Q7Z020|TRPA1_DROME Transient receptor potential cation channel subfamily A member 1 OS=Drosophila melanogaster GN=TrpA1 PE=2 SV=3 Back     alignment and function description
>sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 Back     alignment and function description
>sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 Back     alignment and function description
>sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 Back     alignment and function description
>sp|Q8UVC3|INVS_CHICK Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query673
224127174708 predicted protein [Populus trichocarpa] 0.863 0.820 0.319 1e-76
224106698703 predicted protein [Populus trichocarpa] 0.836 0.800 0.317 2e-76
224124524673 predicted protein [Populus trichocarpa] 0.753 0.753 0.340 1e-67
224124528705 predicted protein [Populus trichocarpa] 0.772 0.737 0.323 6e-65
225446327666 PREDICTED: ankyrin repeat-containing pro 0.742 0.750 0.314 8e-60
302143275671 unnamed protein product [Vitis vinifera] 0.742 0.745 0.314 1e-59
224127170655 predicted protein [Populus trichocarpa] 0.765 0.786 0.318 2e-59
224106702428 predicted protein [Populus trichocarpa] 0.528 0.831 0.379 2e-59
225446912 996 PREDICTED: uncharacterized protein LOC10 0.791 0.535 0.305 1e-57
302143268 1343 unnamed protein product [Vitis vinifera] 0.731 0.366 0.323 1e-56
>gi|224127174|ref|XP_002329418.1| predicted protein [Populus trichocarpa] gi|222870468|gb|EEF07599.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  294 bits (752), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 213/667 (31%), Positives = 336/667 (50%), Gaps = 86/667 (12%)

Query: 27  LSEIENQDMSETFKTITSPSENTLLHIAAAGSIHDHENMATTLARKYPFLITMQNSKRDT 86
           L  + + ++S    T  SPS N+LLH++A+    D   +   L + +P L+T +N  +DT
Sbjct: 61  LRRVSSAELSSIIYTQVSPSGNSLLHVSASNGSKD---VTELLLQHFPLLMTRKNFHKDT 117

Query: 87  PLHVAARAGMLQTAKILVDCAKRSGMTSSSQIDVKGLMEMKNVRGNTALHEALNALLDAK 146
            LH+AA AG L+T  +L++ AK  G  S    D    +EMKN RGN+ALH+A+       
Sbjct: 118 ALHLAAGAGQLRTITVLINKAKGHGEAS----DFSSFLEMKNDRGNSALHDAV------- 166

Query: 147 KDKNKQKEERVTLLVSLARSLVSEDPNASYLKNVDCKSPLYLAVESK-----NEDILKYI 201
              N+  E        +AR LVSE     Y +N + KSPLYLAVE+      ++ +   +
Sbjct: 167 --INRHHE--------VARFLVSESSKLLYTQNNERKSPLYLAVENSIDKQSDDKMFTIL 216

Query: 202 LEALPVNDDCATKLEGKSPVKVAIELQKLGLLKMMHDKQPALLLIQDEQMNTPMHWAASV 261
           L+A+P + D   KLEGKSPV  A++  K  +L+ +  ++P LL  +DE+   P+H AAS+
Sbjct: 217 LDAIPDDVDLLNKLEGKSPVHAAVQGSKRKILEQIAKEKPGLLRRKDEKGGNPLHCAASM 276

Query: 262 DHLEGVRFLYEINPDSVLQRNEEGFYPFHLASANGRVRVMGEFFEKENMPPPTELLNTKG 321
            ++   +FL++   D  +Q N+EG  P H+AS  G V V+  +    N    TE LN+K 
Sbjct: 277 GYVSETQFLFDKYRDGAIQLNDEGNMPIHVASKKGHVCVVDAYIS--NWTEATEFLNSKR 334

Query: 322 QNILHVAAKKGKSDTVRRILKASNIDTLINEMDDDGNTPLHLAALYGRHLAAAILVWDGR 381
           QNILHVAA+ G+   V+ IL+ + +  LINE D DGNTPLHLA+  GR +A   LV +  
Sbjct: 335 QNILHVAAESGRHLVVKYILRNNKLKELINEQDLDGNTPLHLASKNGRSIATFTLVRNSM 394

Query: 382 ANQDIINFHGQTAYSIAKQKSAEINPEFFGN------DDDADQLRVDNY----------- 424
             + I N    T Y +A+++S  +  E+ G       DD  DQ + +NY           
Sbjct: 395 VMKRIANGENLTPYDVAEKQSKIVGAEYSGEPIPNGKDDQVDQ-KSENYGPKPLTKDKSD 453

Query: 425 ----KTTDKNMKDSG-SKPNAYNMMMTLTVLFQHQLSRSGPTSFQSLLKFTGNTSNQRSV 479
                  D++ K  G  K + Y +MMTL++L  H  +    +  +            R +
Sbjct: 454 HGVGNQVDQDEKSGGKGKLDYYGVMMTLSIL--HFFASPNKSKIEYF------RIKSRPL 505

Query: 480 KKNDVNNRINTFIVVAALVAGASFASSVQM---------GSSSFSDSER--------STT 522
            K ++  RI+  +VVA L+AG +FA  +Q+         G S  + +          S  
Sbjct: 506 PKEEIKGRIDCLLVVAVLIAGVTFAGILQLPRSADLPESGPSKITTTTTNSTQNQGISAQ 565

Query: 523 STSILRSKVLTLKYFTAFNTIAMYTSITAALALCLALTVDPVLASINIWFASLLIVIALY 582
           +  ILR+       +  F+ +A+  ++ A++ LC A   D  +A+  +W AS+L   A+Y
Sbjct: 566 NEGILRN------VYIYFDMVALNAAVMASIILCWAQLYDVKVAAHAVWLASILTGGAIY 619

Query: 583 ASCVAFSDSTYMLKDRGQGFIVAMTVVQCFLLIPLAQLATHLLVPFRLKKPLILYNYRIH 642
             C+AF  +  +       FIV   VV   L +    L+  L++P    + +I      +
Sbjct: 620 LMCLAFVFAVAINVGNSFAFIVVTLVVGGALFLVQTVLSAPLIIPPNANQ-IIERIASPY 678

Query: 643 LWFWYFL 649
           L+F +F+
Sbjct: 679 LYFVFFI 685

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224106698|ref|XP_002333641.1| predicted protein [Populus trichocarpa] gi|222837929|gb|EEE76294.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224124524|ref|XP_002319353.1| predicted protein [Populus trichocarpa] gi|222857729|gb|EEE95276.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224124528|ref|XP_002319354.1| predicted protein [Populus trichocarpa] gi|222857730|gb|EEE95277.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225446327|ref|XP_002273773.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|302143275|emb|CBI21836.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224127170|ref|XP_002329417.1| predicted protein [Populus trichocarpa] gi|222870467|gb|EEF07598.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224106702|ref|XP_002333642.1| predicted protein [Populus trichocarpa] gi|222837930|gb|EEE76295.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225446912|ref|XP_002266690.1| PREDICTED: uncharacterized protein LOC100256773 [Vitis vinifera] Back     alignment and taxonomy information
>gi|302143268|emb|CBI21829.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query673
TAIR|locus:2138391572 AT4G05040 "AT4G05040" [Arabido 0.497 0.585 0.319 1.1e-32
TAIR|locus:2128781677 AT4G03460 "AT4G03460" [Arabido 0.484 0.481 0.311 7.1e-31
TAIR|locus:2129690670 ACD6 "AT4G14400" [Arabidopsis 0.508 0.510 0.302 9.9e-28
TAIR|locus:2128771641 AT4G03450 "AT4G03450" [Arabido 0.456 0.478 0.334 1.4e-27
TAIR|locus:2020833616 AT1G03670 "AT1G03670" [Arabido 0.375 0.410 0.332 1.8e-27
TAIR|locus:2128791683 AT4G03470 [Arabidopsis thalian 0.517 0.509 0.303 1.4e-26
TAIR|locus:2129685694 AT4G14390 "AT4G14390" [Arabido 0.505 0.489 0.284 1.8e-23
TAIR|locus:2026489543 AT1G07710 "AT1G07710" [Arabido 0.656 0.813 0.243 1.6e-20
MGI|MGI:1335082 1062 Invs "inversin" [Mus musculus 0.445 0.282 0.259 1.8e-15
TAIR|locus:2181768524 ANK1 "ankyrin-like1" [Arabidop 0.573 0.736 0.232 3.8e-15
TAIR|locus:2138391 AT4G05040 "AT4G05040" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 379 (138.5 bits), Expect = 1.1e-32, P = 1.1e-32
 Identities = 117/366 (31%), Positives = 192/366 (52%)

Query:    42 ITSPSENTLLHIAAAGSIHDHENMATTLARKYPFLITMQNSKRDTPLHVAARAGMLQTAK 101
             + S   +++LH+AA      H  +   +  + P L+   N K   PLHVAA AG     +
Sbjct:   110 LKSDRGDSVLHLAARWG---HLELVKNIISECPCLVLELNFKDQLPLHVAAHAGHSAIVE 166

Query:   102 ILVDCAKR-SGMTSSSQIDVKGLMEMKNVRGNTALHEALNALLDAKKDKNKQKEERVTLL 160
              LV      S   +    +      +++  GNTALH A+              E R    
Sbjct:   167 ALVASVTFFSDRLAEEDRERLNPYVLRDKYGNTALHLAI--------------EGRY--- 209

Query:   161 VSLARSLVSEDPNASYLKNVDCKSPLYLAVESKNEDILKYILEALPVND------DCATK 214
             + +A SLV+E+ NAS+L+N +  S LY+AVE+ +  ++K IL+    ND      +  +K
Sbjct:   210 MEMAASLVNENQNASFLENNEGISSLYMAVEAGDVTLVKEILKTAGNNDLEGRNSNLDSK 269

Query:   215 LEG-KSPVKVAIELQKLGLLKMMHDKQPALLLIQDEQMNTPMHWAASVDHLEGVRFLYEI 273
             LEG K  V VA+  + +G+L ++ ++ P+L   +DE+  T + +AAS+   +GV  L + 
Sbjct:   270 LEGRKHLVHVALNARSIGVLDVILNEYPSLEDERDEEGRTCLSFAASIGFYKGVCNLLDR 329

Query:   274 NPDSVLQRNEEGFYPFHLASANGRVRVMGEFFEKENMPPPTELLNTKGQNILHVAAKKGK 333
             +  +V   +E+G +P H A+ NG +R++ E  ++   P    +LN  GQN+LH+AAK G+
Sbjct:   330 STKNVYVCDEDGSFPIHTAAENGHIRIVKEILKR--CPHSKHMLNKLGQNVLHIAAKIGE 387

Query:   334 SDTVRRILKASNIDTLINEMDDDGNTPLHLAALYGRHLAAAILVWDGRANQDIINFHGQT 393
              + V+ ++++ +   L    D DGNTPLHLA L  R+ +   L  D +  Q + N +G T
Sbjct:   388 HNLVKSLMRSDDTKHLGVGQDVDGNTPLHLAVLNWRYRSIRTLASDVKILQ-LRNDNGLT 446

Query:   394 AYSIAK 399
             A  IA+
Sbjct:   447 ARGIAE 452
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2128781 AT4G03460 "AT4G03460" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129690 ACD6 "AT4G14400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2128771 AT4G03450 "AT4G03450" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020833 AT1G03670 "AT1G03670" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2128791 AT4G03470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129685 AT4G14390 "AT4G14390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026489 AT1G07710 "AT1G07710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
MGI|MGI:1335082 Invs "inversin" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
TAIR|locus:2181768 ANK1 "ankyrin-like1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.01200071
hypothetical protein (708 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query673
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-21
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-11
pfam13962114 pfam13962, PGG, Domain of unknown function 2e-11
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-09
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-09
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 7e-08
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 9e-08
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-06
PHA02736154 PHA02736, PHA02736, Viral ankyrin protein; Provisi 1e-06
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 4e-06
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 6e-06
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 4e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 6e-05
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 1e-04
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 5e-04
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 0.002
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 0.002
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information 
 Score = 89.4 bits (222), Expect = 3e-21
 Identities = 48/132 (36%), Positives = 66/132 (50%), Gaps = 7/132 (5%)

Query: 246 IQDEQMNTPMHWAASVDHLEGVRFLYEINPDSVLQRNEEGFYPFHLASANGRVRVMGEFF 305
            +DE   TP+H AAS  HLE V+ L E   D V  ++ +G  P HLA+ NG + ++    
Sbjct: 2   ARDEDGRTPLHLAASNGHLEVVKLLLENGAD-VNAKDNDGRTPLHLAAKNGHLEIVKLLL 60

Query: 306 EKENMPPPTELLNTKGQNILHVAAKKGKSDTVRRILKASNIDTLINEMDDDGNTPLHLAA 365
           EK          +  G   LH+AA+ G  D V+ +LK       +N  D DG TPLHLAA
Sbjct: 61  EK---GADVNARDKDGNTPLHLAARNGNLDVVKLLLKH---GADVNARDKDGRTPLHLAA 114

Query: 366 LYGRHLAAAILV 377
             G      +L+
Sbjct: 115 KNGHLEVVKLLL 126

The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222475 pfam13962, PGG, Domain of unknown function Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|165103 PHA02736, PHA02736, Viral ankyrin protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 673
KOG0510 929 consensus Ankyrin repeat protein [General function 100.0
PHA02876682 ankyrin repeat protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02876682 ankyrin repeat protein; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
KOG0510 929 consensus Ankyrin repeat protein [General function 100.0
PHA02716764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA02716764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02730672 ankyrin-like protein; Provisional 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
PHA02730672 ankyrin-like protein; Provisional 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
PHA02917661 ankyrin-like protein; Provisional 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
PHA02878477 ankyrin repeat protein; Provisional 100.0
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 100.0
PHA02878477 ankyrin repeat protein; Provisional 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
PHA02917661 ankyrin-like protein; Provisional 100.0
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 100.0
PHA02989494 ankyrin repeat protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
PHA02989494 ankyrin repeat protein; Provisional 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
KOG0508615 consensus Ankyrin repeat protein [General function 100.0
PHA02798489 ankyrin-like protein; Provisional 99.98
PHA02798489 ankyrin-like protein; Provisional 99.98
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.97
PHA02792631 ankyrin-like protein; Provisional 99.97
KOG0509600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.96
KOG0508615 consensus Ankyrin repeat protein [General function 99.96
PHA02792631 ankyrin-like protein; Provisional 99.95
KOG0509600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.94
PF13962113 PGG: Domain of unknown function 99.94
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.94
PHA02859209 ankyrin repeat protein; Provisional 99.93
PHA02859209 ankyrin repeat protein; Provisional 99.92
PHA02795437 ankyrin-like protein; Provisional 99.91
PHA02795437 ankyrin-like protein; Provisional 99.91
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.9
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.9
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.89
PLN03192823 Voltage-dependent potassium channel; Provisional 99.88
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.88
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.88
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.87
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.86
KOG0514452 consensus Ankyrin repeat protein [General function 99.86
PLN03192823 Voltage-dependent potassium channel; Provisional 99.85
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.82
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.81
PHA02743166 Viral ankyrin protein; Provisional 99.79
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.78
KOG0514452 consensus Ankyrin repeat protein [General function 99.78
PHA02741169 hypothetical protein; Provisional 99.76
PHA02741169 hypothetical protein; Provisional 99.76
PHA02743166 Viral ankyrin protein; Provisional 99.74
PHA02884300 ankyrin repeat protein; Provisional 99.74
PHA02736154 Viral ankyrin protein; Provisional 99.73
PHA02736154 Viral ankyrin protein; Provisional 99.72
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.72
PHA02884300 ankyrin repeat protein; Provisional 99.72
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.69
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.66
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.63
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.63
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.58
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.57
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.56
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.55
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.4
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.32
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.29
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.28
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.26
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.25
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.23
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.22
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.16
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.15
PTZ00322664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.09
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.08
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.04
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.03
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.67
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.67
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.6
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.5
PF1360630 Ank_3: Ankyrin repeat 98.47
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.41
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.39
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.37
PF1360630 Ank_3: Ankyrin repeat 98.35
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.26
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.21
KOG0522 560 consensus Ankyrin repeat protein [General function 98.16
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.14
KOG0522560 consensus Ankyrin repeat protein [General function 98.1
KOG0705749 consensus GTPase-activating protein Centaurin gamm 97.9
KOG0705749 consensus GTPase-activating protein Centaurin gamm 97.89
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 97.84
KOG0511516 consensus Ankyrin repeat protein [General function 97.8
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 97.7
KOG0520975 consensus Uncharacterized conserved protein, conta 97.68
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.62
KOG2384223 consensus Major histocompatibility complex protein 97.4
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.32
KOG0520975 consensus Uncharacterized conserved protein, conta 97.24
KOG2384223 consensus Major histocompatibility complex protein 97.06
KOG0511516 consensus Ankyrin repeat protein [General function 96.96
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 95.95
KOG2505591 consensus Ankyrin repeat protein [General function 95.41
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 95.28
KOG2505591 consensus Ankyrin repeat protein [General function 94.32
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 93.4
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 92.81
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 88.53
cd07920322 Pumilio Pumilio-family RNA binding domain. Puf rep 88.07
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 87.69
cd07920322 Pumilio Pumilio-family RNA binding domain. Puf rep 84.83
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 82.61
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 80.32
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=1.5e-43  Score=372.25  Aligned_cols=312  Identities=26%  Similarity=0.376  Sum_probs=284.6

Q ss_pred             cCCCCCcHHHHHHh-CCccCHHHHHHHHHHhCCccccccCCCCCcHHHHHHHcCCHHHHHHHHhchhccCCCCCcccchh
Q 005862           43 TSPSENTLLHIAAA-GSIHDHENMATTLARKYPFLITMQNSKRDTPLHVAARAGMLQTAKILVDCAKRSGMTSSSQIDVK  121 (673)
Q Consensus        43 ~~~~g~t~Lh~Aa~-g~~~~~~e~v~~Ll~~~~~ll~~~~~~g~TpLh~Aa~~g~~~iv~~Ll~~ga~~~~~~~~~~~~~  121 (673)
                      .|..|+|+||+|+. ..    .+.+++|++.|++ ....|.++.+|+|+|+..|+.++.+.|+++|+|            
T Consensus        84 ~D~~~n~~l~~a~~~~~----~~~i~~Lls~gad-~~~~n~~~~aplh~A~~~~~~s~L~~Ll~~~~d------------  146 (929)
T KOG0510|consen   84 KDSADNTPLHAAVEYNQ----GDKIQVLLSYGAD-TPLRNLNKNAPLHLAADSGNYSCLKLLLDYGAD------------  146 (929)
T ss_pred             hhcccCchhHHHhhcch----HHHHHHHHhcCCC-CChhhhhccCchhhccccchHHHHHHHHHhcCC------------
Confidence            67789999999999 99    9999999999988 788999999999999999999999999999987            


Q ss_pred             hhhhhcCCccCcHHHHHHHHHHhhhhccchhhhHHHHHHHHHHHHHHhcCCCcccccCCCCchHHHHHHHcCCHHHHHHH
Q 005862          122 GLMEMKNVRGNTALHEALNALLDAKKDKNKQKEERVTLLVSLARSLVSEDPNASYLKNVDCKSPLYLAVESKNEDILKYI  201 (673)
Q Consensus       122 ~~~~~~d~~g~T~Lh~A~~~l~~~~~~~~~~~~~~~~~~~~iv~~Ll~~~~~~~~~~~~~g~tpL~~A~~~g~~~iv~~L  201 (673)
                        ++..|+.|.||||.|+.       .++.          |..+.|++.+++.. ..|.+|..|+|.|+++|..+..+..
T Consensus       147 --vnl~de~~~TpLh~A~~-------~~~~----------E~~k~Li~~~a~~~-K~~~~~~~~iH~aa~s~s~e~mEi~  206 (929)
T KOG0510|consen  147 --VNLEDENGFTPLHLAAR-------KNKV----------EAKKELINKGADPC-KSDIDGNFPIHEAARSGSKECMEIF  206 (929)
T ss_pred             --ccccccCCCchhhHHHh-------cChH----------HHHHHHHhcCCCCC-cccCcCCchHHHHHHhcchhhhhhh
Confidence              78899999999999999       9998          98899999999987 7999999999999999999999999


Q ss_pred             HHh---CCCCCcccccCCCCcHHHHHHHhCcHHHHHHHHHcCCcc--------------cccCCCCCCcHHHHHHHCCCH
Q 005862          202 LEA---LPVNDDCATKLEGKSPVKVAIELQKLGLLKMMHDKQPAL--------------LLIQDEQMNTPMHWAASVDHL  264 (673)
Q Consensus       202 l~~---~~~~~~~~~~~~g~t~L~~A~~~~~~~~v~~Ll~~~~~~--------------~~~~d~~g~t~Lh~A~~~g~~  264 (673)
                      +.+   ......+..+..+.+|||.|+..|+.++++..++.+...              ++..|.+|.||||+|++.|+.
T Consensus       207 l~~~g~~r~~~in~~~n~~~~pLhlAve~g~~e~lk~~L~n~~~~a~~~~~~~~q~kelv~~~d~dg~tpLH~a~r~G~~  286 (929)
T KOG0510|consen  207 LPEHGYERQTHINFDNNEKATPLHLAVEGGDIEMLKMCLQNGKKIADVQLDAMQQEKELVNDEDNDGCTPLHYAARQGGP  286 (929)
T ss_pred             hccccchhhcccccccCCCCcchhhhhhcCCHHHHHHHHhCccccchhhhHHHHHHHHHhhcccccCCchHHHHHHcCCh
Confidence            984   122333466788999999999999999999999987333              455689999999999999999


Q ss_pred             HHHHHHHhhCCCcccccccCCChHHHHHHHcCCHHHHHHHHhccCCCCCcccCCCCCCcHHHHHHhcCCHHHHHHHHHhC
Q 005862          265 EGVRFLYEINPDSVLQRNEEGFYPFHLASANGRVRVMGEFFEKENMPPPTELLNTKGQNILHVAAKKGKSDTVRRILKAS  344 (673)
Q Consensus       265 ~~v~~Ll~~~~~~~~~~d~~g~tpLh~A~~~g~~~iv~~Ll~~~~~~~~~~~~d~~g~t~Lh~A~~~~~~~iv~~Ll~~~  344 (673)
                      ++++.|+..|++ ++.++.++.||||.|++.|+.+.++.|++ ..+....+..|..|.||||+|+++|+..+++.|++.|
T Consensus       287 ~svd~Ll~~Ga~-I~~kn~d~~spLH~AA~yg~~ntv~rLL~-~~~~rllne~D~~g~tpLHlaa~~gH~~v~qlLl~~G  364 (929)
T KOG0510|consen  287 ESVDNLLGFGAS-INSKNKDEESPLHFAAIYGRINTVERLLQ-ESDTRLLNESDLHGMTPLHLAAKSGHDRVVQLLLNKG  364 (929)
T ss_pred             hHHHHHHHcCCc-ccccCCCCCCchHHHHHcccHHHHHHHHh-CcCccccccccccCCCchhhhhhcCHHHHHHHHHhcC
Confidence            999999999999 89999999999999999999999999999 3444556778889999999999999999999999999


Q ss_pred             CCccccc---ccCCCCCcHHHHHHHhCCHHHHHHHHhcCCCCccccccCCCCHHHH
Q 005862          345 NIDTLIN---EMDDDGNTPLHLAALYGRHLAAAILVWDGRANQDIINFHGQTAYSI  397 (673)
Q Consensus       345 ~~~~~in---~~d~~G~T~Lh~A~~~~~~~~v~~Ll~~~~~~~~~~n~~G~T~l~~  397 (673)
                         ++.+   ..|.+|+||||+|++.|+..+|+.|+.+| ++++.+|++|.|++|+
T Consensus       365 ---A~~~~~~e~D~dg~TaLH~Aa~~g~~~av~~Li~~G-a~I~~~n~~g~SA~~~  416 (929)
T KOG0510|consen  365 ---ALFLNMSEADSDGNTALHLAAKYGNTSAVQKLISHG-ADIGVKNKKGKSAFDT  416 (929)
T ss_pred             ---hhhhcccccccCCchhhhHHHHhccHHHHHHHHHcC-Cceeeccccccccccc
Confidence               5444   56999999999999999999999999998 9999999999999997

>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PF13962 PGG: Domain of unknown function Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>cd07920 Pumilio Pumilio-family RNA binding domain Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>cd07920 Pumilio Pumilio-family RNA binding domain Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query673
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 2e-11
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 2e-10
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 1e-07
1wg0_A243 Structural Comparison Of Nas6p Protein Structures I 3e-07
1ixv_A231 Crystal Structure Analysis Of Homolog Of Oncoprotei 3e-07
2dzn_A228 Crystal Structure Analysis Of Yeast Nas6p Complexed 3e-07
2xeh_A157 Structural Determinants For Improved Thermal Stabil 3e-07
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 4e-07
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 3e-04
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 5e-07
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 7e-07
2xee_A157 Structural Determinants For Improved Thermal Stabil 7e-07
1uoh_A226 Human Gankyrin Length = 226 7e-07
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 8e-07
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 9e-07
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 2e-04
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 1e-06
3so8_A162 Crystal Structure Of Ankra Length = 162 1e-06
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 1e-06
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 1e-06
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 1e-06
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 1e-06
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 1e-04
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 2e-06
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 4e-06
3eu9_A240 The Ankyrin Repeat Domain Of Huntingtin Interacting 9e-06
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 1e-05
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 1e-05
1s70_B299 Complex Between Protein Ser/thr Phosphatase-1 (delt 2e-05
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 2e-05
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 7e-05
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 7e-05
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 1e-04
4hbd_A276 Crystal Structure Of Kank2 Ankyrin Repeats Length = 1e-04
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 2e-04
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 2e-04
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 2e-04
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 4e-04
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 4e-04
1yyh_A253 Crystal Structure Of The Human Notch 1 Ankyrin Doma 4e-04
2f8x_K256 Crystal Structure Of Activated Notch, Csl And Maml 5e-04
1mx4_A168 Structure Of P18ink4c (F82q) Length = 168 8e-04
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 9e-04
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 9e-04
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure 
Iteration: 1

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 97/363 (26%), Positives = 154/363 (42%), Gaps = 59/363 (16%)
Query: 79  MQNSKRDTPLHVAARAGMLQTAKILVD-----------------CAKRSGMTSSSQIDVK 121
           + N K +TPLH+AARAG  + AK L+                  CA R G T+     VK
Sbjct: 42  VSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNM----VK 97
Query: 122 GLME------MKNVRGNTALH--------EALNALLDAKKDKNKQKEERVTLL------- 160
            L+E      +    G+T LH        E + ALL+ +  +    ++  T L       
Sbjct: 98  LLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYG 157
Query: 161 -VSLARSLVSED--PNASYLKNVDCKSPLYLAVESKNEDILKYILEALPVNDDCATKLEG 217
            V +A  L+  D  PNA+    +   +PL++AV   N DI+K +L         +    G
Sbjct: 158 KVRVAELLLERDAHPNAAGKNGL---TPLHVAVHHNNLDIVKLLLPR--GGSPHSPAWNG 212
Query: 218 KSPVKVAIELQKLGLLKMMHDKQPALLLIQDEQMNTPMHWAASVDHLEGVRFLYEINPDS 277
            +P+ +A +  ++ + + +  +       +  Q  TP+H AA   H E V  L     + 
Sbjct: 213 YTPLHIAAKQNQVEVARSL-LQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANG 271
Query: 278 VLQRNEEGFYPFHLASANGRVRVMGEFFEKENMPPPTELLNTKGQNILHVAAKKGKSDTV 337
            L  N+ G  P HL +  G V V     +   M   T  +   G   LHVA+  G    V
Sbjct: 272 NLG-NKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRM---GYTPLHVASHYGNIKLV 327
Query: 338 RRILKASNIDTLINEMDDDGNTPLHLAALYGRHLAAAILVWDGRANQDIINFHGQTAYSI 397
           + +L+       +N     G +PLH AA  G      +L+ +G A+ + ++  G T  +I
Sbjct: 328 KFLLQH---QADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNG-ASPNEVSSDGTTPLAI 383
Query: 398 AKQ 400
           AK+
Sbjct: 384 AKR 386
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 Back     alignment and structure
>pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 Back     alignment and structure
>pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|4HBD|A Chain A, Crystal Structure Of Kank2 Ankyrin Repeats Length = 276 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|1YYH|A Chain A, Crystal Structure Of The Human Notch 1 Ankyrin Domain Length = 253 Back     alignment and structure
>pdb|2F8X|K Chain K, Crystal Structure Of Activated Notch, Csl And Maml On Hes-1 Promoter Dna Sequence Length = 256 Back     alignment and structure
>pdb|1MX4|A Chain A, Structure Of P18ink4c (F82q) Length = 168 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query673
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-32
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 5e-23
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-07
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-04
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-28
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-26
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-26
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-23
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-17
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 9e-26
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-16
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-15
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-24
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 7e-22
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-20
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-24
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-20
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-07
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-04
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-24
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-21
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 8e-18
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-23
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 4e-19
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 6e-05
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-04
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-23
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-22
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 5e-14
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-13
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 9e-12
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-04
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 8e-23
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-06
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 8e-23
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 9e-14
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-07
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-22
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-15
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-04
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-22
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 7e-19
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 5e-15
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-07
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-20
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-15
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 4e-13
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-10
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-09
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-20
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-17
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-16
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-20
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-17
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-10
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-10
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-06
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-19
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 5e-18
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-15
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-08
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-08
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 9e-05
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-04
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-19
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-14
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-11
3hra_A201 Ankyrin repeat family protein; structural protein; 6e-07
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-19
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-18
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 5e-11
2pnn_A273 Transient receptor potential cation channel subfa 7e-19
2pnn_A273 Transient receptor potential cation channel subfa 4e-15
2pnn_A273 Transient receptor potential cation channel subfa 2e-12
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 8e-19
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 6e-08
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-07
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-18
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-17
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-08
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-18
3v31_A167 Ankyrin repeat family A protein 2; structural geno 7e-15
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-10
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-07
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-18
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-13
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-07
2etb_A256 Transient receptor potential cation channel subfam 3e-18
2etb_A256 Transient receptor potential cation channel subfam 4e-17
2etb_A256 Transient receptor potential cation channel subfam 7e-15
2etb_A256 Transient receptor potential cation channel subfam 4e-10
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-17
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 4e-08
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-05
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 5e-17
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-16
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 6e-16
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 6e-10
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-08
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-04
1awc_B153 Protein (GA binding protein beta 1); complex (tran 6e-17
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-13
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-07
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-07
1awc_B153 Protein (GA binding protein beta 1); complex (tran 4e-06
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-16
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-13
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 4e-13
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 5e-10
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 4e-16
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 5e-14
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-12
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 8e-12
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-10
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 5e-16
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-10
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 5e-07
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-04
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 6e-16
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 6e-15
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-10
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-08
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-07
2rfa_A232 Transient receptor potential cation channel subfa 1e-15
2rfa_A232 Transient receptor potential cation channel subfa 2e-10
2rfa_A232 Transient receptor potential cation channel subfa 2e-09
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-15
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 7e-14
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-09
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 9e-08
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 8e-07
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-05
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 5e-05
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-15
3deo_A183 Signal recognition particle 43 kDa protein; chloro 5e-15
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-11
3deo_A183 Signal recognition particle 43 kDa protein; chloro 4e-08
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 4e-15
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 5e-08
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-07
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-06
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 5e-15
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 5e-15
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 5e-09
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-06
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 7e-15
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 5e-08
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-05
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-04
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-14
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 4e-13
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 3e-08
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 4e-06
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-14
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 5e-09
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-06
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 3e-06
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 5e-05
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-14
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-12
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-09
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-06
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 4e-04
3jxi_A260 Vanilloid receptor-related osmotically activated p 4e-14
3jxi_A260 Vanilloid receptor-related osmotically activated p 7e-13
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-11
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-11
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 5e-14
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-13
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-13
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-06
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-05
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-05
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 8e-04
1sw6_A327 Regulatory protein SWI6; transcription regulation, 4e-13
1sw6_A327 Regulatory protein SWI6; transcription regulation, 4e-12
1sw6_A327 Regulatory protein SWI6; transcription regulation, 5e-04
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 7e-13
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-12
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 8e-08
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-05
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-06
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-11
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-09
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-07
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 3e-06
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 8e-06
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-11
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 5e-11
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-10
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 7e-08
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 3e-05
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-04
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 8e-04
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-09
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-07
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 6e-05
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 7e-04
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 1e-07
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 3e-06
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
 Score =  128 bits (323), Expect = 2e-32
 Identities = 60/391 (15%), Positives = 121/391 (30%), Gaps = 86/391 (21%)

Query: 48  NTLLHIAAAGSIHDHENMATTL----ARKYPFLITMQNSKRDTPLHVAARAGMLQTAKIL 103
              +H+AA        +    L            T+QN    T LH+A + G + TAK L
Sbjct: 21  MEKIHVAA---RKGQTDEVRRLIETGVS-----PTIQNRFGCTALHLACKFGCVDTAKYL 72

Query: 104 V----DCAKRSGMT------SSSQID-VKGLMEMKNVRGNTALHEAL--NALLDAKKDKN 150
                  +   G         +++ D V  L+E    RG          +     +   +
Sbjct: 73  ASVGEVHSLWHGQKPIHLAVMANKTDLVVALVEGAKERGQMPESLLNECDEREVNEIGSH 132

Query: 151 KQKEERVTLL----------VSLARSLVSE--DPNASYLKNVDCKSPLYLAVESKNEDIL 198
            +  +  T L          + + + LV     P A   K+   ++PL  A+E +N + L
Sbjct: 133 VKHCKGQTALHWCVGLGPEYLEMIKILVQLGASPTA---KDKADETPLMRAMEFRNREAL 189

Query: 199 KYILEALPVNDDCATKLEGKSPVKVAIELQKLGLLKMMHDKQPALLLIQDEQMNTPMHWA 258
                                            ++  +  K    L   ++Q N+ +HWA
Sbjct: 190 DL-------------------------------MMDTVPSKSSLRLDYANKQGNSHLHWA 218

Query: 259 ASVDHLEGVRFLYEINPDSVLQRNEEGFYPFHLASANGRVRVMGEFFEKENMPPPTELLN 318
             ++  +      E+  D V   + E   P +L+     V +  E  +K ++        
Sbjct: 219 ILINWEDVAMRFVEMGID-VNMEDNEHTVPLYLSVRAAMVLLTKELLQKTDVFLIQACPY 277

Query: 319 TKGQNI----------LHVAAKKGKSDTVRRILKASNIDTLINEMDDDGNTPLHLAALYG 368
             G  +          +  AA   K + + ++L+    +  +    + G           
Sbjct: 278 HNGTTVLPDRVVWLDFVPAAADPSKQEVL-QLLQEKLDE--VVRSLNTGAGGAVKRKKKA 334

Query: 369 RHLAAAILVWDGRANQDIINFHGQTAYSIAK 399
                 + +    A     +     + +++K
Sbjct: 335 APAVKRMKLAPS-APVRTRSRSRARSSAVSK 364
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query673
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.98
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.97
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.97
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.97
2rfa_A232 Transient receptor potential cation channel subfa 99.97
3hra_A201 Ankyrin repeat family protein; structural protein; 99.97
2rfa_A232 Transient receptor potential cation channel subfa 99.97
3hra_A201 Ankyrin repeat family protein; structural protein; 99.97
2pnn_A273 Transient receptor potential cation channel subfa 99.96
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.96
2pnn_A273 Transient receptor potential cation channel subfa 99.96
2etb_A256 Transient receptor potential cation channel subfam 99.96
2etb_A256 Transient receptor potential cation channel subfam 99.96
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.95
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.95
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.95
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.95
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.95
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.94
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.94
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.94
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.93
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.93
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.93
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.93
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.93
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.93
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.93
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.93
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.93
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.92
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.92
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.92
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.92
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.92
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.92
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.92
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.92
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.91
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.91
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.9
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.89
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.89
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.88
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.87
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.87
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.86
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.86
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.85
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.85
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.85
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.85
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.83
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.82
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.82
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.82
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.81
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.81
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.81
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.81
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.81
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.8
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.79
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.78
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.78
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.76
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.75
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.75
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.73
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.73
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.73
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.72
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.7
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.68
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.6
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.59
1y29_A28 Huwentoxin-X; A double-stranded beta-sheet, ICK, k 81.38
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
Probab=100.00  E-value=2.3e-51  Score=446.11  Aligned_cols=354  Identities=22%  Similarity=0.302  Sum_probs=297.3

Q ss_pred             cHHHHHHHHhhhhhhhhcCcchhhHhhcccccchhccccccCCCCCcHHHHHHh-CCccCHHHHHHHHHHhCCccccccC
Q 005862            3 DANEALRLASLRSALINYNVSPFLLSEIENQDMSETFKTITSPSENTLLHIAAA-GSIHDHENMATTLARKYPFLITMQN   81 (673)
Q Consensus         3 ~~~~~l~~a~~~~~~~~~~~~~~l~~~~~~~~~~~~l~~~~~~~g~t~Lh~Aa~-g~~~~~~e~v~~Ll~~~~~ll~~~~   81 (673)
                      .+.|+||.|+..|.+   ++.++|++...+.+       ..+..|.||||+||. |+    .+++++|++++++ ++.+|
T Consensus        13 ~g~t~L~~Aa~~g~~---~~v~~Ll~~g~~~~-------~~~~~~~t~L~~A~~~g~----~~~v~~Ll~~g~~-~~~~~   77 (437)
T 1n11_A           13 SGLTPLHVASFMGHL---PIVKNLLQRGASPN-------VSNVKVETPLHMAARAGH----TEVAKYLLQNKAK-VNAKA   77 (437)
T ss_dssp             --CCHHHHHHHHTCH---HHHHHHHHTTCCSC-------CSSSCCCCHHHHHHHHTC----HHHHHHHHHHTCC-SSCCC
T ss_pred             CCCCHHHHHHHCCCH---HHHHHHHHcCCCCC-------CCCCCCCCHHHHHHHcCC----HHHHHHHHhCCCC-CCCCC
Confidence            567899999999999   88999988644433       367789999999999 99    9999999999988 89999


Q ss_pred             CCCCcHHHHHHHcCCHHHHHHHHhchhccCCCCCcccchhhhhhhcCCccCcHHHHHHHHHHhhhhccchhhhHHHHHHH
Q 005862           82 SKRDTPLHVAARAGMLQTAKILVDCAKRSGMTSSSQIDVKGLMEMKNVRGNTALHEALNALLDAKKDKNKQKEERVTLLV  161 (673)
Q Consensus        82 ~~g~TpLh~Aa~~g~~~iv~~Ll~~ga~~~~~~~~~~~~~~~~~~~d~~g~T~Lh~A~~~l~~~~~~~~~~~~~~~~~~~  161 (673)
                      ..|.||||+|+..|+.++|++|+++|++              ++.+|..|.||||+|+.       .|+.          
T Consensus        78 ~~g~t~L~~A~~~g~~~~v~~Ll~~ga~--------------~~~~~~~g~t~L~~A~~-------~g~~----------  126 (437)
T 1n11_A           78 KDDQTPLHCAARIGHTNMVKLLLENNAN--------------PNLATTAGHTPLHIAAR-------EGHV----------  126 (437)
T ss_dssp             TTSCCHHHHHHHHTCHHHHHHHHHHTCC--------------TTCCCTTCCCHHHHHHH-------HTCH----------
T ss_pred             CCCCCHHHHHHHCCCHHHHHHHHhCCCC--------------CCCCCCCCCcHHHHHHH-------cCCH----------
Confidence            9999999999999999999999999987              56678888899999988       8888          


Q ss_pred             HHHHHHHhcCCCcccccCCCCchHHHHHHHcCCHHHHHHHHHhCCCCCcccccCCCCcHHHHHHHhCcHHHHHHHHHcCC
Q 005862          162 SLARSLVSEDPNASYLKNVDCKSPLYLAVESKNEDILKYILEALPVNDDCATKLEGKSPVKVAIELQKLGLLKMMHDKQP  241 (673)
Q Consensus       162 ~iv~~Ll~~~~~~~~~~~~~g~tpL~~A~~~g~~~iv~~Ll~~~~~~~~~~~~~~g~t~L~~A~~~~~~~~v~~Ll~~~~  241 (673)
                      ++++.|++++.+.. ..+..|.||||+|+..|+.+++++|++++...  ...+..|.||||.|+..++.+++++|++++ 
T Consensus       127 ~~v~~Ll~~~~~~~-~~~~~g~t~L~~A~~~g~~~~v~~Ll~~g~~~--~~~~~~g~t~L~~A~~~~~~~~v~~Ll~~g-  202 (437)
T 1n11_A          127 ETVLALLEKEASQA-CMTKKGFTPLHVAAKYGKVRVAELLLERDAHP--NAAGKNGLTPLHVAVHHNNLDIVKLLLPRG-  202 (437)
T ss_dssp             HHHHHHHHTTCCSC-CCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCT--TCCCSSCCCHHHHHHHTTCHHHHHHHGGGT-
T ss_pred             HHHHHHHhCCCCCc-CCCCCCCCHHHHHHHcCCHHHHHHHHhCCCCC--CCCCCCCCCHHHHHHHcCCHHHHHHHHhCC-
Confidence            88888888887766 56777888888888888888888888875443  245667888888888888888888888887 


Q ss_pred             cccccCCCCCCcHHHHHHHCCCHHHHHHHHhhCCCcccccccCCChHHHHHHHcCCHHHHHHHHhccCCCCCcccCCCCC
Q 005862          242 ALLLIQDEQMNTPMHWAASVDHLEGVRFLYEINPDSVLQRNEEGFYPFHLASANGRVRVMGEFFEKENMPPPTELLNTKG  321 (673)
Q Consensus       242 ~~~~~~d~~g~t~Lh~A~~~g~~~~v~~Ll~~~~~~~~~~d~~g~tpLh~A~~~g~~~iv~~Ll~~~~~~~~~~~~d~~g  321 (673)
                      ..++..+..|.||||+|+..|+.+++++|++.+.+ .+..+..|.||||.|+..|+.+++++|++++.   ..+..+..|
T Consensus       203 ~~~~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~g~~-~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~~~---~~~~~~~~g  278 (437)
T 1n11_A          203 GSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGS-ANAESVQGVTPLHLAAQEGHAEMVALLLSKQA---NGNLGNKSG  278 (437)
T ss_dssp             CCSCCCCTTCCCHHHHHHHTTCHHHHHHHHHTTCC-TTCCCTTCCCHHHHHHHTTCHHHHHHHHTTTC---CTTCCCTTC
T ss_pred             CCCCCcCCCCCCHHHHHHHcCCHHHHHHHHHcCCC-CCCCCCCCCCHHHHHHHCCCHHHHHHHHhcCC---CCCCCCCCC
Confidence            56777778888888888888888888888888877 67778888888888888888888888888552   236677888


Q ss_pred             CcHHHHHHhcCCHHHHHHHHHhCCCcccccccCCCCCcHHHHHHHhCCHHHHHHHHhcCCCCccccccCCCCHHHHHHhh
Q 005862          322 QNILHVAAKKGKSDTVRRILKASNIDTLINEMDDDGNTPLHLAALYGRHLAAAILVWDGRANQDIINFHGQTAYSIAKQK  401 (673)
Q Consensus       322 ~t~Lh~A~~~~~~~iv~~Ll~~~~~~~~in~~d~~G~T~Lh~A~~~~~~~~v~~Ll~~~~~~~~~~n~~G~T~l~~a~~~  401 (673)
                      +||||+|+..|+.+++++|++.+   .++|.+|..|+||||+|+..|+.+++++|++++ ++++.+|..|+||||+|+..
T Consensus       279 ~t~L~~A~~~~~~~~~~~Ll~~g---~~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~g-ad~n~~~~~g~t~L~~A~~~  354 (437)
T 1n11_A          279 LTPLHLVAQEGHVPVADVLIKHG---VMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQ-ADVNAKTKLGYSPLHQAAQQ  354 (437)
T ss_dssp             CCHHHHHHHHTCHHHHHHHHHHT---CCTTCCCSSCCCHHHHHHHSSCSHHHHHHHHTT-CCTTCCCTTSCCHHHHHHHT
T ss_pred             CCHHHHHHHcCCHHHHHHHHhCC---ccCCCCCCCCCCHHHHHHHcCcHHHHHHHHhcC-CCCCCCCCCCCCHHHHHHHC
Confidence            88888888888888888888887   778888888888888888888888888888876 88888888888888888888


Q ss_pred             ccccCccccCCcc
Q 005862          402 SAEINPEFFGNDD  414 (673)
Q Consensus       402 ~~~~~~~~l~~~~  414 (673)
                      ++.+++++|.+..
T Consensus       355 g~~~iv~~Ll~~g  367 (437)
T 1n11_A          355 GHTDIVTLLLKNG  367 (437)
T ss_dssp             TCHHHHHHHHHTT
T ss_pred             ChHHHHHHHHHCc
Confidence            8888888876543
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>1y29_A Huwentoxin-X; A double-stranded beta-sheet, ICK, knottin; NMR {Synthetic} SCOP: g.3.6.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 673
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 9e-24
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 8e-20
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-16
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-10
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-08
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 5e-15
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 6e-13
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-06
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 6e-04
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 6e-14
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-10
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-08
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-11
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 4e-08
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-04
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 4e-04
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 0.003
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-11
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-10
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 3e-09
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-04
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-10
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 9e-10
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-08
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 8e-05
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-09
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-08
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-07
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-09
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9e-08
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9e-06
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 8e-05
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 0.002
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 6e-09
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-06
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 0.004
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 3e-08
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 4e-06
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 5e-06
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 0.001
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 9e-05
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 3e-04
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 6e-04
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 0.001
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 0.002
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  101 bits (253), Expect = 9e-24
 Identities = 91/430 (21%), Positives = 151/430 (35%), Gaps = 80/430 (18%)

Query: 49  TLLHIAAAGSIHDHENMATTLARKYPFLITMQNSKRDTPLHVAARAGMLQTAKILVDCAK 108
           T LH+A+      H  +   L ++      + N K +TPLH+AARAG  + AK L+    
Sbjct: 2   TPLHVASF---MGHLPIVKNLLQR-GASPNVSNVKVETPLHMAARAGHTEVAKYLLQN-- 55

Query: 109 RSGMTSSSQIDVKGLMEMKNVRGNTALHEA--------LNALLDAKKDKNKQKEERVTLL 160
                   +  V      K     T LH A        +  LL+   + N       T L
Sbjct: 56  --------KAKV----NAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPL 103

Query: 161 VSLARSLVSEDPNASY-------LKNVDCKSPLYLAVESKNEDILKYILEALPVNDDCAT 213
              AR    E   A                +PL++A +     + + +LE        A 
Sbjct: 104 HIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDA--HPNAA 161

Query: 214 KLEGKSPVKVAIELQKLGLLKMMHDKQPALLLIQDEQMNTPMHWAASVDHLEGVRFLYEI 273
              G +P+ VA+    L ++K++  +             TP+H AA  + +E  R L + 
Sbjct: 162 GKNGLTPLHVAVHHNNLDIVKLLLPRG-GSPHSPAWNGYTPLHIAAKQNQVEVARSLLQY 220

Query: 274 NPDSVLQRNEEGFYPFHLASANGRVRVMGEFFEKENMPPPTELLNTKGQNILHVAAKKGK 333
              +    + +G  P HLA+  G   ++       +      L N  G   LH+ A++G 
Sbjct: 221 GGSAN-AESVQGVTPLHLAAQEGHAEMVALLL---SKQANGNLGNKSGLTPLHLVAQEGH 276

Query: 334 SDTVRRILKA------------------------------SNIDTLINEMDDDGNTPLHL 363
                 ++K                                     +N     G +PLH 
Sbjct: 277 VPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQ 336

Query: 364 AALYGRHLAAAILVWDGRANQDIINFHGQTAYSIAKQKSAEINPEFFGNDDDADQLRVDN 423
           AA  G      +L+ +G A+ + ++  G T  +IAK+          G     D L+V  
Sbjct: 337 AAQQGHTDIVTLLLKNG-ASPNEVSSDGTTPLAIAKRL---------GYISVTDVLKVVT 386

Query: 424 YKTTDKNMKD 433
            +T+   + D
Sbjct: 387 DETSFVLVSD 396
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query673
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.98
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.97
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.97
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.97
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.97
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.96
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.96
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.95
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.95
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.95
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.94
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.94
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.94
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.92
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.9
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.9
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.9
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.89
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.88
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.88
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.88
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.87
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.84
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.83
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.82
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.82
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.81
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.8
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.78
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.74
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.74
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=3.3e-44  Score=383.03  Aligned_cols=361  Identities=24%  Similarity=0.315  Sum_probs=319.3

Q ss_pred             HHHHHHhhhhhhhhcCcchhhHhhcccccchhccccccCCCCCcHHHHHHh-CCccCHHHHHHHHHHhCCccccccCCCC
Q 005862            6 EALRLASLRSALINYNVSPFLLSEIENQDMSETFKTITSPSENTLLHIAAA-GSIHDHENMATTLARKYPFLITMQNSKR   84 (673)
Q Consensus         6 ~~l~~a~~~~~~~~~~~~~~l~~~~~~~~~~~~l~~~~~~~g~t~Lh~Aa~-g~~~~~~e~v~~Ll~~~~~ll~~~~~~g   84 (673)
                      ||||+|+..|.+   +..++|++...+.+       ..|..|+||||+||. |+    .+++++|+++|++ ++.+|..|
T Consensus         2 TpL~~Aa~~g~~---~~v~~Ll~~g~~in-------~~d~~g~TpL~~A~~~g~----~~iv~~Ll~~gad-i~~~~~~g   66 (408)
T d1n11a_           2 TPLHVASFMGHL---PIVKNLLQRGASPN-------VSNVKVETPLHMAARAGH----TEVAKYLLQNKAK-VNAKAKDD   66 (408)
T ss_dssp             CHHHHHHHHTCH---HHHHHHHHTTCCSC-------CSSSCCCCHHHHHHHHTC----HHHHHHHHHHTCC-SSCCCTTS
T ss_pred             ChHHHHHHCcCH---HHHHHHHHCCCCCC-------CCCCCCCCHHHHHHHcCC----HHHHHHHHHCcCC-CCCCCCCC
Confidence            689999999988   88999987644332       478899999999999 99    9999999999997 89999999


Q ss_pred             CcHHHHHHHcCCHHHHHHHHhchhccCCCCCcccc-------------------hhhhhhhcCCccCcHHHHHHHHHHhh
Q 005862           85 DTPLHVAARAGMLQTAKILVDCAKRSGMTSSSQID-------------------VKGLMEMKNVRGNTALHEALNALLDA  145 (673)
Q Consensus        85 ~TpLh~Aa~~g~~~iv~~Ll~~ga~~~~~~~~~~~-------------------~~~~~~~~d~~g~T~Lh~A~~~l~~~  145 (673)
                      .||||+|+..|+.+++++|++.+.+..........                   .......++..+.++++.|+.     
T Consensus        67 ~t~L~~A~~~g~~~~~~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~a~~-----  141 (408)
T d1n11a_          67 QTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAK-----  141 (408)
T ss_dssp             CCHHHHHHHHTCHHHHHHHHHHTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHTTCCSCCCCTTSCCHHHHHHH-----
T ss_pred             CCHHHHHHHcCCHHHHHHHHHhhhccccccccccchhhhhhhhcccccccccccccccccccccccchHHHHHHH-----
Confidence            99999999999999999999987764332221100                   112245578899999999999     


Q ss_pred             hhccchhhhHHHHHHHHHHHHHHhcCCCcccccCCCCchHHHHHHHcCCHHHHHHHHHhCCCCCcccccCCCCcHHHHHH
Q 005862          146 KKDKNKQKEERVTLLVSLARSLVSEDPNASYLKNVDCKSPLYLAVESKNEDILKYILEALPVNDDCATKLEGKSPVKVAI  225 (673)
Q Consensus       146 ~~~~~~~~~~~~~~~~~iv~~Ll~~~~~~~~~~~~~g~tpL~~A~~~g~~~iv~~Ll~~~~~~~~~~~~~~g~t~L~~A~  225 (673)
                        .++.          ++++.|++++.+++ ..+.+|.+||++|+..|+.+++++|++++...  ...+..|.||+|.+.
T Consensus       142 --~~~~----------~~v~~ll~~~~~~~-~~~~~~~~~L~~A~~~~~~~~~~~Ll~~g~~~--~~~~~~~~t~l~~~~  206 (408)
T d1n11a_         142 --YGKV----------RVAELLLERDAHPN-AAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSP--HSPAWNGYTPLHIAA  206 (408)
T ss_dssp             --TTCH----------HHHHHHHHTTCCTT-CCCSSCCCHHHHHHHTTCHHHHHHHGGGTCCS--CCCCTTCCCHHHHHH
T ss_pred             --cCCH----------HHHHHHHHcCCCCC-cCCCcCchHHHHHHHcCCHHHHHHHHhcCCcc--cccCCCCCCcchhhh
Confidence              9999          99999999999887 67888999999999999999999999996554  356678999999999


Q ss_pred             HhCcHHHHHHHHHcCCcccccCCCCCCcHHHHHHHCCCHHHHHHHHhhCCCcccccccCCChHHHHHHHcCCHHHHHHHH
Q 005862          226 ELQKLGLLKMMHDKQPALLLIQDEQMNTPMHWAASVDHLEGVRFLYEINPDSVLQRNEEGFYPFHLASANGRVRVMGEFF  305 (673)
Q Consensus       226 ~~~~~~~v~~Ll~~~~~~~~~~d~~g~t~Lh~A~~~g~~~~v~~Ll~~~~~~~~~~d~~g~tpLh~A~~~g~~~iv~~Ll  305 (673)
                      ...+.++...++... ......+..|.||||+|+..++.++++.+.+.... .+..+..|.||++.|++.++.+++++|+
T Consensus       207 ~~~~~~~~~~l~~~~-~~~~~~~~~~~t~l~~a~~~~~~~~~~~~~~~~~~-~~~~~~~g~~~l~~a~~~~~~~i~~~Ll  284 (408)
T d1n11a_         207 KQNQVEVARSLLQYG-GSANAESVQGVTPLHLAAQEGHAEMVALLLSKQAN-GNLGNKSGLTPLHLVAQEGHVPVADVLI  284 (408)
T ss_dssp             HTTCHHHHHHHHHTT-CCTTCCCTTCCCHHHHHHHTTCHHHHHHHHTTTCC-TTCCCTTCCCHHHHHHHHTCHHHHHHHH
T ss_pred             ccchhhhhhhhhhcc-ccccccCCCCCCHHHHHHHhCcHhHhhhhhccccc-cccccCCCCChhhhhhhcCcHHHHHHHH
Confidence            999999999999988 56667788899999999999999999999998877 7788999999999999999999999999


Q ss_pred             hccCCCCCcccCCCCCCcHHHHHHhcCCHHHHHHHHHhCCCcccccccCCCCCcHHHHHHHhCCHHHHHHHHhcCCCCcc
Q 005862          306 EKENMPPPTELLNTKGQNILHVAAKKGKSDTVRRILKASNIDTLINEMDDDGNTPLHLAALYGRHLAAAILVWDGRANQD  385 (673)
Q Consensus       306 ~~~~~~~~~~~~d~~g~t~Lh~A~~~~~~~iv~~Ll~~~~~~~~in~~d~~G~T~Lh~A~~~~~~~~v~~Ll~~~~~~~~  385 (673)
                      ++|..   .+..+..+.||||.++..++.++++++++.|   +++|.+|.+|+||||+|++.|+.++|++|+++| +|++
T Consensus       285 ~~g~~---~~~~~~~~~t~L~~~~~~~~~~~~~~ll~~g---~~in~~d~~G~T~Lh~A~~~g~~~iv~~Ll~~G-Ad~n  357 (408)
T d1n11a_         285 KHGVM---VDATTRMGYTPLHVASHYGNIKLVKFLLQHQ---ADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNG-ASPN  357 (408)
T ss_dssp             HHTCC---TTCCCSSCCCHHHHHHHSSCSHHHHHHHHTT---CCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTT-CCSC
T ss_pred             HCCCc---cccccccccccchhhcccCcceeeeeecccc---ccccccCCCCCCHHHHHHHcCCHHHHHHHHHCC-CCCC
Confidence            97633   3667888999999999999999999999998   889999999999999999999999999999987 9999


Q ss_pred             ccccCCCCHHHHHHhhccccCcccc
Q 005862          386 IINFHGQTAYSIAKQKSAEINPEFF  410 (673)
Q Consensus       386 ~~n~~G~T~l~~a~~~~~~~~~~~l  410 (673)
                      .+|++|+||||+|++.|+.+++++|
T Consensus       358 ~~d~~G~t~L~~A~~~~~~~iv~~L  382 (408)
T d1n11a_         358 EVSSDGTTPLAIAKRLGYISVTDVL  382 (408)
T ss_dssp             CCCSSSCCHHHHHHHTTCHHHHHHH
T ss_pred             CCCCCCCCHHHHHHHcCCHHHHHHH
Confidence            9999999999999999998888765
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure