Citrus Sinensis ID: 005981

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660------
MKNPLSNTDLFKLSALLFVSFTFFYLGKRWSDGNQRILFFSSYTSSRTSQQNGYVSLSPNLNKSFDISSLISQNQSLASPYIVPSPAPVDPLPPPPPPPPPERFGIVNEDGTMSDDFEIGEYDPDLVETEWNGDRNGTEATKSFKITRYEMCPGSMREYIPCLDNVEAIKQLKSTDKGERFERHCPLNGTGLNCLVPAPKGYKTPIPWPRSRNEVWYNNVPHSRLVEDKGGQNWISKEKDKFKFPGGGTQFIHGADQYLDQIAKMVPDITWGHHIRVVMDAGCGVASFGAYLLPRNVITMSIAPKDVHENQIQFALERGAPAMVAAFATRRLPYPSQAFDLIHCSRCRINWTRDDGILLLEVNRMLRAGGYFAWAAQPVYKHEEAQEEHWKEMLDLTTRLCWELVKKEGYIAIWKKPTNNSCYLNREAGTIPPLCDPDDNPDNVWYVDLKACITRLPENGYGANVSLWPERLRTSPDRLQSIQLDAFIARKELFKAESKYWNEIIESYVRALHWKKMKLRNVLDMRAGFGGFAAALIEQKFDCWVMNVVPVSGFNTLPVIYDRGLIGVMHDWCEPFDTYPRTYDLLHAAGLFSVESKRCNMSTIMLEMDRMLRPGGHVYIRDSIDVMDELQEIGKAMGWHVTLRETAEGPHASYRILTADKRLLHA
ccccccccHHHHHHHHHHHHHHHHHHcccccccccEEEEEEcccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccEEEccccccccccccHHHHHHHHHccccccccccEEEEEEEcccccHHHHHHcccccEEEEcccccccHHHHHHHHHcccccEEEcccccccccccccccEEEccccccccccccccHHEEEcEEEEcccEEEEEccccccHHHHHHHHHHHHHHHHHHHcEEEcEEEEEEEEEEccccccHHHccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEcccccccHHHHHHcccccEEEEEEEcccccccccHHcccccccEEcccccccccccccccEEccccccccccccccHHHHHHHHccccccccEEEEEccHHHHHHHHHHHHHcccEEEEEEcccccccccEEEEEEEccccc
cccccccHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEccccccccccccEEEcccccccccccHHccccccccccccccccccccccccccccccccHHHcEccccccccccccccccccccHHHccccccccccccccccccccccccccHccccccccHHHHHHccccccHHHHHHcccccccccccccccccccccccccccccccHEHHccccccHHEEEEccccEEEEcccEEEccccccccccHHHHHHHHHHHHcccccccccEEEEEEccccHccHHHHHccccEEEEEcccccHHHHHHHHHHHccccEEEEEHcccccccccccEEEHHcccccccccccccEEEEEEHHEcccccEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcccccHHHHcccccccccccccccccccccEcccHHccccccccccccccccccHHHccccccHcccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccEEEHHcHHHccHHHHHHHHcccccEEEEEEEcccccccccEEEcccEEEEEcccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccEEEEEccHHHHHHHHHHHHHcccEEEEEEcccccccccEEEEEEEEEEcc
mknplsntdlfklsALLFVSFTFFYlgkrwsdgnqrILFFSSYtssrtsqqngyvslspnlnksfdiSSLIsqnqslaspyivpspapvdplppppppppperfgivnedgtmsddfeigeydpdlvetewngdrngteatksFKITryemcpgsmreyipcldNVEAIKQlkstdkgerferhcplngtglnclvpapkgyktpipwprsrnevwynnvphsrlvedkggqnwiskekdkfkfpgggtqfihgADQYLDQIAKmvpditwgHHIRVVMDAGcgvasfgayllprnvitmsiapkdvhENQIQFALERGAPAMVAAFAtrrlpypsqafdlihcsrcrinwtrddgILLLEVNRMLRAggyfawaaqpvykheeaQEEHWKEMLDLTTRLCWELVKKEGYIAiwkkptnnscylnreagtipplcdpddnpdnvwyVDLKACItrlpengyganvslwperlrtspdrlQSIQLDAFIARKELFKAESKYWNEIIESYVRALHWKKMKLRNVLDMRAGFGGFAAALIEQKFdcwvmnvvpvsgfntlpviydrgligvmhdwcepfdtyprtYDLLHAAGLFSVESKRCNMSTIMLEMDRmlrpgghvyirdSIDVMDELQEIGKAMGWHVTlretaegphasyRILTADKRLLHA
mknplsntdlfklsALLFVSFTFFYLGKRWSDGNQRILFFSSYTSSRTSQQNGYVSLSPNLNKSFDISSLISQNQSLASPYIVPSPAPVDPLPPPPPPPPPERFGIVNEDGTMSDDFEIGEYDPDlvetewngdrngteatksfkiTRYEMCPGSMREYIPCLDNVEAIKQLKSTDKGERFErhcplngtglnclvpapKGYKTPIPWPRSRNEVWYNNVPHSrlvedkggqnWISKEKDKFKFPGGGTQFIHGADQYLDQIAKMVPDITWGHHIRVVMDAGCGVASFGAYLLPRNVITMSIAPKDVHENQIQFALERGAPAMVAAFATRRLPYPSQAFDLIHCSRCRINWTRDDGILLLEVNRMLRAGGYFAWAAQPVYKHEEAQEEHWKEMLDLTTRLCWELVKKEGYIaiwkkptnnscYLNREAGTIPPLCDPDDNPDNVWYVDLKACITRLPENGYGANVSLWPERLRTSPDRLQSIQLDAFIARKELFKAESKYWNEIIESYVRALHWKKMKLRNVLDMRAGFGGFAAALIEQKFDCWVMNVVPVSGFNTLPVIYDRGLIGVMHDWCEPFDTYPRTYDLLHAAGLFSVESKRCNMSTIMLEMDRMLRPGGHVYIRDSIDVMDELQEIGKAMGWHVTLRetaegphasyriltadkrllha
MKNPLSNTDLFKLSALLFVSFTFFYLGKRWSDGNQRILFFSSYTSSRTSQQNGYVSLSPNLNKSFDISSLISQNQSLASPYIVpspapvdplpppppppppERFGIVNEDGTMSDDFEIGEYDPDLVETEWNGDRNGTEATKSFKITRYEMCPGSMREYIPCLDNVEAIKQLKSTDKGERFERHCPLNGTGLNCLVPAPKGYKTPIPWPRSRNEVWYNNVPHSRLVEDKGGQNWISKEKDKFKFPGGGTQFIHGADQYLDQIAKMVPDITWGHHIRVVMDAGCGVASFGAYLLPRNVITMSIAPKDVHENQIQFALERGAPAMVAAFATRRLPYPSQAFDLIHCSRCRINWTRDDGILLLEVNRMLRAGGYFAWAAQPVYKHEEAQEEHWKEMLDLTTRLCWELVKKEGYIAIWKKPTNNSCYLNREAGTIpplcdpddnpdnVWYVDLKACITRLPENGYGANVSLWPERLRTSPDRLQSIQLDAFIARKELFKAESKYWNEIIESYVRALHWKKMKLRNVLDMRAGFGGFAAALIEQKFDCWVMNVVPVSGFNTLPVIYDRGLIGVMHDWCEPFDTYPRTYDLLHAAGLFSVESKRCNMSTIMLEMDRMLRPGGHVYIRDSIDVMDELQEIGKAMGWHVTLRETAEGPHASYRILTADKRLLHA
********DLFKLSALLFVSFTFFYLGKRWSDGNQRILFFSSY***************************************************************************IGEYDPDLVETEWN*******ATKSFKITRYEMCPGSMREYIPCLDNVEAIKQLKSTDKGERFERHCPLNGTGLNCLVPAPKGYKTPIPWPRSRNEVWYNNVPHSRLVEDKGGQNWISKEKDKFKFPGGGTQFIHGADQYLDQIAKMVPDITWGHHIRVVMDAGCGVASFGAYLLPRNVITMSIAPKDVHENQIQFALERGAPAMVAAFATRRLPYPSQAFDLIHCSRCRINWTRDDGILLLEVNRMLRAGGYFAWAAQPVYKHEEAQEEHWKEMLDLTTRLCWELVKKEGYIAIWKKPTNNSCYLNREAGTIPPLCDPDDNPDNVWYVDLKACITRLPENGYGANVSLWPERLRTSPDRLQSIQLDAFIARKELFKAESKYWNEIIESYVRALHWKKMKLRNVLDMRAGFGGFAAALIEQKFDCWVMNVVPVSGFNTLPVIYDRGLIGVMHDWCEPFDTYPRTYDLLHAAGLFSVESKRCNMSTIMLEMDRMLRPGGHVYIRDSIDVMDELQEIGKAMGWHVTLRETAEGPHASYRILT********
*******TDLFKLSALLFVSFTFFYLGKRWSDGNQRI****************************************************************************************************************EMCPGSMREYIPCLDNVEAIKQLKSTDKGERFERHCPLNGTGLNCLVPAPKGYKTPIPWPRSRNEVWYNNVPHSRLVEDKGGQNWISKEKDKFKFPGGGTQFIHGADQYLDQIAKMVPDITWGHHIRVVMDAGCGVASFGAYLLPRNVITMSIAPKDVHENQIQFALERGAPAMVAAFATRRLPYPSQAFDLIHCSRCRINWTRDDGILLLEVNRMLRAGGYFAWAAQPVYKHEEAQEEHWKEMLDLTTRLCWELVKKEGYIAIWKKPTN**************LCDPDDNPDNVWYVDLKACIT*****************LRTS*************ARKELFKAESKYWNEIIESYVRALHWKKMKLRNVLDMRAGFGGFAAALIEQKFDCWVMNVVPVSGFNTLPVIYDRGLIGVMHDWCEPFDTYPRTYDLLHAAGLFSVESKRCNMSTIMLEMDRMLRPGGHVYIRDSIDVMDELQEIGKAMGWHVTLRET***PHASYRILTADKRLLHA
MKNPLSNTDLFKLSALLFVSFTFFYLGKRWSDGNQRILFFSSYT*********YVSLSPNLNKSFDISSLISQNQSLASPYIVPSPAPVDPLPPPPPPPPPERFGIVNEDGTMSDDFEIGEYDPDLVETEWNGDRNGTEATKSFKITRYEMCPGSMREYIPCLDNVEAIKQLKSTDKGERFERHCPLNGTGLNCLVPAPKGYKTPIPWPRSRNEVWYNNVPHSRLVEDKGGQNWISKEKDKFKFPGGGTQFIHGADQYLDQIAKMVPDITWGHHIRVVMDAGCGVASFGAYLLPRNVITMSIAPKDVHENQIQFALERGAPAMVAAFATRRLPYPSQAFDLIHCSRCRINWTRDDGILLLEVNRMLRAGGYFAWAAQPVYKHEEAQEEHWKEMLDLTTRLCWELVKKEGYIAIWKKPTNNSCYLNREAGTIPPLCDPDDNPDNVWYVDLKACITRLPENGYGANVSLWPERLRTSPDRLQSIQLDAFIARKELFKAESKYWNEIIESYVRALHWKKMKLRNVLDMRAGFGGFAAALIEQKFDCWVMNVVPVSGFNTLPVIYDRGLIGVMHDWCEPFDTYPRTYDLLHAAGLFSVESKRCNMSTIMLEMDRMLRPGGHVYIRDSIDVMDELQEIGKAMGWHVTLRETAEGPHASYRILTADKRLLHA
**NPLSNTDLFKLSALLFVSFTFFYLGKRWSDGNQRILFFSSY*********GYVSL**NLNKSFDIS*L***************************************************************************ITRYEMCPGSMREYIPCLDNVEAIKQLKSTDKGERFERHCPLNGTGLNCLVPAPKGYKTPIPWPRSRNEVWYNNVPHSRLVEDKGGQNWISKEKDKFKFPGGGTQFIHGADQYLDQIAKMVPDITWGHHIRVVMDAGCGVASFGAYLLPRNVITMSIAPKDVHENQIQFALERGAPAMVAAFATRRLPYPSQAFDLIHCSRCRINWTRDDGILLLEVNRMLRAGGYFAWAAQPVYKHEEAQEEHWKEMLDLTTRLCWELVKKEGYIAIWKKPTNNSCYLNREAGTIPPLCDPDDNPDNVWYVDLKACITRLPENGYGANVSLWPERLRTSPDRLQSIQLDAFIARKELFKAESKYWNEIIESYVRALHWKKMKLRNVLDMRAGFGGFAAALIEQKFDCWVMNVVPVSGFNTLPVIYDRGLIGVMHDWCEPFDTYPRTYDLLHAAGLFSVESKRCNMSTIMLEMDRMLRPGGHVYIRDSIDVMDELQEIGKAMGWHVTLRETAEGPHASYRILTADKRLLHA
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKNPLSNTDLFKLSALLFVSFTFFYLGKRWSDGNQRILFFSSYTSSRTSQQNGYVSLSPNLNKSFDISSLISQNQSLASPYIVPSPAPVDPLPPPPPPPPPERFGIVNEDGTMSDDFEIGEYDPDLVETEWNGDRNGTEATKSFKITRYEMCPGSMREYIPCLDNVEAIKQLKSTDKGERFERHCPLNGTGLNCLVPAPKGYKTPIPWPRSRNEVWYNNVPHSRLVEDKGGQNWISKEKDKFKFPGGGTQFIHGADQYLDQIAKMVPDITWGHHIRVVMDAGCGVASFGAYLLPRNVITMSIAPKDVHENQIQFALERGAPAMVAAFATRRLPYPSQAFDLIHCSRCRINWTRDDGILLLEVNRMLRAGGYFAWAAQPVYKHEEAQEEHWKEMLDLTTRLCWELVKKEGYIAIWKKPTNNSCYLNREAGTIPPLCDPDDNPDNVWYVDLKACITRLPENGYGANVSLWPERLRTSPDRLQSIQLDAFIARKELFKAESKYWNEIIESYVRALHWKKMKLRNVLDMRAGFGGFAAALIEQKFDCWVMNVVPVSGFNTLPVIYDRGLIGVMHDWCEPFDTYPRTYDLLHAAGLFSVESKRCNMSTIMLEMDRMLRPGGHVYIRDSIDVMDELQEIGKAMGWHVTLRETAEGPHASYRILTADKRLLHA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query666 2.2.26 [Sep-21-2011]
O22285694 Probable methyltransferas yes no 0.984 0.945 0.684 0.0
Q9FG39682 Probable methyltransferas no no 0.972 0.950 0.693 0.0
Q94KE1655 Probable methyltransferas no no 0.951 0.967 0.646 0.0
Q8L7V3829 Probable methyltransferas no no 0.807 0.648 0.450 1e-141
Q0WT31770 Probable methyltransferas no no 0.729 0.631 0.485 1e-141
Q9SD39895 Probable methyltransferas no no 0.740 0.550 0.483 1e-140
Q6NPR7770 Probable methyltransferas no no 0.803 0.694 0.452 1e-139
Q9LYN3610 Probable methyltransferas no no 0.711 0.777 0.485 1e-138
Q9SIZ3589 Probable methyltransferas no no 0.786 0.889 0.447 1e-138
Q93YV7608 Probable methyltransferas no no 0.732 0.802 0.471 1e-135
>sp|O22285|PMTB_ARATH Probable methyltransferase PMT11 OS=Arabidopsis thaliana GN=At2g39750 PE=2 SV=1 Back     alignment and function desciption
 Score =  988 bits (2553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/701 (68%), Positives = 556/701 (79%), Gaps = 45/701 (6%)

Query: 3   NPLSNTDLFK------LSALLFVSFTFFYLGKRWSD-GNQRILFFSSYTSSRTSQQNGYV 55
            PL+N DLFK      +SAL+FV+  FFYLGK WSD G Q+++FFSS TS  +  +   V
Sbjct: 2   KPLTNGDLFKSPTLIKISALVFVTVAFFYLGKHWSDDGYQQLVFFSSSTSGSSIPE---V 58

Query: 56  SLSPNLNKSFDISSLISQNQSLASPYIVPSPAPVDPLPPPPPPPPPE------------- 102
           S+SPN N+ F++S++I  N +      +  PA +   PP       +             
Sbjct: 59  SVSPNSNRVFNLSAIIPTNHTQ-----IEIPATIRQQPPSVVADTEKVKVEANPPPPPPP 113

Query: 103 ------------RFGIVNEDGTMSDDFEIGEYDPDLVE-----TEWNGDRNGTEATKSFK 145
                        FGIV+ +G MSDDFE+GE + D VE     TE    ++  ++    +
Sbjct: 114 SPSPPPPPGPVKSFGIVDANGVMSDDFEVGEVESDTVEDWGNQTEIVEAKSDGDSKARVR 173

Query: 146 ITRYEMCPGSMREYIPCLDNVEAIKQLKSTDKGERFERHCPLNGTGLNCLVPAPKGYKTP 205
           I ++ MCP SMREYIPCLDN + IK+LKST++GERFERHCP  G GLNCLVP PKGY+ P
Sbjct: 174 IKKFGMCPESMREYIPCLDNTDVIKKLKSTERGERFERHCPEKGKGLNCLVPPPKGYRQP 233

Query: 206 IPWPRSRNEVWYNNVPHSRLVEDKGGQNWISKEKDKFKFPGGGTQFIHGADQYLDQIAKM 265
           IPWP+SR+EVW++NVPH+RLVEDKGGQNWIS++K+KFKFPGGGTQFIHGADQYLDQ++KM
Sbjct: 234 IPWPKSRDEVWFSNVPHTRLVEDKGGQNWISRDKNKFKFPGGGTQFIHGADQYLDQMSKM 293

Query: 266 VPDITWGHHIRVVMDAGCGVASFGAYLLPRNVITMSIAPKDVHENQIQFALERGAPAMVA 325
           V DIT+G HIRV MD GCGVASFGAYLL R+V+TMS+APKDVHENQIQFALERG PAM A
Sbjct: 294 VSDITFGKHIRVAMDVGCGVASFGAYLLSRDVMTMSVAPKDVHENQIQFALERGVPAMAA 353

Query: 326 AFATRRLPYPSQAFDLIHCSRCRINWTRDDGILLLEVNRMLRAGGYFAWAAQPVYKHEEA 385
           AFATRRL YPSQAFDLIHCSRCRINWTRDDGILLLE+NRMLRAGGYFAWAAQPVYKHE A
Sbjct: 354 AFATRRLLYPSQAFDLIHCSRCRINWTRDDGILLLEINRMLRAGGYFAWAAQPVYKHEPA 413

Query: 386 QEEHWKEMLDLTTRLCWELVKKEGYIAIWKKPTNNSCYLNREAGTIPPLCDPDDNPDNVW 445
            EE W EML+LT  LCW+LVKKEGY+AIW+KP NN CYL+REAGT PPLCD  D+PDNVW
Sbjct: 414 LEEQWTEMLNLTISLCWKLVKKEGYVAIWQKPFNNDCYLSREAGTKPPLCDESDDPDNVW 473

Query: 446 YVDLKACITRLPENGYGANVSLWPERLRTSPDRLQSIQLDAFIARKELFKAESKYWNEII 505
           Y +LK CI+R+PE GYG NV LWP RL T PDRLQ+I+ D++IARKELFKAESKYWNEII
Sbjct: 474 YTNLKPCISRIPEKGYGGNVPLWPARLHTPPDRLQTIKFDSYIARKELFKAESKYWNEII 533

Query: 506 ESYVRALHWKKMKLRNVLDMRAGFGGFAAALIEQKFDCWVMNVVPVSGFNTLPVIYDRGL 565
             YVRAL WKKMKLRNVLDMRAGFGGFAAAL + K DCWV++VVPVSG NTLPVIYDRGL
Sbjct: 534 GGYVRALKWKKMKLRNVLDMRAGFGGFAAALNDHKLDCWVLSVVPVSGPNTLPVIYDRGL 593

Query: 566 IGVMHDWCEPFDTYPRTYDLLHAAGLFSVESKRCNMSTIMLEMDRMLRPGGHVYIRDSID 625
           +GVMHDWCEPFDTYPRTYD LHA+GLFS+E KRC MSTI+LEMDR+LRPGG  YIRDSID
Sbjct: 594 LGVMHDWCEPFDTYPRTYDFLHASGLFSIERKRCEMSTILLEMDRILRPGGRAYIRDSID 653

Query: 626 VMDELQEIGKAMGWHVTLRETAEGPHASYRILTADKRLLHA 666
           VMDE+QEI KAMGWH +LR+T+EGPHASYRILT +KRLL A
Sbjct: 654 VMDEIQEITKAMGWHTSLRDTSEGPHASYRILTCEKRLLRA 694

Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|Q9FG39|PMTC_ARATH Probable methyltransferase PMT12 OS=Arabidopsis thaliana GN=At5g06050 PE=2 SV=1 Back     alignment and function description
>sp|Q94KE1|PMTA_ARATH Probable methyltransferase PMT10 OS=Arabidopsis thaliana GN=At1g77260 PE=2 SV=1 Back     alignment and function description
>sp|Q8L7V3|PMTQ_ARATH Probable methyltransferase PMT26 OS=Arabidopsis thaliana GN=At5g64030 PE=1 SV=1 Back     alignment and function description
>sp|Q0WT31|PMTP_ARATH Probable methyltransferase PMT25 OS=Arabidopsis thaliana GN=At2g34300 PE=1 SV=2 Back     alignment and function description
>sp|Q9SD39|PMTR_ARATH Probable methyltransferase PMT27 OS=Arabidopsis thaliana GN=At3g51070 PE=3 SV=1 Back     alignment and function description
>sp|Q6NPR7|PMTO_ARATH Probable methyltransferase PMT24 OS=Arabidopsis thaliana GN=At1g29470 PE=1 SV=1 Back     alignment and function description
>sp|Q9LYN3|PMTM_ARATH Probable methyltransferase PMT22 OS=Arabidopsis thaliana GN=At3g56080 PE=3 SV=1 Back     alignment and function description
>sp|Q9SIZ3|PMTN_ARATH Probable methyltransferase PMT23 OS=Arabidopsis thaliana GN=At2g40280 PE=1 SV=2 Back     alignment and function description
>sp|Q93YV7|PMT3_ARATH Probable methyltransferase PMT3 OS=Arabidopsis thaliana GN=At4g14360 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query666
255566464673 ATP binding protein, putative [Ricinus c 0.983 0.973 0.730 0.0
224101039664 predicted protein [Populus trichocarpa] 0.977 0.980 0.737 0.0
449465844678 PREDICTED: probable methyltransferase PM 0.989 0.971 0.711 0.0
224109464669 predicted protein [Populus trichocarpa] 0.978 0.974 0.740 0.0
297827583689 dehydration-responsive family protein [A 0.981 0.949 0.698 0.0
18405149694 putative methyltransferase PMT11 [Arabid 0.984 0.945 0.684 0.0
356569344663 PREDICTED: probable methyltransferase PM 0.981 0.986 0.702 0.0
225449394686 PREDICTED: probable methyltransferase PM 0.990 0.962 0.712 0.0
449441370678 PREDICTED: probable methyltransferase PM 0.996 0.979 0.709 0.0
449476436679 PREDICTED: probable methyltransferase PM 0.996 0.977 0.711 0.0
>gi|255566464|ref|XP_002524217.1| ATP binding protein, putative [Ricinus communis] gi|223536494|gb|EEF38141.1| ATP binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1038 bits (2683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 497/680 (73%), Positives = 568/680 (83%), Gaps = 25/680 (3%)

Query: 1   MKNPLSNTDLFK------LSALLFVSFTFFYLGKRWS-DGNQRILFFSSYTSSRTSQQNG 53
           MK+  +N DL K      ++A   +S TFFYLGK WS +G Q+++FFS+ T S       
Sbjct: 1   MKSLNTNMDLLKTPLVLKITAFCLLSITFFYLGKHWSSNGYQQLIFFSTPTES------- 53

Query: 54  YVSLSPNLNKSFDISSLISQNQSLASP-----YIVPSPAPVDPLPPPPPPPPPERFGIVN 108
            VS+SPNLNK F+I+ LI+QNQS   P      + P+PAP+D             FG+++
Sbjct: 54  -VSISPNLNKPFNITDLIAQNQSQIVPDKTQNVVSPTPAPIDQNSVGSDSDSNRTFGVID 112

Query: 109 EDGTMSDDFEIGEYDPDLVETEWNGDRNGTEATKS---FK-ITRYEMCPGSMREYIPCLD 164
            DG M+DDFE+GE+DP++VE+ W  +    E+  S   FK I R+++CP SMRE IPCLD
Sbjct: 113 SDGKMTDDFEVGEFDPEIVES-WGNESGVVESGDSDVKFKGIKRFDLCPESMRERIPCLD 171

Query: 165 NVEAIKQLKSTDKGERFERHCPLNGTGLNCLVPAPKGYKTPIPWPRSRNEVWYNNVPHSR 224
           NVEAIK+LKST++GE+FERHCP  G GLNCLVP PKGYK PIPWPRSR+EVW++NVPHSR
Sbjct: 172 NVEAIKELKSTERGEKFERHCPQEGKGLNCLVPPPKGYKQPIPWPRSRDEVWFSNVPHSR 231

Query: 225 LVEDKGGQNWISKEKDKFKFPGGGTQFIHGADQYLDQIAKMVPDITWGHHIRVVMDAGCG 284
           LVEDKGGQNWI KEK+KFKFPGGGTQFIHGADQYL+QI+KMVP+I +G H RVV+D GCG
Sbjct: 232 LVEDKGGQNWIYKEKNKFKFPGGGTQFIHGADQYLNQISKMVPEIAFGSHTRVVLDVGCG 291

Query: 285 VASFGAYLLPRNVITMSIAPKDVHENQIQFALERGAPAMVAAFATRRLPYPSQAFDLIHC 344
           VASFGAYLL RNV+TMS+APKDVHENQIQFALERG PAMV AFAT RL YPSQAF++IHC
Sbjct: 292 VASFGAYLLSRNVLTMSVAPKDVHENQIQFALERGVPAMVVAFATHRLLYPSQAFEIIHC 351

Query: 345 SRCRINWTRDDGILLLEVNRMLRAGGYFAWAAQPVYKHEEAQEEHWKEMLDLTTRLCWEL 404
           SRCRINWTRDDGILLLEVNRMLRAGGYFAWAAQPVYKHE   EE W+EML+LTTRLCW L
Sbjct: 352 SRCRINWTRDDGILLLEVNRMLRAGGYFAWAAQPVYKHEAILEEQWEEMLNLTTRLCWTL 411

Query: 405 VKKEGYIAIWKKPTNNSCYLNREAGTIPPLCDPDDNPDNVWYVDLKACITRLPENGYGAN 464
           VKKEGYIAIW+KP NNSCYL+RE GT PPLCDPDDNPDNVWYVDLKACITRLPE+GYGAN
Sbjct: 412 VKKEGYIAIWQKPINNSCYLSREEGTKPPLCDPDDNPDNVWYVDLKACITRLPEDGYGAN 471

Query: 465 VSLWPERLRTSPDRLQSIQLDAFIARKELFKAESKYWNEIIESYVRALHWKKMKLRNVLD 524
           ++ WP RL T PDRLQSIQLDA+I+RKELFKAESKYW EII  YVRA HWKK KLRNVLD
Sbjct: 472 ITTWPARLHTPPDRLQSIQLDAYISRKELFKAESKYWYEIIAGYVRAWHWKKFKLRNVLD 531

Query: 525 MRAGFGGFAAALIEQKFDCWVMNVVPVSGFNTLPVIYDRGLIGVMHDWCEPFDTYPRTYD 584
           M+AGFGGFAAALI+Q+FDCWV+NVVP+SG NTLPVIYDRGL+GVMHDWCEPFDTYPRTYD
Sbjct: 532 MKAGFGGFAAALIDQQFDCWVLNVVPISGPNTLPVIYDRGLLGVMHDWCEPFDTYPRTYD 591

Query: 585 LLHAAGLFSVESKRCNMSTIMLEMDRMLRPGGHVYIRDSIDVMDELQEIGKAMGWHVTLR 644
           LLHA GLFS+E KRC++STIMLEMDR+LRPGG  YIRD++DVMDELQE  KAMGWHV L 
Sbjct: 592 LLHANGLFSIEKKRCSISTIMLEMDRILRPGGRAYIRDTLDVMDELQETAKAMGWHVALH 651

Query: 645 ETAEGPHASYRILTADKRLL 664
           +T+EGPHASYRILT DKRLL
Sbjct: 652 DTSEGPHASYRILTCDKRLL 671

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224101039|ref|XP_002312116.1| predicted protein [Populus trichocarpa] gi|222851936|gb|EEE89483.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449465844|ref|XP_004150637.1| PREDICTED: probable methyltransferase PMT11-like [Cucumis sativus] gi|449516433|ref|XP_004165251.1| PREDICTED: probable methyltransferase PMT11-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224109464|ref|XP_002315205.1| predicted protein [Populus trichocarpa] gi|222864245|gb|EEF01376.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297827583|ref|XP_002881674.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. lyrata] gi|297327513|gb|EFH57933.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18405149|ref|NP_030521.1| putative methyltransferase PMT11 [Arabidopsis thaliana] gi|75097411|sp|O22285.1|PMTB_ARATH RecName: Full=Probable methyltransferase PMT11 gi|2642157|gb|AAB87124.1| expressed protein [Arabidopsis thaliana] gi|15450749|gb|AAK96646.1| At2g39750/T5I7.5 [Arabidopsis thaliana] gi|21700885|gb|AAM70566.1| At2g39750/T5I7.5 [Arabidopsis thaliana] gi|330254624|gb|AEC09718.1| putative methyltransferase PMT11 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356569344|ref|XP_003552862.1| PREDICTED: probable methyltransferase PMT11-like [Glycine max] Back     alignment and taxonomy information
>gi|225449394|ref|XP_002282557.1| PREDICTED: probable methyltransferase PMT11 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449441370|ref|XP_004138455.1| PREDICTED: probable methyltransferase PMT11-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449476436|ref|XP_004154736.1| PREDICTED: probable methyltransferase PMT11-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query666
TAIR|locus:2063947694 AT2G39750 [Arabidopsis thalian 0.843 0.809 0.755 2.3e-260
TAIR|locus:2153704682 AT5G06050 [Arabidopsis thalian 0.971 0.948 0.678 6.2e-252
TAIR|locus:2195955655 AT1G77260 [Arabidopsis thalian 0.839 0.853 0.690 4.8e-229
TAIR|locus:2160806829 AT5G64030 [Arabidopsis thalian 0.773 0.621 0.467 5.9e-128
TAIR|locus:2040864770 AT2G34300 [Arabidopsis thalian 0.786 0.680 0.457 8.7e-127
TAIR|locus:2080823895 AT3G51070 [Arabidopsis thalian 0.729 0.543 0.478 2.9e-126
TAIR|locus:2063078589 AT2G40280 [Arabidopsis thalian 0.725 0.820 0.473 9.9e-126
TAIR|locus:2013628770 AT1G29470 [Arabidopsis thalian 0.779 0.674 0.453 1.6e-125
TAIR|locus:2018329623 AT1G04430 [Arabidopsis thalian 0.755 0.807 0.455 4.5e-124
TAIR|locus:2090935611 AT3G23300 [Arabidopsis thalian 0.803 0.875 0.441 2.4e-122
TAIR|locus:2063947 AT2G39750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2358 (835.1 bits), Expect = 2.3e-260, Sum P(2) = 2.3e-260
 Identities = 430/569 (75%), Positives = 485/569 (85%)

Query:   104 FGIVNEDGTMSDDFEIGEYDPDLVETEWNGDRNGTEA-----TKS-FKITRYEMCPGSMR 157
             FGIV+ +G MSDDFE+GE + D VE +W       EA     +K+  +I ++ MCP SMR
Sbjct:   127 FGIVDANGVMSDDFEVGEVESDTVE-DWGNQTEIVEAKSDGDSKARVRIKKFGMCPESMR 185

Query:   158 EYIPCLDNVEAIKQLKSTDKGERFERHCPLNGTGLNCLVPAPKGYKTPIPWPRSRNEVWY 217
             EYIPCLDN + IK+LKST++GERFERHCP  G GLNCLVP PKGY+ PIPWP+SR+EVW+
Sbjct:   186 EYIPCLDNTDVIKKLKSTERGERFERHCPEKGKGLNCLVPPPKGYRQPIPWPKSRDEVWF 245

Query:   218 NNVPHSRLVEDKGGQNWISKEKDKFKFPGGGTQFIHGADQYLDQIAKMVPDITWGHHIRV 277
             +NVPH+RLVEDKGGQNWIS++K+KFKFPGGGTQFIHGADQYLDQ++KMV DIT+G HIRV
Sbjct:   246 SNVPHTRLVEDKGGQNWISRDKNKFKFPGGGTQFIHGADQYLDQMSKMVSDITFGKHIRV 305

Query:   278 VMDAGCGVASFGAYLLPRNVITMSIAPKDVHENQIQFALERGAPAMVAAFATRRLPYPSQ 337
              MD GCGVASFGAYLL R+V+TMS+APKDVHENQIQFALERG PAM AAFATRRL YPSQ
Sbjct:   306 AMDVGCGVASFGAYLLSRDVMTMSVAPKDVHENQIQFALERGVPAMAAAFATRRLLYPSQ 365

Query:   338 AFDLIHCSRCRINWTRDDGILLLEVNRMLRAGGYFAWAAQPVYKHEEAQEEHWKEMLDLT 397
             AFDLIHCSRCRINWTRDDGILLLE+NRMLRAGGYFAWAAQPVYKHE A EE W EML+LT
Sbjct:   366 AFDLIHCSRCRINWTRDDGILLLEINRMLRAGGYFAWAAQPVYKHEPALEEQWTEMLNLT 425

Query:   398 TRLCWELVKKEGYIAIWKKPTNNSCYLNREAGTIXXXXXXXXXXXXVWYVDLKACITRLP 457
               LCW+LVKKEGY+AIW+KP NN CYL+REAGT             VWY +LK CI+R+P
Sbjct:   426 ISLCWKLVKKEGYVAIWQKPFNNDCYLSREAGTKPPLCDESDDPDNVWYTNLKPCISRIP 485

Query:   458 ENGYGANVSLWPERLRTSPDRLQSIQLDAFIARKELFKAESKYWNEIIESYVRALHWKKM 517
             E GYG NV LWP RL T PDRLQ+I+ D++IARKELFKAESKYWNEII  YVRAL WKKM
Sbjct:   486 EKGYGGNVPLWPARLHTPPDRLQTIKFDSYIARKELFKAESKYWNEIIGGYVRALKWKKM 545

Query:   518 KLRNVLDMRAGFGGFAAALIEQKFDCWVMNVVPVSGFNTLPVIYDRGLIGVMHDWCEPFD 577
             KLRNVLDMRAGFGGFAAAL + K DCWV++VVPVSG NTLPVIYDRGL+GVMHDWCEPFD
Sbjct:   546 KLRNVLDMRAGFGGFAAALNDHKLDCWVLSVVPVSGPNTLPVIYDRGLLGVMHDWCEPFD 605

Query:   578 TYPRTYDLLHAAGLFSVESKRCNMSTIMLEMDRMLRPGGHVYIRDSIDVMDELQEIGKAM 637
             TYPRTYD LHA+GLFS+E KRC MSTI+LEMDR+LRPGG  YIRDSIDVMDE+QEI KAM
Sbjct:   606 TYPRTYDFLHASGLFSIERKRCEMSTILLEMDRILRPGGRAYIRDSIDVMDEIQEITKAM 665

Query:   638 GWHVTLRETAEGPHASYRILTADKRLLHA 666
             GWH +LR+T+EGPHASYRILT +KRLL A
Sbjct:   666 GWHTSLRDTSEGPHASYRILTCEKRLLRA 694
GO:0005794 "Golgi apparatus" evidence=ISM;IDA
GO:0008168 "methyltransferase activity" evidence=IEA
GO:0005768 "endosome" evidence=IDA
GO:0005802 "trans-Golgi network" evidence=IDA
TAIR|locus:2153704 AT5G06050 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2195955 AT1G77260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2160806 AT5G64030 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040864 AT2G34300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2080823 AT3G51070 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2063078 AT2G40280 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2013628 AT1G29470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2018329 AT1G04430 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090935 AT3G23300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O22285PMTB_ARATH2, ., 1, ., 1, ., -0.68470.98490.9452yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query666
pfam03141506 pfam03141, Methyltransf_29, Putative S-adenosyl-L- 0.0
pfam0824192 pfam08241, Methyltransf_11, Methyltransferase doma 1e-08
pfam0824298 pfam08242, Methyltransf_12, Methyltransferase doma 3e-06
pfam1364997 pfam13649, Methyltransf_25, Methyltransferase doma 0.001
pfam05308248 pfam05308, Mito_fiss_reg, Mitochondrial fission re 0.002
>gnl|CDD|217386 pfam03141, Methyltransf_29, Putative S-adenosyl-L-methionine-dependent methyltransferase Back     alignment and domain information 
 Score =  876 bits (2266), Expect = 0.0
 Identities = 305/510 (59%), Positives = 367/510 (71%), Gaps = 10/510 (1%)

Query: 158 EYIPCLDNVEAIKQLKSTDKGERFERHCPLNGTGLNCLVPAPKGYKTPIPWPRSRNEVWY 217
           +YIPCLDN  AIK L S ++ E  ERHCP +   L CLVP P GYKTPIPWP+SR++VWY
Sbjct: 1   DYIPCLDNDRAIKFLLSRERMEHRERHCPPSEEKLRCLVPPPDGYKTPIPWPKSRDKVWY 60

Query: 218 NNVPHSRLVEDKGGQNWISKEKDKFKFPGGGTQFIHGADQYLDQIAKMVPDITWGHHIRV 277
            NVPH++L E+KGGQNW+  E DKF+FPGGGTQF HGAD Y+D +A+M+PDI WG  +R 
Sbjct: 61  ANVPHTKLAEEKGGQNWVKVEGDKFRFPGGGTQFPHGADAYIDFLAQMIPDIAWGGRVRT 120

Query: 278 VMDAGCGVASFGAYLLPRNVITMSIAPKDVHENQIQFALERGAPAMVAAFATRRLPYPSQ 337
            +D GCGVASFGAYLL R+V+TMS APKDVHE Q+QFALERG PAM+    TRRLPYPS+
Sbjct: 121 ALDVGCGVASFGAYLLSRDVLTMSFAPKDVHEAQVQFALERGVPAMLGVLGTRRLPYPSR 180

Query: 338 AFDLIHCSRCRINWTRDDGILLLEVNRMLRAGGYFAWAAQPVY-KHEEAQEEHWKEMLDL 396
           +FD+ HCSRC I W  +DGILLLEV+R+LR GGYF  +  PVY + EE  +E WK M  L
Sbjct: 181 SFDMAHCSRCLIPWHANDGILLLEVDRVLRPGGYFVLSGPPVYARDEEDLQEEWKAMEAL 240

Query: 397 TTRLCWELVKKEGYIAIWKKPTNNSCYLNREAGTIPPLCDPDDNPDNVWYVDLKACITRL 456
              LCW+LV K+G IAIW+KP NNSCY  RE G  PPLC   D+PD  WYV ++ACIT L
Sbjct: 241 AKSLCWKLVAKKGDIAIWQKPVNNSCYNKREPGKKPPLCKDSDDPDAAWYVPMEACITPL 300

Query: 457 PEN---GYGANVSLWPERLRTSPDRLQSIQLDAFIARKELFKAESKYWNEIIESYVRALH 513
           PE      G  +  WPERL   P RL S Q        E FKA+++ W   +  Y R L 
Sbjct: 301 PEVSHEVGGGWLEKWPERLTAVPPRLASGQ--IGGVSAEAFKADTELWKRRVSKYKRLLK 358

Query: 514 --WKKMKLRNVLDMRAGFGGFAAALIEQKFDCWVMNVVPVSGFNTLPVIYDRGLIGVMHD 571
               K ++RNV+DM AGFGGFAAALI+     WVMNVVPV   +TLPVIYDRGLIG+ HD
Sbjct: 359 LLIDKGRVRNVMDMNAGFGGFAAALIDDP--VWVMNVVPVDSPDTLPVIYDRGLIGIYHD 416

Query: 572 WCEPFDTYPRTYDLLHAAGLFSVESKRCNMSTIMLEMDRMLRPGGHVYIRDSIDVMDELQ 631
           WCEPF TYPRTYDLLHA  LFS+  KRCN+  I+LEMDR+LRPGG V IRD +DV+D+++
Sbjct: 417 WCEPFSTYPRTYDLLHADHLFSLYKKRCNLEDILLEMDRILRPGGAVIIRDDVDVLDKVK 476

Query: 632 EIGKAMGWHVTLRETAEGPHASYRILTADK 661
           +I KAM W V + +T +GPH   +IL A K
Sbjct: 477 KIAKAMRWEVRITDTEDGPHDPEKILIAQK 506

This family is a putative S-adenosyl-L-methionine (SAM)-dependent methyltransferase. Length = 506
>gnl|CDD|219759 pfam08241, Methyltransf_11, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|219760 pfam08242, Methyltransf_12, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|222287 pfam13649, Methyltransf_25, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|218549 pfam05308, Mito_fiss_reg, Mitochondrial fission regulator Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 666
PF03141506 Methyltransf_29: Putative S-adenosyl-L-methionine- 100.0
PF03141 506 Methyltransf_29: Putative S-adenosyl-L-methionine- 99.95
PLN02336475 phosphoethanolamine N-methyltransferase 99.88
PRK10258251 biotin biosynthesis protein BioC; Provisional 99.7
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 99.62
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 99.56
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 99.54
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 99.5
KOG2940325 consensus Predicted methyltransferase [General fun 99.48
PLN02233261 ubiquinone biosynthesis methyltransferase 99.47
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 99.45
PLN02244340 tocopherol O-methyltransferase 99.44
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 99.43
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 99.42
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 99.41
TIGR00740239 methyltransferase, putative. A simple BLAST search 99.39
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 99.39
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 99.39
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 99.39
KOG4300252 consensus Predicted methyltransferase [General fun 99.38
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 99.37
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 99.37
KOG1540296 consensus Ubiquinone biosynthesis methyltransferas 99.35
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 99.35
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 99.34
PRK11207197 tellurite resistance protein TehB; Provisional 99.33
PRK05785226 hypothetical protein; Provisional 99.32
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 99.32
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 99.32
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 99.31
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 99.29
TIGR00452314 methyltransferase, putative. Known examples to dat 99.27
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 99.27
PLN02490340 MPBQ/MSBQ methyltransferase 99.27
PLN02336475 phosphoethanolamine N-methyltransferase 99.25
PRK08317241 hypothetical protein; Provisional 99.24
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 99.23
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 99.23
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 99.2
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 99.2
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 99.2
PRK12335287 tellurite resistance protein TehB; Provisional 99.18
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 99.17
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 99.16
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 99.13
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 99.13
KOG1270282 consensus Methyltransferases [Coenzyme transport a 99.12
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 99.12
PRK06922677 hypothetical protein; Provisional 99.11
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 99.09
COG4106257 Tam Trans-aconitate methyltransferase [General fun 99.09
PLN02585315 magnesium protoporphyrin IX methyltransferase 99.09
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 99.08
KOG1271227 consensus Methyltransferases [General function pre 99.07
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 99.06
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 99.04
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 99.04
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 99.04
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 99.04
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 99.02
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 99.01
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 99.01
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 99.01
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 99.0
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 99.0
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 99.0
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 99.0
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 98.99
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 98.98
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 98.98
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 98.97
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 98.97
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 98.96
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 98.96
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 98.96
COG4976287 Predicted methyltransferase (contains TPR repeat) 98.96
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 98.96
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 98.96
PRK14967223 putative methyltransferase; Provisional 98.96
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 98.96
PRK06202232 hypothetical protein; Provisional 98.96
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 98.95
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 98.94
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 98.93
KOG1541270 consensus Predicted protein carboxyl methylase [Ge 98.93
PLN02244340 tocopherol O-methyltransferase 98.92
PLN02233261 ubiquinone biosynthesis methyltransferase 98.92
PRK10258251 biotin biosynthesis protein BioC; Provisional 98.91
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 98.91
PRK14121390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 98.9
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 98.89
PRK13255218 thiopurine S-methyltransferase; Reviewed 98.88
PRK11207197 tellurite resistance protein TehB; Provisional 98.87
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 98.87
PLN03075296 nicotianamine synthase; Provisional 98.86
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 98.86
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 98.86
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 98.85
TIGR03438301 probable methyltransferase. This model represents 98.84
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 98.84
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 98.84
KOG3010261 consensus Methyltransferase [General function pred 98.83
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 98.82
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 98.82
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 98.82
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 98.81
PRK12335287 tellurite resistance protein TehB; Provisional 98.79
PRK07402196 precorrin-6B methylase; Provisional 98.79
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 98.79
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 98.78
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 98.77
PRK14968188 putative methyltransferase; Provisional 98.77
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 98.76
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 98.76
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 98.76
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 98.72
TIGR00438188 rrmJ cell division protein FtsJ. 98.71
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 98.7
PF05219265 DREV: DREV methyltransferase; InterPro: IPR007884 98.7
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 98.68
COG4123248 Predicted O-methyltransferase [General function pr 98.68
PRK13256226 thiopurine S-methyltransferase; Reviewed 98.68
PRK04266226 fibrillarin; Provisional 98.68
PF05148219 Methyltransf_8: Hypothetical methyltransferase; In 98.67
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 98.67
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 98.67
PLN02232160 ubiquinone biosynthesis methyltransferase 98.66
TIGR00452314 methyltransferase, putative. Known examples to dat 98.66
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 98.66
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 98.65
PRK05785226 hypothetical protein; Provisional 98.64
PRK00811283 spermidine synthase; Provisional 98.62
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 98.61
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 98.61
PF03291331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 98.6
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 98.6
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 98.59
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 98.59
KOG2361264 consensus Predicted methyltransferase [General fun 98.58
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 98.58
PRK14968188 putative methyltransferase; Provisional 98.58
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 98.56
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 98.56
COG4976287 Predicted methyltransferase (contains TPR repeat) 98.56
PTZ00146293 fibrillarin; Provisional 98.55
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 98.55
TIGR00536284 hemK_fam HemK family putative methylases. The gene 98.55
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 98.54
PRK10901427 16S rRNA methyltransferase B; Provisional 98.53
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 98.51
PLN02490340 MPBQ/MSBQ methyltransferase 98.5
smart00650169 rADc Ribosomal RNA adenine dimethylases. 98.5
PRK08317241 hypothetical protein; Provisional 98.49
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 98.49
KOG1975389 consensus mRNA cap methyltransferase [RNA processi 98.48
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 98.48
KOG3045325 consensus Predicted RNA methylase involved in rRNA 98.48
TIGR00740239 methyltransferase, putative. A simple BLAST search 98.48
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 98.46
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 98.45
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 98.45
PRK13943322 protein-L-isoaspartate O-methyltransferase; Provis 98.45
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 98.45
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 98.45
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 98.44
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 98.43
PRK04457262 spermidine synthase; Provisional 98.43
PRK14901434 16S rRNA methyltransferase B; Provisional 98.42
COG2890280 HemK Methylase of polypeptide chain release factor 98.42
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 98.41
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 98.41
PRK14904445 16S rRNA methyltransferase B; Provisional 98.41
PRK14903431 16S rRNA methyltransferase B; Provisional 98.4
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 98.39
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 98.39
KOG1540296 consensus Ubiquinone biosynthesis methyltransferas 98.39
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 98.38
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 98.38
PF05891218 Methyltransf_PK: AdoMet dependent proline di-methy 98.36
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 98.35
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 98.35
PF02390195 Methyltransf_4: Putative methyltransferase ; Inter 98.34
PRK06922677 hypothetical protein; Provisional 98.34
PLN02366308 spermidine synthase 98.32
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 98.31
PRK04266226 fibrillarin; Provisional 98.31
PRK06202232 hypothetical protein; Provisional 98.31
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 98.3
PHA03411279 putative methyltransferase; Provisional 98.3
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 98.29
TIGR00438188 rrmJ cell division protein FtsJ. 98.29
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 98.28
PF06080204 DUF938: Protein of unknown function (DUF938); Inte 98.27
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 98.26
PRK14902444 16S rRNA methyltransferase B; Provisional 98.25
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 98.25
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 98.23
COG0220227 Predicted S-adenosylmethionine-dependent methyltra 98.22
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 98.21
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 98.2
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 98.19
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 98.19
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 98.19
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 98.18
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 98.18
PTZ00146293 fibrillarin; Provisional 98.18
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 98.18
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 98.18
PRK01581374 speE spermidine synthase; Validated 98.18
PF05724218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 98.16
PRK14121 390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 98.16
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 98.16
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 98.16
PRK03612521 spermidine synthase; Provisional 98.15
PRK13255218 thiopurine S-methyltransferase; Reviewed 98.15
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 98.15
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 98.15
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 98.14
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 98.13
PHA03412241 putative methyltransferase; Provisional 98.12
PRK14967223 putative methyltransferase; Provisional 98.12
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 98.1
KOG4300252 consensus Predicted methyltransferase [General fun 98.09
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 98.08
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 98.07
PF01739196 CheR: CheR methyltransferase, SAM binding domain; 98.05
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 98.04
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 98.04
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 98.04
COG0500257 SmtA SAM-dependent methyltransferases [Secondary m 98.04
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 98.03
TIGR00536284 hemK_fam HemK family putative methylases. The gene 98.03
TIGR00478228 tly hemolysin TlyA family protein. Hemolysins are 98.03
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 98.02
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 98.02
KOG2899288 consensus Predicted methyltransferase [General fun 98.02
PF12147311 Methyltransf_20: Putative methyltransferase; Inter 98.01
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 98.01
PRK10611287 chemotaxis methyltransferase CheR; Provisional 98.0
COG2890280 HemK Methylase of polypeptide chain release factor 97.99
KOG1270282 consensus Methyltransferases [Coenzyme transport a 97.99
KOG3010261 consensus Methyltransferase [General function pred 97.98
KOG2904328 consensus Predicted methyltransferase [General fun 97.97
PF05148219 Methyltransf_8: Hypothetical methyltransferase; In 97.97
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 97.96
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 97.94
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 97.94
PRK07402196 precorrin-6B methylase; Provisional 97.93
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 97.92
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 97.92
PRK11727321 23S rRNA mA1618 methyltransferase; Provisional 97.92
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 97.91
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 97.9
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 97.9
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 97.9
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 97.89
COG1041347 Predicted DNA modification methylase [DNA replicat 97.88
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 97.86
KOG1499346 consensus Protein arginine N-methyltransferase PRM 97.85
TIGR03438301 probable methyltransferase. This model represents 97.84
PF07942270 N2227: N2227-like protein; InterPro: IPR012901 Thi 97.83
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 97.81
KOG1331293 consensus Predicted methyltransferase [General fun 97.81
PRK14896258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 97.8
PRK00274272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 97.79
PF01728181 FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 97.79
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 97.79
COG4122219 Predicted O-methyltransferase [General function pr 97.78
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 97.76
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 97.76
PLN02672 1082 methionine S-methyltransferase 97.75
PF05185448 PRMT5: PRMT5 arginine-N-methyltransferase; InterPr 97.74
COG4123248 Predicted O-methyltransferase [General function pr 97.73
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 97.72
COG0421282 SpeE Spermidine synthase [Amino acid transport and 97.72
PRK04457262 spermidine synthase; Provisional 97.7
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 97.7
TIGR00755253 ksgA dimethyladenosine transferase. Alternate name 97.69
PLN02476278 O-methyltransferase 97.69
PF02390195 Methyltransf_4: Putative methyltransferase ; Inter 97.68
COG4106257 Tam Trans-aconitate methyltransferase [General fun 97.66
COG1352268 CheR Methylase of chemotaxis methyl-accepting prot 97.66
PLN02823336 spermine synthase 97.62
KOG1541270 consensus Predicted protein carboxyl methylase [Ge 97.6
PRK04338382 N(2),N(2)-dimethylguanosine tRNA methyltransferase 97.6
PRK04148134 hypothetical protein; Provisional 97.57
KOG3045325 consensus Predicted RNA methylase involved in rRNA 97.56
KOG3987288 consensus Uncharacterized conserved protein DREV/C 97.56
PTZ00338294 dimethyladenosine transferase-like protein; Provis 97.56
PF05891218 Methyltransf_PK: AdoMet dependent proline di-methy 97.54
COG2263198 Predicted RNA methylase [Translation, ribosomal st 97.53
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 97.53
TIGR00095189 RNA methyltransferase, RsmD family. This model rep 97.52
KOG1269364 consensus SAM-dependent methyltransferases [Lipid 97.51
PF02527184 GidB: rRNA small subunit methyltransferase G; Inte 97.51
PLN02232160 ubiquinone biosynthesis methyltransferase 97.5
PF11968219 DUF3321: Putative methyltransferase (DUF3321); Int 97.47
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 97.44
PRK00536262 speE spermidine synthase; Provisional 97.43
KOG3178342 consensus Hydroxyindole-O-methyltransferase and re 97.42
PF02475200 Met_10: Met-10+ like-protein; InterPro: IPR003402 97.41
KOG1661237 consensus Protein-L-isoaspartate(D-aspartate) O-me 97.4
KOG3191209 consensus Predicted N6-DNA-methyltransferase [Tran 97.38
PLN02585315 magnesium protoporphyrin IX methyltransferase 97.37
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 97.35
PF05219265 DREV: DREV methyltransferase; InterPro: IPR007884 97.35
PRK00811283 spermidine synthase; Provisional 97.35
PF01234256 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: I 97.33
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 97.32
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism 97.31
PRK14902444 16S rRNA methyltransferase B; Provisional 97.31
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 97.3
PRK01581374 speE spermidine synthase; Validated 97.3
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 97.3
PRK11933470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 97.29
PLN02589247 caffeoyl-CoA O-methyltransferase 97.26
PRK13943322 protein-L-isoaspartate O-methyltransferase; Provis 97.26
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 97.25
PRK14903431 16S rRNA methyltransferase B; Provisional 97.23
PRK10901427 16S rRNA methyltransferase B; Provisional 97.22
PRK14904445 16S rRNA methyltransferase B; Provisional 97.22
PF09243274 Rsm22: Mitochondrial small ribosomal subunit Rsm22 97.21
PRK14901434 16S rRNA methyltransferase B; Provisional 97.2
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 97.19
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 97.16
PRK05031362 tRNA (uracil-5-)-methyltransferase; Validated 97.16
TIGR02143353 trmA_only tRNA (uracil-5-)-methyltransferase. This 97.13
COG0220227 Predicted S-adenosylmethionine-dependent methyltra 97.1
KOG1271227 consensus Methyltransferases [General function pre 97.08
KOG2361264 consensus Predicted methyltransferase [General fun 97.08
PF03602183 Cons_hypoth95: Conserved hypothetical protein 95; 97.07
KOG2352482 consensus Predicted spermine/spermidine synthase [ 97.05
PF05185 448 PRMT5: PRMT5 arginine-N-methyltransferase; InterPr 97.05
TIGR03439319 methyl_EasF probable methyltransferase domain, Eas 97.02
PF01728181 FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 97.01
COG2265432 TrmA SAM-dependent methyltransferases related to t 97.0
KOG1500517 consensus Protein arginine N-methyltransferase CAR 97.0
PLN02366308 spermidine synthase 97.0
COG2521287 Predicted archaeal methyltransferase [General func 96.99
TIGR00478228 tly hemolysin TlyA family protein. Hemolysins are 96.98
COG1092393 Predicted SAM-dependent methyltransferases [Genera 96.95
KOG2904328 consensus Predicted methyltransferase [General fun 96.94
COG2521287 Predicted archaeal methyltransferase [General func 96.9
PLN03075296 nicotianamine synthase; Provisional 96.89
KOG3420185 consensus Predicted RNA methylase [Translation, ri 96.88
PF02384311 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T 96.88
PRK13256226 thiopurine S-methyltransferase; Reviewed 96.86
COG0742187 N6-adenine-specific methylase [DNA replication, re 96.86
PF02527184 GidB: rRNA small subunit methyltransferase G; Inte 96.84
PHA03411279 putative methyltransferase; Provisional 96.83
PRK03612521 spermidine synthase; Provisional 96.8
PF10672286 Methyltrans_SAM: S-adenosylmethionine-dependent me 96.77
COG0030259 KsgA Dimethyladenosine transferase (rRNA methylati 96.76
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 96.71
PLN02476278 O-methyltransferase 96.68
PF06080204 DUF938: Protein of unknown function (DUF938); Inte 96.63
COG0500257 SmtA SAM-dependent methyltransferases [Secondary m 96.57
PF05724218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 96.56
PRK04148134 hypothetical protein; Provisional 96.55
PF03291331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 96.52
KOG0820315 consensus Ribosomal RNA adenine dimethylase [RNA p 96.51
smart00650169 rADc Ribosomal RNA adenine dimethylases. 96.5
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 96.49
TIGR02987524 met_A_Alw26 type II restriction m6 adenine DNA met 96.49
KOG1663237 consensus O-methyltransferase [Secondary metabolit 96.48
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 96.44
PRK11760357 putative 23S rRNA C2498 ribose 2'-O-ribose methylt 96.42
COG2520341 Predicted methyltransferase [General function pred 96.41
COG0357215 GidB Predicted S-adenosylmethionine-dependent meth 96.41
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 96.39
TIGR00308374 TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi 96.39
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 96.25
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 96.18
PHA03412241 putative methyltransferase; Provisional 96.14
COG0293205 FtsJ 23S rRNA methylase [Translation, ribosomal st 96.08
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translat 96.01
KOG2915314 consensus tRNA(1-methyladenosine) methyltransferas 96.0
PF13679141 Methyltransf_32: Methyltransferase domain 96.0
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 95.93
KOG1499 346 consensus Protein arginine N-methyltransferase PRM 95.82
PF05958352 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas 95.82
COG0357215 GidB Predicted S-adenosylmethionine-dependent meth 95.72
KOG1709271 consensus Guanidinoacetate methyltransferase and r 95.71
KOG2798369 consensus Putative trehalase [Carbohydrate transpo 95.64
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 95.63
PRK00050296 16S rRNA m(4)C1402 methyltranserfase; Provisional 95.61
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 95.59
KOG1975 389 consensus mRNA cap methyltransferase [RNA processi 95.59
COG3897218 Predicted methyltransferase [General function pred 95.56
COG1189245 Predicted rRNA methylase [Translation, ribosomal s 95.53
KOG1269 364 consensus SAM-dependent methyltransferases [Lipid 95.51
PF08123205 DOT1: Histone methylation protein DOT1 ; InterPro: 95.46
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 95.42
PRK11760357 putative 23S rRNA C2498 ribose 2'-O-ribose methylt 95.41
KOG2940325 consensus Predicted methyltransferase [General fun 95.39
PF12147311 Methyltransf_20: Putative methyltransferase; Inter 95.33
PF01739196 CheR: CheR methyltransferase, SAM binding domain; 95.26
COG5459484 Predicted rRNA methylase [Translation, ribosomal s 95.23
PF01269229 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibr 95.21
COG4122219 Predicted O-methyltransferase [General function pr 95.05
COG4627185 Uncharacterized protein conserved in bacteria [Fun 95.02
PRK11933 470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 94.99
PLN02672 1082 methionine S-methyltransferase 94.92
PLN02668386 indole-3-acetate carboxyl methyltransferase 94.89
PF00398262 RrnaAD: Ribosomal RNA adenine dimethylase; InterPr 94.78
PF01269229 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibr 94.68
PF09445163 Methyltransf_15: RNA cap guanine-N2 methyltransfer 94.59
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 94.4
COG0116381 Predicted N6-adenine-specific DNA methylase [DNA r 94.39
KOG2187534 consensus tRNA uracil-5-methyltransferase and rela 94.38
COG1189245 Predicted rRNA methylase [Translation, ribosomal s 94.29
PRK00536262 speE spermidine synthase; Provisional 94.27
PLN02823336 spermine synthase 94.26
TIGR02143353 trmA_only tRNA (uracil-5-)-methyltransferase. This 93.89
PF13578106 Methyltransf_24: Methyltransferase domain; PDB: 3S 93.67
PF05971299 Methyltransf_10: Protein of unknown function (DUF8 93.63
COG4076252 Predicted RNA methylase [General function predicti 93.63
KOG3115249 consensus Methyltransferase-like protein [General 93.6
KOG3201201 consensus Uncharacterized conserved protein [Funct 93.54
PF01189283 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR 93.35
PF07942270 N2227: N2227-like protein; InterPro: IPR012901 Thi 93.32
PLN02589247 caffeoyl-CoA O-methyltransferase 93.28
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 93.26
PRK00274272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 93.16
PF03492334 Methyltransf_7: SAM dependent carboxyl methyltrans 93.0
PRK14896258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 92.97
PF02475200 Met_10: Met-10+ like-protein; InterPro: IPR003402 92.92
COG4262508 Predicted spermidine synthase with an N-terminal m 92.74
KOG3115249 consensus Methyltransferase-like protein [General 92.64
TIGR01444143 fkbM_fam methyltransferase, FkbM family. Members o 92.52
PF04816205 DUF633: Family of unknown function (DUF633) ; Inte 92.44
KOG1122460 consensus tRNA and rRNA cytosine-C5-methylase (nuc 92.24
KOG3178342 consensus Hydroxyindole-O-methyltransferase and re 92.04
COG1889231 NOP1 Fibrillarin-like rRNA methylase [Translation, 91.89
COG4798238 Predicted methyltransferase [General function pred 91.87
PRK05031362 tRNA (uracil-5-)-methyltransferase; Validated 91.64
COG4627185 Uncharacterized protein conserved in bacteria [Fun 91.51
PF03059276 NAS: Nicotianamine synthase protein; InterPro: IPR 91.49
KOG2899288 consensus Predicted methyltransferase [General fun 91.38
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 91.23
COG1889231 NOP1 Fibrillarin-like rRNA methylase [Translation, 91.09
KOG1331 293 consensus Predicted methyltransferase [General fun 90.92
PF06962140 rRNA_methylase: Putative rRNA methylase; InterPro: 90.68
TIGR00755253 ksgA dimethyladenosine transferase. Alternate name 90.67
KOG4589232 consensus Cell division protein FtsJ [Cell cycle c 90.17
PF04672267 Methyltransf_19: S-adenosyl methyltransferase; Int 89.97
KOG0822649 consensus Protein kinase inhibitor [Cell cycle con 89.33
PRK04338 382 N(2),N(2)-dimethylguanosine tRNA methyltransferase 89.29
COG3129292 Predicted SAM-dependent methyltransferase [General 89.06
KOG1661237 consensus Protein-L-isoaspartate(D-aspartate) O-me 88.89
COG0421282 SpeE Spermidine synthase [Amino acid transport and 88.73
COG1092393 Predicted SAM-dependent methyltransferases [Genera 87.36
KOG3191209 consensus Predicted N6-DNA-methyltransferase [Tran 87.18
PF05958352 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas 87.08
KOG2539491 consensus Mitochondrial/chloroplast ribosome small 87.07
PRK00050 296 16S rRNA m(4)C1402 methyltranserfase; Provisional 86.88
PF01234256 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: I 86.72
COG0293205 FtsJ 23S rRNA methylase [Translation, ribosomal st 86.47
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 86.28
PRK10611287 chemotaxis methyltransferase CheR; Provisional 86.18
TIGR00095189 RNA methyltransferase, RsmD family. This model rep 86.11
KOG2198375 consensus tRNA cytosine-5-methylases and related e 85.76
PF06859110 Bin3: Bicoid-interacting protein 3 (Bin3); InterPr 85.55
KOG1500 517 consensus Protein arginine N-methyltransferase CAR 85.41
PF07757112 AdoMet_MTase: Predicted AdoMet-dependent methyltra 85.26
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 85.25
PF07091251 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 85.01
PRK11727321 23S rRNA mA1618 methyltransferase; Provisional 84.99
PTZ00338 294 dimethyladenosine transferase-like protein; Provis 84.91
KOG2793248 consensus Putative N2,N2-dimethylguanosine tRNA me 84.69
KOG3201201 consensus Uncharacterized conserved protein [Funct 84.56
COG2384226 Predicted SAM-dependent methyltransferase [General 84.4
COG1041347 Predicted DNA modification methylase [DNA replicat 84.19
PF11968219 DUF3321: Putative methyltransferase (DUF3321); Int 83.88
COG2263198 Predicted RNA methylase [Translation, ribosomal st 83.8
KOG2793248 consensus Putative N2,N2-dimethylguanosine tRNA me 83.37
KOG2920282 consensus Predicted methyltransferase [General fun 83.22
PF13578106 Methyltransf_24: Methyltransferase domain; PDB: 3S 82.64
KOG19241102 consensus RhoA GTPase effector DIA/Diaphanous [Sig 81.89
COG4301321 Uncharacterized conserved protein [Function unknow 81.79
PF03269177 DUF268: Caenorhabditis protein of unknown function 81.72
PRK11524 284 putative methyltransferase; Provisional 81.16
PF09243274 Rsm22: Mitochondrial small ribosomal subunit Rsm22 81.11
PF03514374 GRAS: GRAS domain family; InterPro: IPR005202 Sequ 80.84
KOG1099294 consensus SAM-dependent methyltransferase/cell div 80.32
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information 
Probab=100.00  E-value=1e-138  Score=1125.80  Aligned_cols=500  Identities=59%  Similarity=1.111  Sum_probs=480.3

Q ss_pred             ceeccCCcHHHHHhcCCCcccchhccCCCCCCCCCccccCCCCCCCCCCcCCCCccccccCCCCCcccccccccCcchhc
Q 005981          158 EYIPCLDNVEAIKQLKSTDKGERFERHCPLNGTGLNCLVPAPKGYKTPIPWPRSRNEVWYNNVPHSRLVEDKGGQNWISK  237 (666)
Q Consensus       158 ~y~pc~d~~~~~~~~~~~~~~~~~er~C~~~~~~~~Clv~~P~~Y~~P~~wP~s~~~~W~~n~~~~~L~~~k~~q~W~~~  237 (666)
                      |||||+|+.++++++++++++||+|||||+.+++++||||+|++|+.|++||+|||++|++|+||++|.++|+.|||++.
T Consensus         1 dy~PC~D~~~~~~~~~~~~~~~~rERhCP~~~~~~~CLVp~P~gYk~P~~WP~SRd~iW~~Nvph~~L~~~K~~qnWv~~   80 (506)
T PF03141_consen    1 DYIPCLDNSRAIKFLLSRERMEHRERHCPPPEERLRCLVPPPKGYKTPIPWPKSRDYIWYANVPHTKLAEEKADQNWVRV   80 (506)
T ss_pred             CCcCCCCHHHHHhhccCcccccEeeccCcCCCCCCccccCCCccCCCCCCCCcccceeeecccCchHHhhhcccccceee
Confidence            79999999999999999999999999999988899999999999999999999999999999999999999999999999


Q ss_pred             cccccccCCCCccccccHHHHHHHHHhhcccccCCCCCCeEEEECCCCchhHHHhccCCeEEEeCCcchHHHHHHHHHHH
Q 005981          238 EKDKFKFPGGGTQFIHGADQYLDQIAKMVPDITWGHHIRVVMDAGCGVASFGAYLLPRNVITMSIAPKDVHENQIQFALE  317 (666)
Q Consensus       238 ~g~~~~Fpgggt~F~~g~~~~i~~L~~~L~~i~~g~~~~~VLDIGCGtG~~a~~L~~~~V~gvDiS~~~l~~a~~~~a~~  317 (666)
                      +|++|.||||||+|.+|+.+|+++|.++++.+..++..+++||||||+|+|+++|.+++|+++.+++.+.+++|+|+|.+
T Consensus        81 ~gd~~~FPgggt~F~~Ga~~Yid~i~~~~~~~~~~g~iR~~LDvGcG~aSF~a~l~~r~V~t~s~a~~d~~~~qvqfale  160 (506)
T PF03141_consen   81 EGDKFRFPGGGTMFPHGADHYIDQIAEMIPLIKWGGGIRTALDVGCGVASFGAYLLERNVTTMSFAPNDEHEAQVQFALE  160 (506)
T ss_pred             cCCEEEeCCCCccccCCHHHHHHHHHHHhhccccCCceEEEEeccceeehhHHHHhhCCceEEEcccccCCchhhhhhhh
Confidence            99999999999999999999999999999876667888999999999999999999999999999999999999999999


Q ss_pred             cCCCceEEeecccCCCCCCCCeeEEEecccccccccChHHHHHHHHHhccCCeEEEEEECCCC-CCHHHHHHHHHHHHHh
Q 005981          318 RGAPAMVAAFATRRLPYPSQAFDLIHCSRCRINWTRDDGILLLEVNRMLRAGGYFAWAAQPVY-KHEEAQEEHWKEMLDL  396 (666)
Q Consensus       318 rg~~~~~~~~d~e~Lpf~d~sFDlVv~s~~l~h~~~d~~~~L~el~RvLkPGG~lv~st~P~~-~~~~el~~~w~~~~~l  396 (666)
                      ||+++++.....++|||++++||+|||+.|++.|..+...+|.|+.|+|||||+|+++.+|.+ .+.+++.+.|..|+++
T Consensus       161 RGvpa~~~~~~s~rLPfp~~~fDmvHcsrc~i~W~~~~g~~l~evdRvLRpGGyfv~S~ppv~~r~~~~~~~~~~~~~~l  240 (506)
T PF03141_consen  161 RGVPAMIGVLGSQRLPFPSNAFDMVHCSRCLIPWHPNDGFLLFEVDRVLRPGGYFVLSGPPVYQRTDEDLEEEWNAMEDL  240 (506)
T ss_pred             cCcchhhhhhccccccCCccchhhhhcccccccchhcccceeehhhhhhccCceEEecCCcccccchHHHHHHHHHHHHH
Confidence            999999888778999999999999999999999998888999999999999999999999999 7778899999999999


Q ss_pred             hhhhhhhhhhhcCceEEeecCCchhhhHHhhcCCCCCcCCCCCCcceeeeecchhhhcccCCC---CCCCccccCcccCC
Q 005981          397 TTRLCWELVKKEGYIAIWKKPTNNSCYLNREAGTIPPLCDPDDNPDNVWYVDLKACITRLPEN---GYGANVSLWPERLR  473 (666)
Q Consensus       397 ~~~l~W~~v~~~g~~~i~~kpl~~~c~~lr~aGf~~p~c~~~~~~~~~wY~~l~~~l~~L~~~---g~g~~l~~WP~Rl~  473 (666)
                      ++.+||+.+.+.++++|||||.+++|+..|+.+..+++|+..++++.+||.+|++||+.+++.   ..+.++.+||+||+
T Consensus       241 ~~~lCW~~va~~~~~aIwqKp~~~~Cy~~r~~~~~pplC~~~~dpd~aWY~~l~~Cit~~p~~~~~~~~~~~~~WP~RL~  320 (506)
T PF03141_consen  241 AKSLCWKKVAEKGDTAIWQKPTNNSCYQKRKPGKSPPLCDSSDDPDAAWYVPLEACITPLPEVSSEIAGGWLPKWPERLN  320 (506)
T ss_pred             HHHHHHHHheeeCCEEEEeccCCchhhhhccCCCCCCCCCCCCCCcchhhcchhhhcCcCCcccccccccCCCCChhhhc
Confidence            999999999999999999999999999999988999999888999999999999999999975   45679999999999


Q ss_pred             CCccchhhhchhhhhhhhhhhhhhhHhHHHHHHHHHHhcc--cCCCceeeEeeccccchHHHHHHhhCCCceEEEEeecc
Q 005981          474 TSPDRLQSIQLDAFIARKELFKAESKYWNEIIESYVRALH--WKKMKLRNVLDMRAGFGGFAAALIEQKFDCWVMNVVPV  551 (666)
Q Consensus       474 ~~p~rL~~~~~~~~~~~~~~f~~d~~~w~~~v~~Y~~~l~--~~~~~iRnvlD~g~G~Ggfaa~L~~~~~~vwvmnv~~~  551 (666)
                      ++|+||.+.....  .+.+.|.+|+++|+++|++|+++++  +++++||||||||||||||||||+++  +||||||||+
T Consensus       321 ~~P~rl~~~~~~g--~~~e~F~~Dt~~Wk~~V~~Y~~l~~~~i~~~~iRNVMDMnAg~GGFAAAL~~~--~VWVMNVVP~  396 (506)
T PF03141_consen  321 AVPPRLSSGSIPG--ISPEEFKEDTKHWKKRVSHYKKLLGLAIKWGRIRNVMDMNAGYGGFAAALIDD--PVWVMNVVPV  396 (506)
T ss_pred             cCchhhhcCCcCC--CCHHHHHHHHHHHHHHHHHHHHhhcccccccceeeeeeecccccHHHHHhccC--CceEEEeccc
Confidence            9999999854322  2469999999999999999999887  88999999999999999999999999  5799999999


Q ss_pred             CCCCChhHHHhccccccccccCCCCCCCCCccceEEeccccccCCCCCCHHHHHHHhhhcccCCeEEEEEeChhHHHHHH
Q 005981          552 SGFNTLPVIYDRGLIGVMHDWCEPFDTYPRTYDLLHAAGLFSVESKRCNMSTIMLEMDRMLRPGGHVYIRDSIDVMDELQ  631 (666)
Q Consensus       552 ~~~~~l~~~~erGlig~~~~~ce~~~~yp~tyDliha~~~f~~~~~~c~~~~~l~E~dRiLRPgG~~ii~d~~~~~~~~~  631 (666)
                      .++|||++||||||||+||||||+|+|||||||||||++|||.+.+||++++||+||||||||||++||||+.+++++|+
T Consensus       397 ~~~ntL~vIydRGLIG~yhDWCE~fsTYPRTYDLlHA~~lfs~~~~rC~~~~illEmDRILRP~G~~iiRD~~~vl~~v~  476 (506)
T PF03141_consen  397 SGPNTLPVIYDRGLIGVYHDWCEAFSTYPRTYDLLHADGLFSLYKDRCEMEDILLEMDRILRPGGWVIIRDTVDVLEKVK  476 (506)
T ss_pred             CCCCcchhhhhcccchhccchhhccCCCCcchhheehhhhhhhhcccccHHHHHHHhHhhcCCCceEEEeccHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhcCcEEEEEeccCCCCCceEEEEEEe
Q 005981          632 EIGKAMGWHVTLRETAEGPHASYRILTADK  661 (666)
Q Consensus       632 ~i~~~l~W~~~~~~~~~~~~~~e~~l~~~k  661 (666)
                      +|+++|||+++++++|+|+.++||||+|||
T Consensus       477 ~i~~~lrW~~~~~d~e~g~~~~EkiL~~~K  506 (506)
T PF03141_consen  477 KIAKSLRWEVRIHDTEDGPDGPEKILICQK  506 (506)
T ss_pred             HHHHhCcceEEEEecCCCCCCCceEEEEEC
Confidence            999999999999999999999999999998

; GO: 0008168 methyltransferase activity
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>KOG2940 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>KOG4300 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>KOG1271 consensus Methyltransferases [General function prediction only] Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only] Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>KOG3010 consensus Methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>KOG2361 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>KOG1975 consensus mRNA cap methyltransferase [RNA processing and modification] Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>KOG3045 consensus Predicted RNA methylase involved in rRNA processing [RNA processing and modification] Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>KOG4300 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>KOG2899 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] Back     alignment and domain information
>KOG3010 consensus Methyltransferase [General function prediction only] Back     alignment and domain information
>KOG2904 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>PRK11727 23S rRNA mA1618 methyltransferase; Provisional Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>KOG1499 consensus Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones; Transcription; Signal transduction mechanisms] Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>PF07942 N2227: N2227-like protein; InterPro: IPR012901 This family features sequences that are similar to a region of hypothetical yeast gene product N2227 (P53934 from SWISSPROT) Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>KOG1331 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only] Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>KOG3045 consensus Predicted RNA methylase involved in rRNA processing [RNA processing and modification] Back     alignment and domain information
>KOG3987 consensus Uncharacterized conserved protein DREV/CGI-81 [Function unknown] Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>KOG1269 consensus SAM-dependent methyltransferases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PF11968 DUF3321: Putative methyltransferase (DUF3321); InterPro: IPR021867 This family is conserved in fungi and is annotated as being a nucleolar protein Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>KOG3178 consensus Hydroxyindole-O-methyltransferase and related SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family Back     alignment and domain information
>KOG1661 consensus Protein-L-isoaspartate(D-aspartate) O-methyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3191 consensus Predicted N6-DNA-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PF01234 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: IPR000940 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>KOG1271 consensus Methyltransferases [General function prediction only] Back     alignment and domain information
>KOG2361 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH Back     alignment and domain information
>KOG2352 consensus Predicted spermine/spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] Back     alignment and domain information
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family Back     alignment and domain information
>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1500 consensus Protein arginine N-methyltransferase CARM1 [Posttranslational modification, protein turnover, chaperones; Transcription] Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>KOG2904 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>KOG3420 consensus Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information
>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>KOG0820 consensus Ribosomal RNA adenine dimethylase [RNA processing and modification] Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family Back     alignment and domain information
>KOG1663 consensus O-methyltransferase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2915 consensus tRNA(1-methyladenosine) methyltransferase, subunit GCD14 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF13679 Methyltransf_32: Methyltransferase domain Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1499 consensus Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones; Transcription; Signal transduction mechanisms] Back     alignment and domain information
>PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG1709 consensus Guanidinoacetate methyltransferase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2798 consensus Putative trehalase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1975 consensus mRNA cap methyltransferase [RNA processing and modification] Back     alignment and domain information
>COG3897 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1269 consensus SAM-dependent methyltransferases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional Back     alignment and domain information
>KOG2940 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>COG5459 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF01269 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP), functioning in vivo in ribosomal RNA processing [, ] Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>COG4627 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>PLN02668 indole-3-acetate carboxyl methyltransferase Back     alignment and domain information
>PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e Back     alignment and domain information
>PF01269 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP), functioning in vivo in ribosomal RNA processing [, ] Back     alignment and domain information
>PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2187 consensus tRNA uracil-5-methyltransferase and related tRNA-modifying enzymes [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D Back     alignment and domain information
>PF05971 Methyltransf_10: Protein of unknown function (DUF890); InterPro: IPR010286 This family consists of several conserved hypothetical proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>COG4076 Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>KOG3115 consensus Methyltransferase-like protein [General function prediction only] Back     alignment and domain information
>KOG3201 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>PF07942 N2227: N2227-like protein; InterPro: IPR012901 This family features sequences that are similar to a region of hypothetical yeast gene product N2227 (P53934 from SWISSPROT) Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>PF03492 Methyltransf_7: SAM dependent carboxyl methyltransferase; InterPro: IPR005299 This family of plant methyltransferases contains enzymes that act on a variety of substrates including salicylic acid, jasmonic acid and 7-Methylxanthine Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family Back     alignment and domain information
>COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] Back     alignment and domain information
>KOG3115 consensus Methyltransferase-like protein [General function prediction only] Back     alignment and domain information
>TIGR01444 fkbM_fam methyltransferase, FkbM family Back     alignment and domain information
>PF04816 DUF633: Family of unknown function (DUF633) ; InterPro: IPR006901 This is a family of uncharacterised bacterial proteins Back     alignment and domain information
>KOG1122 consensus tRNA and rRNA cytosine-C5-methylase (nucleolar protein NOL1/NOP2) [RNA processing and modification] Back     alignment and domain information
>KOG3178 consensus Hydroxyindole-O-methyltransferase and related SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>COG1889 NOP1 Fibrillarin-like rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG4798 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>COG4627 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 Back     alignment and domain information
>KOG2899 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>COG1889 NOP1 Fibrillarin-like rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1331 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF06962 rRNA_methylase: Putative rRNA methylase; InterPro: IPR010719 This family contains a number of putative rRNA methylases Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>KOG4589 consensus Cell division protein FtsJ [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF04672 Methyltransf_19: S-adenosyl methyltransferase; InterPro: IPR006764 This is a family of uncharacterised proteins Back     alignment and domain information
>KOG0822 consensus Protein kinase inhibitor [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>COG3129 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>KOG1661 consensus Protein-L-isoaspartate(D-aspartate) O-methyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>KOG3191 consensus Predicted N6-DNA-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 Back     alignment and domain information
>KOG2539 consensus Mitochondrial/chloroplast ribosome small subunit component [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional Back     alignment and domain information
>PF01234 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: IPR000940 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>KOG2198 consensus tRNA cytosine-5-methylases and related enzymes of the NOL1/NOP2/sun superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF06859 Bin3: Bicoid-interacting protein 3 (Bin3); InterPro: IPR010675 This entry represents a conserved region of approximately 120 residues within eukaryotic Bicoid-interacting protein 3 (Bin3) Back     alignment and domain information
>KOG1500 consensus Protein arginine N-methyltransferase CARM1 [Posttranslational modification, protein turnover, chaperones; Transcription] Back     alignment and domain information
>PF07757 AdoMet_MTase: Predicted AdoMet-dependent methyltransferase; InterPro: IPR011671 tRNA (uracil-O(2)-)-methyltransferase catalyses the formation of O(2)-methyl-uracil at position 44 (m2U44) in tRNA(Ser) [] Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>PF07091 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 3LCU_A 3LCV_B 3FRH_A 3FRI_A 3B89_A 3FZG_A Back     alignment and domain information
>PRK11727 23S rRNA mA1618 methyltransferase; Provisional Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>KOG2793 consensus Putative N2,N2-dimethylguanosine tRNA methyltransferase [RNA processing and modification] Back     alignment and domain information
>KOG3201 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG2384 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF11968 DUF3321: Putative methyltransferase (DUF3321); InterPro: IPR021867 This family is conserved in fungi and is annotated as being a nucleolar protein Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2793 consensus Putative N2,N2-dimethylguanosine tRNA methyltransferase [RNA processing and modification] Back     alignment and domain information
>KOG2920 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D Back     alignment and domain information
>KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG4301 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF03269 DUF268: Caenorhabditis protein of unknown function, DUF268; InterPro: IPR004951 This family consists of proteins of unknown function found in Caenorhabditis species Back     alignment and domain information
>PRK11524 putative methyltransferase; Provisional Back     alignment and domain information
>PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF03514 GRAS: GRAS domain family; InterPro: IPR005202 Sequence analysis of the products of the GRAS (GAI, RGA, SCR) gene family indicates that they share a variable N terminus and a highly conserved C terminus that contains five recognizable motifs [] Back     alignment and domain information
>KOG1099 consensus SAM-dependent methyltransferase/cell division protein FtsJ [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query666
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 1e-07
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 3e-07
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 1e-06
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 4e-06
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 4e-06
3i9f_A170 Putative type 11 methyltransferase; structural gen 1e-05
3ege_A261 Putative methyltransferase from antibiotic biosyn 1e-05
3f4k_A257 Putative methyltransferase; structural genomics, P 2e-05
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 2e-05
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 2e-05
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 3e-05
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 4e-05
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 4e-05
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 4e-05
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 8e-05
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 1e-04
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 1e-04
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 2e-04
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 3e-04
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 3e-04
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 4e-04
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 4e-04
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 5e-04
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 5e-04
3m33_A226 Uncharacterized protein; structural genomics, PSI- 6e-04
3cc8_A230 Putative methyltransferase; structural genomics, j 7e-04
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Length = 253 Back     alignment and structure
 Score = 52.2 bits (125), Expect = 1e-07
 Identities = 28/151 (18%), Positives = 53/151 (35%), Gaps = 25/151 (16%)

Query: 255 ADQYLDQIAKMVPDITWGHHIRVVMDAGCGVASFGAYLL---PRNVITMSIAPKDVHENQ 311
           A     ++ KM+PD       + V+D GCG      Y      + V+ +     D+ E  
Sbjct: 29  AAGEWHELKKMLPDFN----QKTVLDLGCGFGWHCIYAAEHGAKKVLGI-----DLSERM 79

Query: 312 IQFALERGAPAMVAAFA--TRRLPYPSQAFDLIHCSRCRINWTRDDGILLLEVNRMLRAG 369
           +  A  +    +V         +     A++++  S   +++      +  +V   L++ 
Sbjct: 80  LTEAKRKTTSPVVCYEQKAIEDIAIEPDAYNVVLSSLA-LHYIASFDDICKKVYINLKSS 138

Query: 370 GYF----------AWAAQPVYKHEEAQEEHW 390
           G F          A   Q  Y  E   + HW
Sbjct: 139 GSFIFSVEHPVFTADGRQDWYTDETGNKLHW 169
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Length = 243 Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Length = 260 Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Length = 227 Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Length = 254 Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Length = 170 Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Length = 261 Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Length = 257 Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.70A {Bacillus thuringiensis} Length = 242 Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Length = 267 Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Length = 209 Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Length = 203 Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Length = 241 Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Length = 195 Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Length = 273 Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Length = 276 Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Length = 227 Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Length = 211 Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Length = 269 Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Length = 299 Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Length = 297 Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Length = 211 Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Length = 259 Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* Length = 312 Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Length = 226 Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Length = 230 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query666
4hg2_A257 Methyltransferase type 11; structural genomics, PS 99.56
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 99.55
1vl5_A260 Unknown conserved protein BH2331; putative methylt 99.53
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 99.5
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 99.5
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 99.49
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 99.48
1xxl_A239 YCGJ protein; structural genomics, protein structu 99.48
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 99.47
3gu3_A284 Methyltransferase; alpha-beta protein, structural 99.47
3f4k_A257 Putative methyltransferase; structural genomics, P 99.47
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 99.46
2p7i_A250 Hypothetical protein; putative methyltransferase, 99.45
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 99.44
3dtn_A234 Putative methyltransferase MM_2633; structural gen 99.44
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 99.44
3hnr_A220 Probable methyltransferase BT9727_4108; structural 99.43
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 99.43
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 99.42
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 99.42
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 99.41
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 99.41
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 99.4
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 99.4
3dh0_A219 SAM dependent methyltransferase; cystal structure, 99.4
4fsd_A383 Arsenic methyltransferase; rossmann fold; 1.75A {C 99.39
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 99.39
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 99.39
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 99.39
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 99.38
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 99.38
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 99.38
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 99.38
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 99.37
3ege_A261 Putative methyltransferase from antibiotic biosyn 99.37
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 99.37
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 99.37
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 99.37
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 99.37
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 99.37
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 99.37
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 99.37
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 99.37
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 99.36
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 99.36
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 99.36
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 99.35
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 99.35
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 99.34
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 99.34
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 99.34
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 99.33
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 99.33
2kw5_A202 SLR1183 protein; structural genomics, northeast st 99.33
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 99.32
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 99.32
3i9f_A170 Putative type 11 methyltransferase; structural gen 99.31
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 99.3
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 99.3
3lcc_A235 Putative methyl chloride transferase; halide methy 99.28
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleoti 99.28
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 99.28
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 99.28
3m70_A286 Tellurite resistance protein TEHB homolog; structu 99.28
1vlm_A219 SAM-dependent methyltransferase; possible histamin 99.27
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 99.27
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 99.27
4e2x_A416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 99.27
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 99.27
3m33_A226 Uncharacterized protein; structural genomics, PSI- 99.26
1wzn_A252 SAM-dependent methyltransferase; structural genomi 99.25
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 99.25
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 99.24
3bgv_A313 MRNA CAP guanine-N7 methyltransferase; alternative 99.24
3cc8_A230 Putative methyltransferase; structural genomics, j 99.24
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 99.23
3ocj_A305 Putative exported protein; structural genomics, PS 99.22
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 99.22
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 99.21
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 99.21
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 99.21
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 99.2
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 99.2
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 99.19
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 99.18
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 99.17
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 99.17
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 99.17
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 99.17
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 99.17
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 99.17
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 99.17
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 99.16
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 99.16
2i62_A265 Nicotinamide N-methyltransferase; structural genom 99.16
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 99.15
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 99.15
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 99.14
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 99.14
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 99.14
3q7e_A349 Protein arginine N-methyltransferase 1; HET: SAH; 99.14
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 99.14
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 99.14
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 99.13
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 99.12
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 99.12
2fyt_A340 Protein arginine N-methyltransferase 3; structural 99.11
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 99.11
2fpo_A202 Methylase YHHF; structural genomics, putative meth 99.1
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 99.1
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 99.1
3r0q_C376 Probable protein arginine N-methyltransferase 4.2; 99.1
1ws6_A171 Methyltransferase; structural genomics, riken stru 99.1
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 99.1
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 99.08
4hg2_A257 Methyltransferase type 11; structural genomics, PS 99.08
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 99.08
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 99.08
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 99.08
3hnr_A220 Probable methyltransferase BT9727_4108; structural 99.08
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 99.07
2esr_A177 Methyltransferase; structural genomics, hypothetic 99.07
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 99.07
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 99.07
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 99.07
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 99.06
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 99.06
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 99.06
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 99.06
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 99.05
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 99.05
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 99.05
3uwp_A438 Histone-lysine N-methyltransferase, H3 lysine-79; 99.04
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 99.04
1jsx_A207 Glucose-inhibited division protein B; methyltransf 99.04
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 99.04
2frn_A278 Hypothetical protein PH0793; structural genomics, 99.04
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 99.04
2y1w_A348 Histone-arginine methyltransferase CARM1; histone 99.03
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 99.03
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 99.03
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 99.03
3dh0_A219 SAM dependent methyltransferase; cystal structure, 99.03
2p7i_A250 Hypothetical protein; putative methyltransferase, 99.02
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 99.02
1g6q_1328 HnRNP arginine N-methyltransferase; SAM-binding do 99.02
3lpm_A259 Putative methyltransferase; structural genomics, p 99.02
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 99.02
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 99.02
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 99.02
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 99.01
3dp7_A363 SAM-dependent methyltransferase; structural genomi 99.01
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 99.0
3i9f_A170 Putative type 11 methyltransferase; structural gen 99.0
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 99.0
2r3s_A335 Uncharacterized protein; methyltransferase domain, 99.0
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 98.99
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 98.99
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 98.99
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 98.98
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 98.98
3lcc_A235 Putative methyl chloride transferase; halide methy 98.98
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 98.98
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 98.98
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 98.97
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 98.97
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 98.97
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 98.97
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 98.97
2b3t_A276 Protein methyltransferase HEMK; translation termin 98.97
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 98.97
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 98.96
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 98.96
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 98.96
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 98.96
1yb2_A275 Hypothetical protein TA0852; structural genomics, 98.96
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 98.96
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 98.96
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 98.96
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 98.95
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 98.95
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 98.95
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 98.95
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 98.95
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 98.94
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 98.93
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 98.93
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 98.93
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 98.93
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 98.93
1vl5_A260 Unknown conserved protein BH2331; putative methylt 98.93
1vlm_A219 SAM-dependent methyltransferase; possible histamin 98.93
4e2x_A 416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 98.92
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 98.92
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 98.92
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 98.91
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 98.91
1xj5_A334 Spermidine synthase 1; structural genomics, protei 98.91
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 98.91
3m70_A286 Tellurite resistance protein TEHB homolog; structu 98.91
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 98.91
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 98.9
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 98.9
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 98.9
3sso_A419 Methyltransferase; macrolide, natural product, ros 98.9
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 98.9
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 98.89
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 98.89
3ege_A261 Putative methyltransferase from antibiotic biosyn 98.89
1jsx_A207 Glucose-inhibited division protein B; methyltransf 98.89
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 98.89
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 98.89
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 98.89
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 98.89
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 98.88
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 98.88
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 98.88
3ocj_A305 Putative exported protein; structural genomics, PS 98.88
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 98.88
1xxl_A239 YCGJ protein; structural genomics, protein structu 98.87
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 98.87
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 98.87
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 98.87
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 98.87
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 98.87
3dtn_A234 Putative methyltransferase MM_2633; structural gen 98.87
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 98.86
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 98.86
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 98.86
3f4k_A257 Putative methyltransferase; structural genomics, P 98.86
3b3j_A480 Histone-arginine methyltransferase CARM1; protein 98.85
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 98.85
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 98.84
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 98.84
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 98.84
2oxt_A265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 98.84
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 98.83
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 98.83
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 98.83
3giw_A277 Protein of unknown function DUF574; rossmann-fold 98.83
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 98.83
2wa2_A276 Non-structural protein 5; transferase, S-adenosyl- 98.82
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 98.82
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 98.82
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 98.82
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 98.82
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 98.82
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 98.82
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 98.82
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 98.82
3cc8_A230 Putative methyltransferase; structural genomics, j 98.81
3gu3_A 284 Methyltransferase; alpha-beta protein, structural 98.81
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 98.81
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 98.81
4hc4_A376 Protein arginine N-methyltransferase 6; HRMT1L6, S 98.81
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 98.81
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 98.8
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 98.8
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 98.8
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 98.8
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 98.8
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 98.79
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 98.79
3duw_A223 OMT, O-methyltransferase, putative; alternating of 98.79
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 98.78
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 98.78
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 98.78
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 98.78
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 98.78
2o07_A304 Spermidine synthase; structural genomics, structur 98.78
3g5t_A 299 Trans-aconitate 3-methyltransferase; structural ge 98.78
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 98.78
2b25_A336 Hypothetical protein; structural genomics, methyl 98.77
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 98.77
2i7c_A283 Spermidine synthase; transferase, structural genom 98.77
2kw5_A202 SLR1183 protein; structural genomics, northeast st 98.77
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 98.77
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 98.76
2pt6_A321 Spermidine synthase; transferase, structural genom 98.76
3gjy_A317 Spermidine synthase; APC62791, structural genomics 98.76
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 98.75
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 98.75
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 98.75
1wzn_A252 SAM-dependent methyltransferase; structural genomi 98.74
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 98.74
2p41_A305 Type II methyltransferase; vizier, viral enzymes i 98.73
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 98.73
2i62_A265 Nicotinamide N-methyltransferase; structural genom 98.73
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 98.72
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 98.72
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 98.72
2b78_A385 Hypothetical protein SMU.776; structure genomics, 98.72
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 98.71
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 98.71
1ne2_A200 Hypothetical protein TA1320; structural genomics, 98.71
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 98.71
2h00_A254 Methyltransferase 10 domain containing protein; st 98.71
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 98.71
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 98.7
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 98.7
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 98.7
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 98.7
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 98.69
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleoti 98.69
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 98.69
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 98.68
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 98.68
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 98.68
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 98.68
3dp7_A363 SAM-dependent methyltransferase; structural genomi 98.68
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 98.67
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 98.66
2cmg_A262 Spermidine synthase; transferase, putrescine amino 98.66
2qm3_A373 Predicted methyltransferase; putative methyltransf 98.66
3m33_A226 Uncharacterized protein; structural genomics, PSI- 98.65
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 98.65
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 98.65
2avd_A229 Catechol-O-methyltransferase; structural genomics, 98.65
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 98.64
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 98.64
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 98.64
2b3t_A276 Protein methyltransferase HEMK; translation termin 98.64
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 98.64
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 98.64
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 98.64
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 98.62
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 98.62
3r0q_C 376 Probable protein arginine N-methyltransferase 4.2; 98.62
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 98.62
1zq9_A285 Probable dimethyladenosine transferase; SGC, struc 98.62
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 98.61
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 98.61
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 98.61
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 98.61
3frh_A253 16S rRNA methylase; methyltransferase domain, heli 98.61
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 98.61
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 98.6
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 98.6
2r3s_A335 Uncharacterized protein; methyltransferase domain, 98.6
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 98.6
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 98.6
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 98.6
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 98.59
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 98.59
3bgv_A 313 MRNA CAP guanine-N7 methyltransferase; alternative 98.59
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 98.59
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 98.59
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 98.59
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 98.58
3lpm_A259 Putative methyltransferase; structural genomics, p 98.58
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 98.58
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 98.58
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 98.58
2frn_A278 Hypothetical protein PH0793; structural genomics, 98.58
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 98.58
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 98.57
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 98.57
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 98.56
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 98.55
2h1r_A299 Dimethyladenosine transferase, putative; SGC toron 98.55
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 98.55
3k6r_A278 Putative transferase PH0793; structural genomics, 98.54
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 98.54
2y1w_A 348 Histone-arginine methyltransferase CARM1; histone 98.54
1g6q_1 328 HnRNP arginine N-methyltransferase; SAM-binding do 98.53
2fyt_A 340 Protein arginine N-methyltransferase 3; structural 98.53
3q7e_A 349 Protein arginine N-methyltransferase 1; HET: SAH; 98.53
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 98.53
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 98.53
2frx_A479 Hypothetical protein YEBU; rossmann-type S-adenosy 98.53
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 98.53
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 98.52
3m6w_A464 RRNA methylase; rRNA methyltransferase, 5-methylcy 98.52
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 98.52
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 98.52
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 98.52
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 98.51
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 98.51
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 98.5
2oxt_A265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 98.5
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 98.5
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 98.5
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 98.49
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 98.49
2f8l_A344 Hypothetical protein LMO1582; structural genomics, 98.47
3sso_A419 Methyltransferase; macrolide, natural product, ros 98.45
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 98.45
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 98.45
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 98.45
1yb2_A275 Hypothetical protein TA0852; structural genomics, 98.45
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 98.44
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 98.44
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 98.43
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 98.42
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 98.42
2wa2_A276 Non-structural protein 5; transferase, S-adenosyl- 98.4
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 98.4
2p41_A305 Type II methyltransferase; vizier, viral enzymes i 98.39
3m4x_A456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 98.39
3duw_A223 OMT, O-methyltransferase, putative; alternating of 98.38
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 98.38
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 98.38
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 98.37
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 98.36
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 98.35
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 98.35
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 98.34
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 98.33
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 98.33
1ws6_A171 Methyltransferase; structural genomics, riken stru 98.32
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 98.31
2okc_A445 Type I restriction enzyme stysji M protein; NP_813 98.31
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 98.3
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 98.3
3gru_A295 Dimethyladenosine transferase; rossman fold, ribos 98.3
2ih2_A421 Modification methylase TAQI; DNA, DNA methyltransf 98.29
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 98.28
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 98.28
1yub_A245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 98.28
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 98.27
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 98.27
4hc4_A 376 Protein arginine N-methyltransferase 6; HRMT1L6, S 98.26
2esr_A177 Methyltransferase; structural genomics, hypothetic 98.26
2avd_A229 Catechol-O-methyltransferase; structural genomics, 98.26
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 98.25
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 98.25
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 98.24
2b25_A336 Hypothetical protein; structural genomics, methyl 98.24
2xyq_A290 Putative 2'-O-methyl transferase; transferase-vira 98.24
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 98.23
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 98.23
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 98.23
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 98.22
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 98.22
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 98.22
1qam_A244 ERMC' methyltransferase; rRNA methyltransferase ER 98.22
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 98.21
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 98.21
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 98.21
3b5i_A374 S-adenosyl-L-methionine:salicylic acid carboxyl me 98.2
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 98.19
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 98.19
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 98.19
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 98.19
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 98.18
3evf_A277 RNA-directed RNA polymerase NS5; NS5 methyltransfe 98.18
3b3j_A 480 Histone-arginine methyltransferase CARM1; protein 98.17
2fpo_A202 Methylase YHHF; structural genomics, putative meth 98.17
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 98.17
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 98.16
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 98.16
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, 98.16
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 98.15
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 98.15
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 98.12
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 98.12
3tqs_A255 Ribosomal RNA small subunit methyltransferase A; p 98.08
3k0b_A393 Predicted N6-adenine-specific DNA methylase; methy 98.07
3uwp_A438 Histone-lysine N-methyltransferase, H3 lysine-79; 98.06
2cmg_A262 Spermidine synthase; transferase, putrescine amino 98.04
2qfm_A364 Spermine synthase; spermidine aminopropyltransfera 98.03
3fut_A271 Dimethyladenosine transferase; methyltransferase, 98.03
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 98.02
3ldu_A385 Putative methylase; structural genomics, PSI-2, pr 98.02
2efj_A384 3,7-dimethylxanthine methyltransferase; SAM-depend 98.01
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 98.01
2xyq_A290 Putative 2'-O-methyl transferase; transferase-vira 98.01
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 98.01
3gjy_A317 Spermidine synthase; APC62791, structural genomics 98.0
3ldg_A384 Putative uncharacterized protein SMU.472; YPSC, me 97.99
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 97.99
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 97.99
2o07_A304 Spermidine synthase; structural genomics, structur 97.97
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 97.96
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 97.96
2pt6_A321 Spermidine synthase; transferase, structural genom 97.94
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 97.93
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 97.92
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 97.92
1ne2_A200 Hypothetical protein TA1320; structural genomics, 97.92
2qm3_A373 Predicted methyltransferase; putative methyltransf 97.92
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 97.91
2dul_A378 N(2),N(2)-dimethylguanosine tRNA methyltransferas; 97.9
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 97.9
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 97.89
1xj5_A334 Spermidine synthase 1; structural genomics, protei 97.89
2h00_A254 Methyltransferase 10 domain containing protein; st 97.88
1m6e_X359 S-adenosyl-L-methionnine:salicylic acid carboxyl m 97.87
2ar0_A541 M.ecoki, type I restriction enzyme ecoki M protein 97.87
2b78_A385 Hypothetical protein SMU.776; structure genomics, 97.84
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 97.83
2i7c_A283 Spermidine synthase; transferase, structural genom 97.82
3o4f_A294 Spermidine synthase; aminopropyltransferase, polya 97.81
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 97.78
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 97.78
3axs_A392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 97.78
4gqb_A637 Protein arginine N-methyltransferase 5; TIM barrel 97.76
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 97.76
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 97.76
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 97.75
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
Probab=99.56  E-value=4.3e-15  Score=152.81  Aligned_cols=117  Identities=16%  Similarity=0.263  Sum_probs=88.3

Q ss_pred             HHHHHHhhcccccCCCCCCeEEEECCCCchhHHHhccC--CeEEEeCCcchHHHHHHHHHHHcCCCceEEeecccCCCCC
Q 005981          258 YLDQIAKMVPDITWGHHIRVVMDAGCGVASFGAYLLPR--NVITMSIAPKDVHENQIQFALERGAPAMVAAFATRRLPYP  335 (666)
Q Consensus       258 ~i~~L~~~L~~i~~g~~~~~VLDIGCGtG~~a~~L~~~--~V~gvDiS~~~l~~a~~~~a~~rg~~~~~~~~d~e~Lpf~  335 (666)
                      .++.|.+..+      ...+|||||||+|.++..|++.  +|+|+|+|+.|+..+     ++ .....+...+++.++++
T Consensus        29 l~~~l~~~~~------~~~~vLDvGcGtG~~~~~l~~~~~~v~gvD~s~~ml~~a-----~~-~~~v~~~~~~~e~~~~~   96 (257)
T 4hg2_A           29 LFRWLGEVAP------ARGDALDCGCGSGQASLGLAEFFERVHAVDPGEAQIRQA-----LR-HPRVTYAVAPAEDTGLP   96 (257)
T ss_dssp             HHHHHHHHSS------CSSEEEEESCTTTTTHHHHHTTCSEEEEEESCHHHHHTC-----CC-CTTEEEEECCTTCCCCC
T ss_pred             HHHHHHHhcC------CCCCEEEEcCCCCHHHHHHHHhCCEEEEEeCcHHhhhhh-----hh-cCCceeehhhhhhhccc
Confidence            4445554443      2368999999999999999987  999999999877543     22 22345566678999999


Q ss_pred             CCCeeEEEecccccccccChHHHHHHHHHhccCCeEEEEEECCCCCCHHHHHH
Q 005981          336 SQAFDLIHCSRCRINWTRDDGILLLEVNRMLRAGGYFAWAAQPVYKHEEAQEE  388 (666)
Q Consensus       336 d~sFDlVv~s~~l~h~~~d~~~~L~el~RvLkPGG~lv~st~P~~~~~~el~~  388 (666)
                      +++||+|+|+.++ ||. +...+++++.|+|||||.|++.+........++..
T Consensus        97 ~~sfD~v~~~~~~-h~~-~~~~~~~e~~rvLkpgG~l~~~~~~~~~~~~~~~~  147 (257)
T 4hg2_A           97 PASVDVAIAAQAM-HWF-DLDRFWAELRRVARPGAVFAAVTYGLTRVDPEVDA  147 (257)
T ss_dssp             SSCEEEEEECSCC-TTC-CHHHHHHHHHHHEEEEEEEEEEEECCCBCCHHHHH
T ss_pred             CCcccEEEEeeeh-hHh-hHHHHHHHHHHHcCCCCEEEEEECCCCCCCHHHHH
Confidence            9999999998875 663 68899999999999999999886533333344443
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Back     alignment and structure
>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 Back     alignment and structure
>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Back     alignment and structure
>4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 666
d2gh1a1 281 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bac 5e-06
d2gh1a1281 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bac 0.002
d1wzna1251 c.66.1.43 (A:1-251) Hypothetical methyltransferase 4e-05
d1y8ca_246 c.66.1.43 (A:) Putative methyltransferase CAC2371 0.001
d1y8ca_246 c.66.1.43 (A:) Putative methyltransferase CAC2371 0.002
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Length = 281 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: BC2162-like
domain: Methyltransferase BC2162
species: Bacillus cereus [TaxId: 1396]

 Score = 46.4 bits (109), Expect = 5e-06
 Identities = 19/123 (15%), Positives = 41/123 (33%)

Query: 500 YWNEIIESYVRALHWKKMKLRNVLDMRAGFGGFAAALIEQKFDCWVMNVVPVSGFNTLPV 559
           Y+N+   S++    WK  K  +++D   G+G     L+    +      +          
Sbjct: 9   YYNDDYVSFLVNTVWKITKPVHIVDYGCGYGYLGLVLMPLLPEGSKYTGIDSGETLLAEA 68

Query: 560 IYDRGLIGVMHDWCEPFDTYPRTYDLLHAAGLFSVESKRCNMSTIMLEMDRMLRPGGHVY 619
                L+    ++ E   T     D    A   +         T++ +M   ++ GG + 
Sbjct: 69  RELFRLLPYDSEFLEGDATEIELNDKYDIAICHAFLLHMTTPETMLQKMIHSVKKGGKII 128

Query: 620 IRD 622
             +
Sbjct: 129 CFE 131
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Length = 281 Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 251 Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Length = 246 Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Length = 246 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query666
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 99.69
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 99.69
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 99.65
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 99.62
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 99.6
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 99.58
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 99.55
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 99.53
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 99.53
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 99.52
d2gh1a1281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 99.5
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 99.49
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 99.49
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 99.45
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 99.42
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 99.42
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 99.39
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 99.39
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 99.39
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 99.37
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 99.34
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 99.33
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 99.32
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 99.31
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 99.31
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 99.31
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 99.29
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 99.28
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 99.28
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 99.24
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 99.21
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 99.2
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 99.2
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 99.19
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 99.18
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 99.18
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 99.17
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 99.17
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 99.15
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 99.15
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 99.15
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 99.15
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 99.14
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 99.13
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 99.11
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 99.11
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 99.11
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 99.1
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 99.08
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 99.07
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 99.07
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 99.07
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 99.04
d2fyta1311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 99.04
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 99.02
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 98.99
d1oria_316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 98.98
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 98.98
d1g6q1_328 Arginine methyltransferase, HMT1 {Baker's yeast (S 98.97
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 98.96
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 98.95
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 98.94
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 98.94
d2gh1a1 281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 98.93
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 98.92
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 98.92
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 98.91
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 98.89
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 98.88
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 98.88
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 98.87
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 98.86
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 98.76
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 98.76
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 98.74
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 98.72
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 98.71
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 98.69
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 98.66
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 98.65
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 98.61
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 98.61
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 98.61
d1g6q1_ 328 Arginine methyltransferase, HMT1 {Baker's yeast (S 98.6
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 98.57
d2fyta1 311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 98.57
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 98.57
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 98.56
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 98.56
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 98.54
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 98.54
d1oria_ 316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 98.54
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 98.53
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 98.53
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 98.51
d1af7a2193 Chemotaxis receptor methyltransferase CheR, C-term 98.48
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 98.4
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 98.38
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 98.25
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 98.24
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 98.23
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 98.15
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 98.12
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 98.1
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 98.1
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 98.08
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 98.02
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 98.01
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 98.0
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 98.0
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 98.0
d2h00a1250 Methyltransferase 10 domain containing protein MET 97.98
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 97.97
d2f8la1328 Hypothetical protein Lmo1582 {Listeria monocytogen 97.96
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 97.96
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 97.95
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 97.86
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 97.84
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 97.83
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 97.74
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 97.7
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 97.7
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 97.67
d2ih2a1223 DNA methylase TaqI, N-terminal domain {Thermus aqu 97.66
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 97.66
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 97.63
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 97.63
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 97.6
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 97.59
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 97.58
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 97.58
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 97.57
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 97.56
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 97.54
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 97.48
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 97.46
d1jsxa_207 Glucose-inhibited division protein B (GidB) {Esche 97.39
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 97.38
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 97.36
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 97.34
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 97.26
d1ej0a_180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 97.25
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 97.25
d1qama_235 rRNA adenine dimethylase {Bacillus subtilis, Ermc' 97.24
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 97.2
d1xdza_239 Glucose-inhibited division protein B (GidB) {Bacil 97.13
d1xdza_239 Glucose-inhibited division protein B (GidB) {Bacil 97.1
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 97.09
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 97.08
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 97.04
d1ej0a_180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 97.03
d1yuba_245 rRNA adenine dimethylase {Streptococcus pneumoniae 97.01
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 96.99
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 96.89
d1af7a2193 Chemotaxis receptor methyltransferase CheR, C-term 96.87
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 96.8
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 96.78
d2okca1425 Type I restriction enzyme StySJI M protein {Bacter 96.72
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 96.7
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, R 96.48
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 96.45
d2p41a1257 An RNA cap (nucleoside-2'-O-)-methyltransferase do 96.37
d1ixka_313 Hypothetical methyltransferase PH1374 {Archaeon Py 96.35
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 96.26
d1jsxa_207 Glucose-inhibited division protein B (GidB) {Esche 96.24
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 96.23
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 96.18
d1zq9a1278 Probable dimethyladenosine transferase {Human (Hom 95.84
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 95.79
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 95.76
d1qyra_252 High level kasugamycin resistance protein KsgA {Es 95.66
d2ar0a1524 M.EcoKI {Escherichia coli [TaxId: 562]} 95.65
d2bm8a1232 Cephalosporin hydroxylase CmcI {Streptomyces clavu 95.64
d2b9ea1293 NOL1R {Human (Homo sapiens) [TaxId: 9606]} 95.43
d2ih2a1223 DNA methylase TaqI, N-terminal domain {Thermus aqu 95.38
d2dula1375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 95.33
d2f8la1328 Hypothetical protein Lmo1582 {Listeria monocytogen 94.65
d2p41a1257 An RNA cap (nucleoside-2'-O-)-methyltransferase do 94.36
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 94.3
d1m6ex_359 Salicylic acid carboxyl methyltransferase (SAMT) { 94.15
d2h00a1250 Methyltransferase 10 domain containing protein MET 94.1
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 93.57
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 93.57
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 93.41
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 93.29
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 93.1
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 92.85
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 92.65
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 92.26
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 91.84
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, R 91.48
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 91.31
d1ixka_313 Hypothetical methyltransferase PH1374 {Archaeon Py 91.21
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 91.06
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 90.47
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 90.35
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 90.25
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 89.73
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 89.29
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 88.42
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 88.27
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 87.56
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 86.56
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 83.19
d1i4wa_322 Transcription factor sc-mtTFB {Baker's yeast (Sacc 82.93
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 82.43
d1yuba_245 rRNA adenine dimethylase {Streptococcus pneumoniae 80.61
d2bm8a1232 Cephalosporin hydroxylase CmcI {Streptomyces clavu 80.36
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: UbiE/COQ5-like
domain: Hypothetical protein YcgJ
species: Bacillus subtilis [TaxId: 1423]

Probab=99.69  E-value=1.1e-16  Score=158.53  Aligned_cols=103  Identities=24%  Similarity=0.399  Sum_probs=88.3

Q ss_pred             CCCCeEEEECCCCchhHHHhccC--CeEEEeCCcchHHHHHHHHHHHcCCC-ceEEeecccCCCCCCCCeeEEEeccccc
Q 005981          273 HHIRVVMDAGCGVASFGAYLLPR--NVITMSIAPKDVHENQIQFALERGAP-AMVAAFATRRLPYPSQAFDLIHCSRCRI  349 (666)
Q Consensus       273 ~~~~~VLDIGCGtG~~a~~L~~~--~V~gvDiS~~~l~~a~~~~a~~rg~~-~~~~~~d~e~Lpf~d~sFDlVv~s~~l~  349 (666)
                      +++.+|||||||+|.++..|+++  +|+|+|+|+.|+..|+. .+...+.. ..+...+++++|+++++||+|+|..+++
T Consensus        15 ~~~~rILDiGcGtG~~~~~la~~~~~v~gvD~S~~~l~~A~~-~~~~~~~~~~~~~~~d~~~~~~~~~~fD~v~~~~~l~   93 (234)
T d1xxla_          15 RAEHRVLDIGAGAGHTALAFSPYVQECIGVDATKEMVEVASS-FAQEKGVENVRFQQGTAESLPFPDDSFDIITCRYAAH   93 (234)
T ss_dssp             CTTCEEEEESCTTSHHHHHHGGGSSEEEEEESCHHHHHHHHH-HHHHHTCCSEEEEECBTTBCCSCTTCEEEEEEESCGG
T ss_pred             CCCCEEEEeCCcCcHHHHHHHHhCCeEEEEeCChhhhhhhhh-hhcccccccccccccccccccccccccceeeeeceee
Confidence            45689999999999999999887  99999999999988874 44555554 4556667899999999999999998866


Q ss_pred             ccccChHHHHHHHHHhccCCeEEEEEEC
Q 005981          350 NWTRDDGILLLEVNRMLRAGGYFAWAAQ  377 (666)
Q Consensus       350 h~~~d~~~~L~el~RvLkPGG~lv~st~  377 (666)
                      |+ +++..+|+++.|+|||||+++++.+
T Consensus        94 ~~-~d~~~~l~~~~r~LkpgG~~~~~~~  120 (234)
T d1xxla_          94 HF-SDVRKAVREVARVLKQDGRFLLVDH  120 (234)
T ss_dssp             GC-SCHHHHHHHHHHHEEEEEEEEEEEE
T ss_pred             cc-cCHHHHHHHHHHeeCCCcEEEEEEc
Confidence            65 8999999999999999999999864
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bm8a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1m6ex_ c.66.1.35 (X:) Salicylic acid carboxyl methyltransferase (SAMT) {Clarkia breweri [TaxId: 36903]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} Back     information, alignment and structure
>d2bm8a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure