Citrus Sinensis ID: 005993
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 666 | ||||||
| 255540135 | 816 | zinc finger protein, putative [Ricinus c | 0.909 | 0.742 | 0.655 | 0.0 | |
| 297734460 | 830 | unnamed protein product [Vitis vinifera] | 0.906 | 0.727 | 0.635 | 0.0 | |
| 359491569 | 2234 | PREDICTED: uncharacterized protein LOC10 | 0.906 | 0.270 | 0.635 | 0.0 | |
| 224119746 | 862 | predicted protein [Populus trichocarpa] | 0.900 | 0.696 | 0.647 | 0.0 | |
| 356527801 | 820 | PREDICTED: uncharacterized protein LOC10 | 0.885 | 0.719 | 0.605 | 0.0 | |
| 449440961 | 824 | PREDICTED: uncharacterized protein LOC10 | 0.900 | 0.728 | 0.635 | 0.0 | |
| 449501464 | 794 | PREDICTED: uncharacterized LOC101222073 | 0.866 | 0.726 | 0.609 | 0.0 | |
| 297792383 | 804 | hypothetical protein ARALYDRAFT_495140 [ | 0.840 | 0.696 | 0.576 | 0.0 | |
| 240256429 | 819 | Histidine kinase-, DNA gyrase B-, and HS | 0.867 | 0.705 | 0.557 | 0.0 | |
| 9757986 | 823 | unnamed protein product [Arabidopsis tha | 0.851 | 0.688 | 0.556 | 0.0 |
| >gi|255540135|ref|XP_002511132.1| zinc finger protein, putative [Ricinus communis] gi|223550247|gb|EEF51734.1| zinc finger protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 826 bits (2134), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 429/654 (65%), Positives = 485/654 (74%), Gaps = 48/654 (7%)
Query: 30 ICFADNGGGMNPDKMRHCMSLGYSAKSKAANTIGQYGNGFKTSTMRLGADVIVFSCCCGK 89
+ DNGGGM+PDKMR CMSLGYSAKSK ANTIGQYGNGFKTSTMRLGADVIVFS C GK
Sbjct: 194 LLIEDNGGGMDPDKMRQCMSLGYSAKSKVANTIGQYGNGFKTSTMRLGADVIVFSRCPGK 253
Query: 90 DGKSPTRSIGLLSYTFLRSTGKEDIVVPMLDYEGSQQEWKKIIRSSLDDWNRNVETIVQW 149
DGKSPT+SIGLLSYTFLRSTGKEDIVVPMLDYE QEW K+IRSS DWNRNVETIVQW
Sbjct: 254 DGKSPTQSIGLLSYTFLRSTGKEDIVVPMLDYERKGQEWNKMIRSSSGDWNRNVETIVQW 313
Query: 150 SPFSSEADLLHQFNLMKDHGTRIIIYNLWEDDQGLLELDFDSDKHDIQLRGVNRDEQNIK 209
SPFSSEADLL QFNLM DHGTRI+IYNLWEDD+G LELDFD+D HDIQLRGVNRDE+NI+
Sbjct: 314 SPFSSEADLLRQFNLMSDHGTRIVIYNLWEDDEGSLELDFDTDPHDIQLRGVNRDEKNIQ 373
Query: 210 MAQHYPNSRHFLTYRHSLRSYASILYLRLPPGFRIIIRGKDVEHHNIVNDMMLSKKVTYR 269
MA+ +PNSRHFLTYRHSLRSYASILYLRLPP FRII+RGKDVEHHNIVNDMMLS+++TYR
Sbjct: 374 MAKEFPNSRHFLTYRHSLRSYASILYLRLPPCFRIILRGKDVEHHNIVNDMMLSQEITYR 433
Query: 270 PQPGASGIPTDL---HMAVDVTIGFVKDAKHHIDVQGFNVYHKNRLIKPFWRLWNASGSD 326
PQ A G+ D HMA VTIGFVKDAKHHIDVQGFNVYHKNRLIKPFWRLWNA+GSD
Sbjct: 434 PQ-SADGVAKDFNLNHMAAIVTIGFVKDAKHHIDVQGFNVYHKNRLIKPFWRLWNAAGSD 492
Query: 327 GRGVIGVLEANFVEPAHDKQGFERTTVLARLEARLIQMQKDYWNNNCHEIGYAPRRYKKY 386
GRGVIGVLEANFVEPAHDKQGFERTTVLARLEARL+QMQK YW+ NCH+IGYAPRR K++
Sbjct: 493 GRGVIGVLEANFVEPAHDKQGFERTTVLARLEARLVQMQKTYWSTNCHKIGYAPRRNKRF 552
Query: 387 IKDSYD-------REISSK-KSYPSRHKITDSSHSDKHQLHSNQRWEGKDSKRLPEASNY 438
I +S D ++SS+ K Y + SS SDK H+NQ GK S + N
Sbjct: 553 INESTDGGSSPDYSQVSSQSKKYSALRGKGLSSLSDKFYSHANQN-GGKRSDTFAKNGNP 611
Query: 439 GDRKGHESSKGKYKMKTPVKYREGASVSEPLSPSAEDASDDDMHVMVTARGANGSSQKIL 498
GH SS G KT P SPS D D+D H+ + R
Sbjct: 612 AYANGHVSSNGSDGTKTSTGSGRKTHSKAPSSPSLHDVDDNDAHIALPTR---------- 661
Query: 499 AAEKSFGKDGLHRTHPSACLVDSESQQDGASGGSSVRPFMPSQSKGSEVNYPEHFLSDCS 558
+DGLH S+ L D+ Q SQSK +V+ +H L +
Sbjct: 662 -------QDGLHMVRLSSPLEDTTQQ-----------AVTRSQSKAGKVDNSQHVLPESD 703
Query: 559 LGANLGQLKQENHELKKRLEKKEGELQEER------ERCRSLEAQLKVMQQTIEELNKEQ 612
L N+ +LKQEN EL++RL+K+E E Q E +C+SLE QL+ QQ IEELNKEQ
Sbjct: 704 L-CNINELKQENQELRERLKKREAEFQGEMMHGSMCNKCKSLEIQLQEAQQKIEELNKEQ 762
Query: 613 ESLIDIFAEERDRREREEENLRKKIKDASDTIQDLLDKIKLLEKMKTPSIRAGR 666
ESLIDIF+EERDRR++EEENLRKK KDAS+TIQ LLDK++LLEKMK+P+ RA R
Sbjct: 763 ESLIDIFSEERDRRDKEEENLRKKYKDASNTIQQLLDKVRLLEKMKSPNYRAER 816
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|297734460|emb|CBI15707.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359491569|ref|XP_002280533.2| PREDICTED: uncharacterized protein LOC100266246 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224119746|ref|XP_002318152.1| predicted protein [Populus trichocarpa] gi|222858825|gb|EEE96372.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356527801|ref|XP_003532495.1| PREDICTED: uncharacterized protein LOC100816702 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449440961|ref|XP_004138252.1| PREDICTED: uncharacterized protein LOC101222073 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449501464|ref|XP_004161374.1| PREDICTED: uncharacterized LOC101222073 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|297792383|ref|XP_002864076.1| hypothetical protein ARALYDRAFT_495140 [Arabidopsis lyrata subsp. lyrata] gi|297309911|gb|EFH40335.1| hypothetical protein ARALYDRAFT_495140 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|240256429|ref|NP_199891.4| Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase family protein [Arabidopsis thaliana] gi|332008608|gb|AED95991.1| Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase family protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|9757986|dbj|BAA96991.2| unnamed protein product [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 666 | ||||||
| TAIR|locus:2117358 | 707 | AT4G24970 [Arabidopsis thalian | 0.599 | 0.564 | 0.737 | 8.3e-177 | |
| TAIR|locus:2163320 | 819 | AT5G50780 [Arabidopsis thalian | 0.558 | 0.454 | 0.726 | 1.5e-166 | |
| TAIR|locus:2179837 | 708 | AT5G13130 [Arabidopsis thalian | 0.534 | 0.502 | 0.652 | 1.5e-138 | |
| TAIR|locus:2122264 | 635 | CRT1 "compromised recognition | 0.510 | 0.535 | 0.508 | 1.1e-91 | |
| TAIR|locus:2122254 | 626 | CRH1 "CRT1 Homologue 1" [Arabi | 0.509 | 0.541 | 0.498 | 2.9e-87 | |
| TAIR|locus:2011226 | 663 | DMS11 "DEFECTIVE IN MERISTEM S | 0.493 | 0.496 | 0.510 | 3.9e-83 | |
| TAIR|locus:2122244 | 486 | AT4G36270 "AT4G36270" [Arabido | 0.483 | 0.662 | 0.446 | 7.2e-68 | |
| ZFIN|ZDB-GENE-060929-544 | 422 | zgc:152774 "zgc:152774" [Danio | 0.519 | 0.819 | 0.328 | 1.9e-44 | |
| ZFIN|ZDB-GENE-030131-1502 | 1079 | morc3a "MORC family CW-type zi | 0.486 | 0.300 | 0.348 | 7.1e-44 | |
| ZFIN|ZDB-GENE-040801-98 | 763 | morc3b "MORC family CW-type zi | 0.267 | 0.233 | 0.343 | 7.4e-35 |
| TAIR|locus:2117358 AT4G24970 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1583 (562.3 bits), Expect = 8.3e-177, Sum P(2) = 8.3e-177
Identities = 301/408 (73%), Positives = 342/408 (83%)
Query: 34 DNGGGMNPDKMRHCMSLGYSAKSKAANTIGQYGNGFKTSTMRLGADVIVFSCCCGKDGKS 93
DNGGGM+P+KMR CMSLGYSAKSK ANTIGQYGNGFKTSTMRLGADVIVFS C GKDGKS
Sbjct: 220 DNGGGMDPEKMRQCMSLGYSAKSKLANTIGQYGNGFKTSTMRLGADVIVFSRCPGKDGKS 279
Query: 94 PTRSIGLLSYTFLRSTGKEDIVVPMLDYEGSQQEWKKIIRSSLDDWNRNVETIVQWSPFS 153
T+SIGLLSYTFLRSTGKEDIVVPMLDYE EW KIIRSS DW++NVETI+QWSPFS
Sbjct: 280 STQSIGLLSYTFLRSTGKEDIVVPMLDYERRDPEWSKIIRSSTRDWDKNVETIIQWSPFS 339
Query: 154 SEADLLHQFNLMKDHGTRIIIYNLWEDDQGLLELDFDSDKHDIQLRGVNRDEQNIKMAQH 213
SE DLLHQF+LMKD GTRIIIYNLWEDDQG+LELDFD+D +DIQLRGVNR+E+NIKMA
Sbjct: 340 SEEDLLHQFDLMKDRGTRIIIYNLWEDDQGMLELDFDADPYDIQLRGVNREERNIKMASQ 399
Query: 214 YPNSRHFLTYRHSLRSYASILYLRLPPGFRIIIRGKDVEHHNIVNDMMLSKKVTYRPQPG 273
+PNSRHFLTY+HSLRSY SILYLR+PPGFRII+RG DVEHH++VNDMM ++++TYRPQ
Sbjct: 400 FPNSRHFLTYKHSLRSYVSILYLRIPPGFRIILRGIDVEHHSVVNDMMQTEQITYRPQSE 459
Query: 274 ASGIPTDLHMAVDVTIGFVKDAKHHIDVQGFNVYHKNRLIKPFWRLWNASGSDGRGVIGV 333
+ G+ T+ M+ V IGFVKDAKHH+DVQGFNVYHKNRLIKPFWR+WNA+GSDGRGVIGV
Sbjct: 460 SYGVVTN--MSAIVIIGFVKDAKHHVDVQGFNVYHKNRLIKPFWRIWNATGSDGRGVIGV 517
Query: 334 LEANFVEPAHDKQGFERTTVLARLEARLIQMQKDYWNNNCHEIGYAPRRYKK--YIKDSY 391
LEANFVEPAHDKQGFERTTVLARLE+RL+QMQK YW+ NCH+IGYAPRR +K Y D+
Sbjct: 518 LEANFVEPAHDKQGFERTTVLARLESRLVQMQKTYWSTNCHKIGYAPRRREKSAYGYDNR 577
Query: 392 DREISSKKSYPSRHKI----TDSSHSDKHQLHSNQRW-EGKDSKRLPE 434
D + + PS K +D +S + H+ GKD RL E
Sbjct: 578 DSSPENDREGPSSIKTPTPASDKFYSSSYPNHNGDNGVSGKDGARLQE 625
|
|
| TAIR|locus:2163320 AT5G50780 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2179837 AT5G13130 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2122264 CRT1 "compromised recognition of TCV 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2122254 CRH1 "CRT1 Homologue 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2011226 DMS11 "DEFECTIVE IN MERISTEM SILENCING 11" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2122244 AT4G36270 "AT4G36270" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-060929-544 zgc:152774 "zgc:152774" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-1502 morc3a "MORC family CW-type zinc finger 3a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040801-98 morc3b "MORC family CW-type zinc finger 3b" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 666 | |||
| pfam13589 | 134 | pfam13589, HATPase_c_3, Histidine kinase-, DNA gyr | 1e-09 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 4e-08 | |
| pfam05103 | 131 | pfam05103, DivIVA, DivIVA protein | 4e-07 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 8e-07 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-06 | |
| COG2433 | 652 | COG2433, COG2433, Uncharacterized conserved protei | 1e-06 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 2e-06 | |
| PRK00409 | 782 | PRK00409, PRK00409, recombination and DNA strand e | 2e-06 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 5e-06 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 6e-06 | |
| pfam07888 | 546 | pfam07888, CALCOCO1, Calcium binding and coiled-co | 6e-06 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 1e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-05 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 2e-05 | |
| smart00935 | 140 | smart00935, OmpH, Outer membrane protein (OmpH-lik | 3e-05 | |
| COG4026 | 290 | COG4026, COG4026, Uncharacterized protein containi | 4e-05 | |
| COG4026 | 290 | COG4026, COG4026, Uncharacterized protein containi | 5e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 6e-05 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 7e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-04 | |
| pfam00769 | 244 | pfam00769, ERM, Ezrin/radixin/moesin family | 1e-04 | |
| pfam11559 | 149 | pfam11559, ADIP, Afadin- and alpha -actinin-Bindin | 1e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-04 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 2e-04 | |
| pfam04156 | 186 | pfam04156, IncA, IncA protein | 2e-04 | |
| TIGR04211 | 198 | TIGR04211, SH3_and_anchor, SH3 domain protein | 2e-04 | |
| pfam13514 | 1118 | pfam13514, AAA_27, AAA domain | 2e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 2e-04 | |
| pfam13851 | 201 | pfam13851, GAS, Growth-arrest specific micro-tubul | 2e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 3e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 3e-04 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 3e-04 | |
| pfam03938 | 157 | pfam03938, OmpH, Outer membrane protein (OmpH-like | 3e-04 | |
| pfam00038 | 312 | pfam00038, Filament, Intermediate filament protein | 3e-04 | |
| pfam09726 | 680 | pfam09726, Macoilin, Transmembrane protein | 4e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 5e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 5e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 5e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 5e-04 | |
| TIGR00414 | 418 | TIGR00414, serS, seryl-tRNA synthetase | 5e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 6e-04 | |
| pfam04156 | 186 | pfam04156, IncA, IncA protein | 6e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 6e-04 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 9e-04 | |
| pfam03962 | 188 | pfam03962, Mnd1, Mnd1 family | 9e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.001 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.001 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.001 | |
| smart00935 | 140 | smart00935, OmpH, Outer membrane protein (OmpH-lik | 0.001 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.001 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.001 | |
| pfam06148 | 133 | pfam06148, COG2, COG (conserved oligomeric Golgi) | 0.001 | |
| TIGR03185 | 650 | TIGR03185, DNA_S_dndD, DNA sulfur modification pro | 0.001 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 0.001 | |
| COG1579 | 239 | COG1579, COG1579, Zn-ribbon protein, possibly nucl | 0.001 | |
| pfam10174 | 774 | pfam10174, Cast, RIM-binding protein of the cytoma | 0.001 | |
| smart00787 | 312 | smart00787, Spc7, Spc7 kinetochore protein | 0.001 | |
| pfam13868 | 349 | pfam13868, Trichoplein, Tumour suppressor, Mitosta | 0.001 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.002 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 0.002 | |
| pfam04156 | 186 | pfam04156, IncA, IncA protein | 0.002 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.002 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 0.002 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 0.002 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 0.002 | |
| COG4942 | 420 | COG4942, COG4942, Membrane-bound metallopeptidase | 0.002 | |
| COG0172 | 429 | COG0172, SerS, Seryl-tRNA synthetase [Translation, | 0.002 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.003 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.003 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.003 | |
| COG1579 | 239 | COG1579, COG1579, Zn-ribbon protein, possibly nucl | 0.003 | |
| pfam05622 | 713 | pfam05622, HOOK, HOOK protein | 0.003 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.004 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.004 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.004 | |
| pfam00769 | 244 | pfam00769, ERM, Ezrin/radixin/moesin family | 0.004 | |
| pfam13514 | 1118 | pfam13514, AAA_27, AAA domain | 0.004 | |
| pfam13863 | 126 | pfam13863, DUF4200, Domain of unknown function (DU | 0.004 | |
| PRK04863 | 1486 | PRK04863, mukB, cell division protein MukB; Provis | 0.004 |
| >gnl|CDD|222246 pfam13589, HATPase_c_3, Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase | Back alignment and domain information |
|---|
Score = 56.5 bits (137), Expect = 1e-09
Identities = 27/93 (29%), Positives = 48/93 (51%), Gaps = 8/93 (8%)
Query: 30 ICFADNGGGMNPDKMRHCMSLGYSAKSKA--ANTIGQYGNGFKTSTMRLGADVIVFSCCC 87
I DNGGGM+ +++R+ + LG S+K + T+G+ G G K +++ LG + V S
Sbjct: 35 ISIEDNGGGMSYEELRNALKLGRSSKEGERDSTTLGRKGIGMKLASLSLGRKLTVTS--- 91
Query: 88 GKDGKSPTRSIGLLSYTFLRSTGKEDIVVPMLD 120
K+G+S T ++ + G+ D+
Sbjct: 92 KKEGESSTLTL---DLDDIDKEGEWDLPELTSA 121
|
This family represents, additionally, the structurally related ATPase domains of histidine kinase, DNA gyrase B and HSP90. Length = 134 |
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|218434 pfam05103, DivIVA, DivIVA protein | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|225288 COG2433, COG2433, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|116500 pfam07888, CALCOCO1, Calcium binding and coiled-coil domain (CALCOCO1) like | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214922 smart00935, OmpH, Outer membrane protein (OmpH-like) | Back alignment and domain information |
|---|
| >gnl|CDD|226513 COG4026, COG4026, Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|226513 COG4026, COG4026, Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|216108 pfam00769, ERM, Ezrin/radixin/moesin family | Back alignment and domain information |
|---|
| >gnl|CDD|192773 pfam11559, ADIP, Afadin- and alpha -actinin-Binding | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217933 pfam04156, IncA, IncA protein | Back alignment and domain information |
|---|
| >gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein | Back alignment and domain information |
|---|
| >gnl|CDD|205692 pfam13514, AAA_27, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|222417 pfam13851, GAS, Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217803 pfam03938, OmpH, Outer membrane protein (OmpH-like) | Back alignment and domain information |
|---|
| >gnl|CDD|200948 pfam00038, Filament, Intermediate filament protein | Back alignment and domain information |
|---|
| >gnl|CDD|220365 pfam09726, Macoilin, Transmembrane protein | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|232965 TIGR00414, serS, seryl-tRNA synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|217933 pfam04156, IncA, IncA protein | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|202833 pfam03962, Mnd1, Mnd1 family | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|214922 smart00935, OmpH, Outer membrane protein (OmpH-like) | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|218912 pfam06148, COG2, COG (conserved oligomeric Golgi) complex component, COG2 | Back alignment and domain information |
|---|
| >gnl|CDD|234141 TIGR03185, DNA_S_dndD, DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|220614 pfam10174, Cast, RIM-binding protein of the cytomatrix active zone | Back alignment and domain information |
|---|
| >gnl|CDD|197874 smart00787, Spc7, Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|217933 pfam04156, IncA, IncA protein | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|223250 COG0172, SerS, Seryl-tRNA synthetase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|218661 pfam05622, HOOK, HOOK protein | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|216108 pfam00769, ERM, Ezrin/radixin/moesin family | Back alignment and domain information |
|---|
| >gnl|CDD|205692 pfam13514, AAA_27, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|206034 pfam13863, DUF4200, Domain of unknown function (DUF4200) | Back alignment and domain information |
|---|
| >gnl|CDD|235316 PRK04863, mukB, cell division protein MukB; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 666 | |||
| KOG1845 | 775 | consensus MORC family ATPases [Cell cycle control, | 100.0 | |
| KOG1845 | 775 | consensus MORC family ATPases [Cell cycle control, | 99.97 | |
| PF13589 | 137 | HATPase_c_3: Histidine kinase-, DNA gyrase B-, and | 99.08 | |
| PRK05218 | 613 | heat shock protein 90; Provisional | 99.02 | |
| PRK14083 | 601 | HSP90 family protein; Provisional | 98.51 | |
| COG0326 | 623 | HtpG Molecular chaperone, HSP90 family [Posttransl | 97.59 | |
| PTZ00130 | 814 | heat shock protein 90; Provisional | 97.57 | |
| PRK00095 | 617 | mutL DNA mismatch repair protein; Reviewed | 97.41 | |
| PTZ00272 | 701 | heat shock protein 83 kDa (Hsp83); Provisional | 97.35 | |
| TIGR00585 | 312 | mutl DNA mismatch repair protein MutL. All protein | 96.75 | |
| KOG0019 | 656 | consensus Molecular chaperone (HSP90 family) [Post | 96.17 | |
| COG1389 | 538 | DNA topoisomerase VI, subunit B [DNA replication, | 96.08 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 95.41 | |
| PF10267 | 395 | Tmemb_cc2: Predicted transmembrane and coiled-coil | 95.4 | |
| PRK14868 | 795 | DNA topoisomerase VI subunit B; Provisional | 95.39 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 95.24 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 95.18 | |
| KOG0020 | 785 | consensus Endoplasmic reticulum glucose-regulated | 95.08 | |
| KOG3850 | 455 | consensus Predicted membrane protein [Function unk | 94.89 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 94.7 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 94.52 | |
| PRK04184 | 535 | DNA topoisomerase VI subunit B; Validated | 94.11 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 93.72 | |
| PF02518 | 111 | HATPase_c: Histidine kinase-, DNA gyrase B-, and H | 93.42 | |
| PF06705 | 247 | SF-assemblin: SF-assemblin/beta giardin | 92.99 | |
| TIGR01052 | 488 | top6b DNA topoisomerase VI, B subunit. This model | 92.61 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 92.04 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 91.87 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 91.22 | |
| PF14362 | 301 | DUF4407: Domain of unknown function (DUF4407) | 90.87 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 90.85 | |
| PRK11637 | 428 | AmiB activator; Provisional | 90.42 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 90.4 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 89.84 | |
| PF15254 | 861 | CCDC14: Coiled-coil domain-containing protein 14 | 89.44 | |
| KOG0243 | 1041 | consensus Kinesin-like protein [Cytoskeleton] | 89.42 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 89.25 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 89.03 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 88.87 | |
| COG0323 | 638 | MutL DNA mismatch repair enzyme (predicted ATPase) | 88.45 | |
| PF07200 | 150 | Mod_r: Modifier of rudimentary (Mod(r)) protein; I | 88.35 | |
| smart00387 | 111 | HATPase_c Histidine kinase-like ATPases. Histidine | 88.12 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 87.98 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 87.85 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 87.78 | |
| COG3290 | 537 | CitA Signal transduction histidine kinase regulati | 87.67 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 87.41 | |
| PRK10604 | 433 | sensor protein RstB; Provisional | 87.12 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 87.11 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 87.05 | |
| KOG1962 | 216 | consensus B-cell receptor-associated protein and r | 86.12 | |
| PRK11637 | 428 | AmiB activator; Provisional | 86.11 | |
| PF15294 | 278 | Leu_zip: Leucine zipper | 85.97 | |
| TIGR03752 | 472 | conj_TIGR03752 integrating conjugative element pro | 85.6 | |
| PF03962 | 188 | Mnd1: Mnd1 family; InterPro: IPR005647 This family | 85.5 | |
| PRK11100 | 475 | sensory histidine kinase CreC; Provisional | 85.41 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 85.0 | |
| PRK14867 | 659 | DNA topoisomerase VI subunit B; Provisional | 84.98 | |
| cd00075 | 103 | HATPase_c Histidine kinase-like ATPases; This fami | 84.61 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 84.55 | |
| KOG2129 | 552 | consensus Uncharacterized conserved protein H4 [Fu | 84.47 | |
| TIGR02449 | 65 | conserved hypothetical protein TIGR02449. Members | 84.44 | |
| PF15236 | 157 | CCDC66: Coiled-coil domain-containing protein 66 | 84.34 | |
| KOG4360 | 596 | consensus Uncharacterized coiled coil protein [Fun | 84.34 | |
| PRK05431 | 425 | seryl-tRNA synthetase; Provisional | 84.22 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 84.21 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 84.15 | |
| PF06785 | 401 | UPF0242: Uncharacterised protein family (UPF0242); | 84.1 | |
| PLN02320 | 502 | seryl-tRNA synthetase | 83.95 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 83.55 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 83.49 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 83.41 | |
| PRK00409 | 782 | recombination and DNA strand exchange inhibitor pr | 83.4 | |
| TIGR01069 | 771 | mutS2 MutS2 family protein. Function of MutS2 is u | 83.32 | |
| PRK09470 | 461 | cpxA two-component sensor protein; Provisional | 83.29 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 83.21 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 83.15 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 82.88 | |
| smart00502 | 127 | BBC B-Box C-terminal domain. Coiled coil region C- | 82.85 | |
| KOG1962 | 216 | consensus B-cell receptor-associated protein and r | 82.84 | |
| TIGR01386 | 457 | cztS_silS_copS heavy metal sensor kinase. Members | 82.84 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 82.8 | |
| PRK10780 | 165 | periplasmic chaperone; Provisional | 82.67 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 82.4 | |
| PF04949 | 159 | Transcrip_act: Transcriptional activator; InterPro | 82.11 | |
| PF02403 | 108 | Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom | 82.01 | |
| PRK09303 | 380 | adaptive-response sensory kinase; Validated | 81.81 | |
| KOG1853 | 333 | consensus LIS1-interacting protein NUDE [Cytoskele | 81.81 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 81.8 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 81.01 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 80.86 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 80.84 | |
| PF07334 | 76 | IFP_35_N: Interferon-induced 35 kDa protein (IFP 3 | 80.66 | |
| PF12777 | 344 | MT: Microtubule-binding stalk of dynein motor; Int | 80.48 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 80.35 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 80.2 | |
| PRK09039 | 343 | hypothetical protein; Validated | 80.02 | |
| PRK10549 | 466 | signal transduction histidine-protein kinase BaeS; | 80.01 |
| >KOG1845 consensus MORC family ATPases [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.7e-53 Score=481.13 Aligned_cols=558 Identities=37% Similarity=0.554 Sum_probs=406.3
Q ss_pred cccccccchhcccCCCCCCCcceEEEE-----ECCCCCCHHHHHHHHhcCCCCCCCccccccccCCcccccccccCCeEE
Q 005993 7 GLFSNSKMLQLCSNLPSLWSFHCICFA-----DNGGGMNPDKMRHCMSLGYSAKSKAANTIGQYGNGFKTSTMRLGADVI 81 (666)
Q Consensus 7 ~~~~~a~a~n~~i~~~~~~G~~~L~I~-----DDG~GMd~~el~~~msfG~s~k~~~~~~IGrYGnGfKTgSMRLGkdvi 81 (666)
++|+..+-+|-+.|. -.+.++|+ |||+||+++-+..||.+|++++......+|||||||||++||||++++
T Consensus 166 ~tf~~vd~I~p~~d~----~i~a~~v~~~~~s~~gg~~~~~~i~~~m~l~~~~k~e~~~tv~q~~~gfktst~rlGa~~i 241 (775)
T KOG1845|consen 166 ATFVRVDYINPVMDI----FIRALVVQLKRISDDGGGMKPEVIRKCMSLGYSSKKEANSTVGQYGNGFKTSTMRLGADAI 241 (775)
T ss_pred cceEEeeeecccccc----cceeEEeeccceeccccccCHHHHHHHHHhhhhhhhhhhhhhhhhccccccchhhhcccee
Confidence 577666666666553 26788888 679999999999999999999975578999999999999999999999
Q ss_pred EEeeecCCCCCCCceeEeehhhhhhhhcCCCceEEee----eeeccCccceeeeeccchhhHHHHHHH-----HhhcCCC
Q 005993 82 VFSCCCGKDGKSPTRSIGLLSYTFLRSTGKEDIVVPM----LDYEGSQQEWKKIIRSSLDDWNRNVET-----IVQWSPF 152 (666)
Q Consensus 82 VfSK~~g~~~~~~t~SigLLS~TFL~~~g~deIvVPm----vswdld~~~~~~ii~~~~~dw~~nL~i-----IlkySPF 152 (666)
||+|..+..|...+++|||||||||+.++.++++||| ..++...+.|.+|++.+..+|..|+.+ +++|+||
T Consensus 242 ~~~R~~~~~~~kstqsiglls~tfL~~t~~~d~iv~~~~i~~~~e~~~~~~~~i~~~s~~~~~~n~~i~~~~~~L~w~p~ 321 (775)
T KOG1845|consen 242 VFSRCESRRGLKSTQSIGLLSYTFLRKTGKRDFIVPMRLIKMDYEKSDQLWQGILYKSGVDWAVNLEIEVTERFLKWSPY 321 (775)
T ss_pred EeehhhhhccCCcceeEEEEEEeeeccccCCceeEecchhhhhhhcccccccceeeccccccceeeeeHHHHHHhhcCcc
Confidence 9999877789999999999999999999999999999 889988888999998889999999998 9999999
Q ss_pred CCHHHHHHH---------------HhhcCCCeeEEEEEcc--ccccCCceeecCCCCCCceeecCCcchhhhhhhhcCCC
Q 005993 153 SSEADLLHQ---------------FNLMKDHGTRIIIYNL--WEDDQGLLELDFDSDKHDIQLRGVNRDEQNIKMAQHYP 215 (666)
Q Consensus 153 ~sE~eLl~Q---------------fd~Ig~~GT~III~NL--~r~~~G~~ELDFdtD~~DI~I~g~~~d~k~~q~a~~~P 215 (666)
.++.+++.| |+.+..+||.||+||+ |+.+.|.+|+||+.++++|.
T Consensus 322 ~~~~~~l~q~~v~~~~~~~ef~~~~~~~~~~g~~~I~Y~~~~~~~~~g~~e~df~l~~~~i~------------------ 383 (775)
T KOG1845|consen 322 SHLLDLLGQNSVQYSKDFPEFGHQFNIMNKPGTDVIIYNLRRWKGDEGILELDFDLDPHVIP------------------ 383 (775)
T ss_pred ccHHHHhhhhhhhhccccchhcchhhhccCCCceeeeechhhhcccccceeeccccCccccc------------------
Confidence 999999999 8888999999999999 99899999999999999985
Q ss_pred CccchhhhHhhHHHHHHHhhccCCCCeEEEEcCeeeccccccccccccceEEeecCCCCCCCCccccceeeEEEeeecCc
Q 005993 216 NSRHFLTYRHSLRSYASILYLRLPPGFRIIIRGKDVEHHNIVNDMMLSKKVTYRPQPGASGIPTDLHMAVDVTIGFVKDA 295 (666)
Q Consensus 216 ~~~h~~~~~ySLRaYLSILYLr~pprmrIiLrGkkVe~~~~~~dL~~~e~i~YkPq~~~~~lp~~l~~~v~vtiGflk~a 295 (666)
..+.++++.|.+|||+..+++++++++|.++.|+.+..+++..+.++|+|+....+.+ .-.+.+....||.+.+
T Consensus 384 -----~~~~~~~~s~~sil~~~~~~~~~~v~~~~~~~h~sv~~~q~~~~~~~~~p~r~~~~~~-~~~~~~~~~~~~~~~~ 457 (775)
T KOG1845|consen 384 -----WTYCHSHLSEASILLLTRRLRFKSVLRGKDVEHHSVINYQVQTEEILYQPQRAPADGK-QRLIKLSPKPGFVKDA 457 (775)
T ss_pred -----ccchhhhhhcccccchhccccchhccccccchhhhHHHHHHHHHHHhcccccccCCcc-chhhcccCCCCccccc
Confidence 1356889999999999999999999999999999999999999999999995432211 1134445689999999
Q ss_pred cccccccceeEEecCcccc----chhhcccCCCCCCcceeEEEecccccccccccccchhHHHHHHHHHHHHHHHHHhhh
Q 005993 296 KHHIDVQGFNVYHKNRLIK----PFWRLWNASGSDGRGVIGVLEANFVEPAHDKQGFERTTVLARLEARLIQMQKDYWNN 371 (666)
Q Consensus 296 ~~~~~~qGf~VYhkNRLIk----~y~rVg~~~~s~GrGVIGVvEanflePtHNKQdFe~t~ly~rLe~rL~q~~~eYW~~ 371 (666)
+++++++|++|||++|||+ |+||.++..++.+++|++++.+||++|+|++|+|+++...++.+.++.++++.||..
T Consensus 458 ~~~~~~~~~nV~~~~~lie~~~~~~~k~~n~~~s~~~~~~~il~~n~~~~a~~~~~v~~~~v~a~~es~~~~~~~~~~~~ 537 (775)
T KOG1845|consen 458 PRPIDVQQFNVSHGPRLIEHGCRPFVKIDNATGSLGQAVIPILVGNFVETAPDSQGVEKTIVLASSESRDKQSLNTYEEK 537 (775)
T ss_pred CCCCCccCCccccCCcchhhcccceeeecCCCccccccccceecccccccCCCccccccccccccchhhhhhcccccccc
Confidence 9999999999999999999 999999999999999999999999999999999999999999999999999999999
Q ss_pred cccccccccccccccccc--ccccccCCCCCCCCCcccCCCCCCCcccccccccccccCCCCCCcccCCCCCCCCCCCcc
Q 005993 372 NCHEIGYAPRRYKKYIKD--SYDREISSKKSYPSRHKITDSSHSDKHQLHSNQRWEGKDSKRLPEASNYGDRKGHESSKG 449 (666)
Q Consensus 372 ~c~~iGy~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 449 (666)
.|++++|.+....+..+. ++.++..| +.. |. + .++.-++ -. +.+.-.
T Consensus 538 ~~~~i~~~~~q~~~~~~~~~~~~Ke~~~--~~~--~~---~-~~~~~~~------~~------~~~~~~----------- 586 (775)
T KOG1845|consen 538 KCLRIDEAGRQLQKERESTTTVVKEEKP--ENN--HL---S-SSKRTQR------RK------STGRAI----------- 586 (775)
T ss_pred cccccCccchhhhhhhcccceeeccccc--ccc--hh---c-chhcccc------cc------cccccc-----------
Confidence 999999999776666543 23333333 211 10 0 1111000 00 000000
Q ss_pred cccccCCccccCCCcccCCCCCCCCCCCcccchhhhccccCCCCcccccccccccCCCCCCcCCCCccccccccccCCCC
Q 005993 450 KYKMKTPVKYREGASVSEPLSPSAEDASDDDMHVMVTARGANGSSQKILAAEKSFGKDGLHRTHPSACLVDSESQQDGAS 529 (666)
Q Consensus 450 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 529 (666)
..++-....++...|.+. ..+|+.-. .+....+..-.+.+.. ..++.-..+..-+ ..|-||+.
T Consensus 587 ----~~~~~~~~~~~~~~~~~~--------~~~v~sq~---~~~~~e~e~~k~~~~~-~~~a~~~~~~~~~-~~~~~~~~ 649 (775)
T KOG1845|consen 587 ----SVAVEKFNLRSGPNGRGQ--------IDMVESQE---TPLLKEVERLKKKRRR-AALALEVQSSKNE-EEQSDDDE 649 (775)
T ss_pred ----ccchhhhccccccCCcCC--------cccccccc---chhhhHHHHhhhhhhh-hhhhhhhccccch-hhhhccch
Confidence 000000011111111110 00000000 0000000000001110 0000000000001 11333333
Q ss_pred CCCCCCCCCCCCCCCcccCCCCCccCccccchhhhhhhhhhhHHHHHHHHhHH-------hHHHHHHhhhcHHHHHHHHH
Q 005993 530 GGSSVRPFMPSQSKGSEVNYPEHFLSDCSLGANLGQLKQENHELKKRLEKKEG-------ELQEERERCRSLEAQLKVMQ 602 (666)
Q Consensus 530 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~~-------~~~~e~~~~~~l~~~~~~~~ 602 (666)
---++...-... .- .....+ . .+-+|++.+.+.-+++..... ++.++.+..+.|+.++++..
T Consensus 650 ~~~~e~~~~~~~-~~-------~~~~~~--~-~~~~l~~~~~~~l~~~~~~~~t~~~q~~~~n~~~~~~~~~~~~~k~~~ 718 (775)
T KOG1845|consen 650 DSLNEVRRKSAK-LK-------SEQKQK--K-TLVELEETRKKWLRSMLNQSLTAGEQLKSLNQQEDFDKTLEVELKESR 718 (775)
T ss_pred hhhhHHhhhccc-cc-------hhhccc--H-HHHHHHHHHHHHHHHhhhhhhhhhhhhcccccccccccchHHHHHHHH
Confidence 211111100000 00 001112 2 377777777777666654333 24555588999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHh
Q 005993 603 QTIEELNKEQESLIDIFAEERDRREREEENLRKKIKDASDTIQDLLDKIK 652 (666)
Q Consensus 603 ~~~~~~~keq~~li~~f~eer~~~~~e~~~lr~kl~~~~~~i~~~~~~~~ 652 (666)
.+|..+.+.|+++.+.|..||.+|+.||..+|.||..+ .+.++++..+.
T Consensus 719 n~l~~~~~~~~s~~~~~~~~~~~~~~e~~l~~~k~~~~-~~~~~~~~~~~ 767 (775)
T KOG1845|consen 719 NKLQNLRNKLQSLADMFIQERADRDKEEDLQRFKLPVS-GTLEKVLKDIE 767 (775)
T ss_pred HHHHHHHHHHHhcchhhhhHHHhhhhhhhhhhhcccch-hhHHHHhhhhH
Confidence 99999999999999999999999999999999999754 45556655544
|
|
| >KOG1845 consensus MORC family ATPases [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF13589 HATPase_c_3: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; PDB: 3IED_A 2XCM_B 2JKI_B 3OPD_A 2O1V_B 2GQP_A 2O1W_C 1YT2_A 1TC6_A 2H8M_B | Back alignment and domain information |
|---|
| >PRK05218 heat shock protein 90; Provisional | Back alignment and domain information |
|---|
| >PRK14083 HSP90 family protein; Provisional | Back alignment and domain information |
|---|
| >COG0326 HtpG Molecular chaperone, HSP90 family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00130 heat shock protein 90; Provisional | Back alignment and domain information |
|---|
| >PRK00095 mutL DNA mismatch repair protein; Reviewed | Back alignment and domain information |
|---|
| >PTZ00272 heat shock protein 83 kDa (Hsp83); Provisional | Back alignment and domain information |
|---|
| >TIGR00585 mutl DNA mismatch repair protein MutL | Back alignment and domain information |
|---|
| >KOG0019 consensus Molecular chaperone (HSP90 family) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1389 DNA topoisomerase VI, subunit B [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >PF10267 Tmemb_cc2: Predicted transmembrane and coiled-coil 2 protein; InterPro: IPR019394 This family of transmembrane coiled-coil containing proteins is conserved from worms to humans | Back alignment and domain information |
|---|
| >PRK14868 DNA topoisomerase VI subunit B; Provisional | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >KOG0020 consensus Endoplasmic reticulum glucose-regulated protein (GRP94/endoplasmin), HSP90 family [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3850 consensus Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK04184 DNA topoisomerase VI subunit B; Validated | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF02518 HATPase_c: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; InterPro: IPR003594 This domain is found in several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases [], heat shock protein HSP90 [, , ], phytochrome-like ATPases and DNA mismatch repair proteins | Back alignment and domain information |
|---|
| >PF06705 SF-assemblin: SF-assemblin/beta giardin | Back alignment and domain information |
|---|
| >TIGR01052 top6b DNA topoisomerase VI, B subunit | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF14362 DUF4407: Domain of unknown function (DUF4407) | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >PF15254 CCDC14: Coiled-coil domain-containing protein 14 | Back alignment and domain information |
|---|
| >KOG0243 consensus Kinesin-like protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG0323 MutL DNA mismatch repair enzyme (predicted ATPase) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF07200 Mod_r: Modifier of rudimentary (Mod(r)) protein; InterPro: IPR009851 This entry represents a conserved region approximately 150 residues long within a number of eukaryotic proteins that show homology with Drosophila melanogaster Modifier of rudimentary (Mod(r)) proteins | Back alignment and domain information |
|---|
| >smart00387 HATPase_c Histidine kinase-like ATPases | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >COG3290 CitA Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >PRK10604 sensor protein RstB; Provisional | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PF15294 Leu_zip: Leucine zipper | Back alignment and domain information |
|---|
| >TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family | Back alignment and domain information |
|---|
| >PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) | Back alignment and domain information |
|---|
| >PRK11100 sensory histidine kinase CreC; Provisional | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >PRK14867 DNA topoisomerase VI subunit B; Provisional | Back alignment and domain information |
|---|
| >cd00075 HATPase_c Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown] | Back alignment and domain information |
|---|
| >TIGR02449 conserved hypothetical protein TIGR02449 | Back alignment and domain information |
|---|
| >PF15236 CCDC66: Coiled-coil domain-containing protein 66 | Back alignment and domain information |
|---|
| >KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK05431 seryl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function | Back alignment and domain information |
|---|
| >PLN02320 seryl-tRNA synthetase | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR01069 mutS2 MutS2 family protein | Back alignment and domain information |
|---|
| >PRK09470 cpxA two-component sensor protein; Provisional | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >smart00502 BBC B-Box C-terminal domain | Back alignment and domain information |
|---|
| >KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR01386 cztS_silS_copS heavy metal sensor kinase | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >PRK10780 periplasmic chaperone; Provisional | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PF04949 Transcrip_act: Transcriptional activator; InterPro: IPR007033 Golgins are a family of coiled-coil proteins associated with the Golgi apparatus necessary for tethering events in membrane fusion and as structural supports for Golgi cisternae [] | Back alignment and domain information |
|---|
| >PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >PRK09303 adaptive-response sensory kinase; Validated | Back alignment and domain information |
|---|
| >KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF07334 IFP_35_N: Interferon-induced 35 kDa protein (IFP 35) N-terminus; InterPro: IPR009938 This entry represents the N terminus of interferon-induced 35 kDa protein (IFP 35) (approximately 80 residues long), which contains a leucine zipper motif in an alpha helical configuration [] | Back alignment and domain information |
|---|
| >PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK10549 signal transduction histidine-protein kinase BaeS; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 666 | |||
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 4e-09 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-08 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 8e-08 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-07 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 5e-07 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 7e-07 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 9e-07 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 9e-07 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 7e-06 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 9e-06 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 3e-05 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 5e-08 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 3e-06 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 4e-06 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 2e-04 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 2e-04 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 1e-07 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 1e-04 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 2e-04 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 9e-07 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 4e-06 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 1e-06 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 2e-05 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 3e-05 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 9e-05 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 2e-06 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 3e-06 | |
| 2e7s_A | 135 | RAB guanine nucleotide exchange factor SEC2; coile | 5e-06 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 1e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-05 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 6e-05 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 2e-04 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 8e-04 | |
| 2b9c_A | 147 | Striated-muscle alpha tropomyosin; alpha-helix, co | 2e-04 | |
| 2oto_A | 155 | M protein; helical coiled coil, fibrinogen-binding | 3e-04 | |
| 1u2m_A | 143 | Histone-like protein HLP-1; coiled coil, chaperone | 3e-04 | |
| 2eqb_B | 97 | RAB guanine nucleotide exchange factor SEC2; coile | 4e-04 | |
| 3ghg_C | 411 | Fibrinogen gamma chain; triple-stranded coiled coi | 4e-04 | |
| 2xs1_A | 704 | Programmed cell death 6-interacting protein; prote | 4e-04 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 6e-04 |
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
Score = 59.1 bits (143), Expect = 4e-09
Identities = 25/105 (23%), Positives = 48/105 (45%), Gaps = 3/105 (2%)
Query: 558 SLGANLGQLKQENHELKKRLEKKEGELQEERERCRSLEAQLKVMQQTIEELNKEQESLID 617
L + +L+ + ELK +L KKE ELQ R +Q + I EL L +
Sbjct: 1071 DLHEQIAELQAQIAELKAQLAKKEEELQAALARLEDETSQKNNALKKIRELESHISDLQE 1130
Query: 618 IFAEERDRR---EREEENLRKKIKDASDTIQDLLDKIKLLEKMKT 659
E+ R E+++ +L ++++ ++D LD ++++
Sbjct: 1131 DLESEKAARNKAEKQKRDLSEELEALKTELEDTLDTTATQQELRG 1175
|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Length = 155 | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Length = 155 | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Length = 155 | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Length = 129 | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Length = 129 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Length = 189 | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Length = 154 | Back alignment and structure |
|---|
| >2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Length = 135 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Length = 168 | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Length = 168 | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Length = 168 | Back alignment and structure |
|---|
| >2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 Length = 147 | Back alignment and structure |
|---|
| >2oto_A M protein; helical coiled coil, fibrinogen-binding, virulence factor, S active protein, toxin; 3.04A {Streptococcus pyogenes serotype M1} PDB: 2xny_M Length = 155 | Back alignment and structure |
|---|
| >1u2m_A Histone-like protein HLP-1; coiled coil, chaperone; 2.30A {Escherichia coli} SCOP: f.48.1.1 PDB: 1sg2_A Length = 143 | Back alignment and structure |
|---|
| >2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Length = 97 | Back alignment and structure |
|---|
| >3ghg_C Fibrinogen gamma chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 1deq_C Length = 411 | Back alignment and structure |
|---|
| >2xs1_A Programmed cell death 6-interacting protein; protein transport-viral protein complex, cell cycle; 2.30A {Homo sapiens} PDB: 2xs8_A 2oev_A 2r05_A 2r02_A 2r03_A 2oex_A 2ojq_A Length = 704 | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Length = 256 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 666 | |||
| 1y4s_A | 559 | Chaperone protein HTPG; HSP90, molecular chaperone | 98.88 | |
| 2o1u_A | 666 | Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, | 98.8 | |
| 2ioq_A | 624 | Chaperone protein HTPG; heat shock protein, HSP90; | 98.71 | |
| 2ior_A | 235 | Chaperone protein HTPG; heat shock protein, HSP90; | 98.52 | |
| 1yc1_A | 264 | HSP 86, heat shock protein HSP 90-alpha; cell-cycl | 98.48 | |
| 3peh_A | 281 | Endoplasmin homolog; structural genomics, structur | 98.45 | |
| 2wer_A | 220 | ATP-dependent molecular chaperone HSP82; ATPase, A | 98.44 | |
| 3nmq_A | 239 | Heat shock protein HSP 90-beta; ATPase, chaperone- | 98.4 | |
| 3ied_A | 272 | Heat shock protein; HSP90, chaperone, structural g | 98.37 | |
| 3o0i_A | 256 | HSP90AA1 protein; HSP90 heat-shock proteins, chape | 98.36 | |
| 3t0h_A | 228 | Heat shock protein HSP 90-alpha; chaperone, ATPase | 98.35 | |
| 2gqp_A | 236 | Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, | 98.35 | |
| 1qy5_A | 269 | Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N | 98.34 | |
| 2cg9_A | 677 | ATP-dependent molecular chaperone HSP82; chaperone | 98.25 | |
| 1b63_A | 333 | MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A | 97.26 | |
| 3na3_A | 348 | DNA mismatch repair protein MLH1; MUTL protein hom | 96.57 | |
| 1h7s_A | 365 | PMS1 protein homolog 2; DNA repair, GHL ATPase, mi | 96.14 | |
| 3h4l_A | 367 | DNA mismatch repair protein PMS1; ATP binding, DNA | 96.11 | |
| 1kij_A | 390 | DNA gyrase subunit B; topoisomerase, gyrase B-coum | 95.89 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 93.96 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 92.52 | |
| 3fv5_A | 201 | DNA topoisomerase 4 subunit B; topoisomerase IV B | 91.65 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 90.16 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 90.16 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 89.69 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 89.45 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 89.1 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 88.83 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 88.13 | |
| 1ei1_A | 391 | DNA gyrase B, GYRB; ATPase domain, dimer, isomeras | 88.11 | |
| 1l8d_A | 112 | DNA double-strand break repair RAD50 ATPase; zinc | 87.88 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 87.33 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 87.23 | |
| 1mu5_A | 471 | Type II DNA topoisomerase VI subunit B; GHKL ATPas | 87.19 | |
| 2btz_A | 394 | Pyruvate dehydrogenase kinase isoenzyme 2; GHKL mo | 87.06 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 86.71 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 86.61 | |
| 2e0a_A | 394 | Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP | 86.27 | |
| 1ses_A | 421 | Seryl-tRNA synthetase; ligase; HET: AHX AMP; 2.50A | 86.16 | |
| 2q8g_A | 407 | [pyruvate dehydrogenase [lipoamide]] kinase isozy; | 86.03 | |
| 3d36_A | 244 | Sporulation kinase B; GHKL ATPase, four helix bund | 85.9 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 85.83 | |
| 2c2a_A | 258 | Sensor histidine kinase; phosphotransfer, PHOQ, se | 85.68 | |
| 1s16_A | 390 | Topoisomerase IV subunit B; two-domain protein com | 85.64 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 85.42 | |
| 3sl2_A | 177 | Sensor histidine kinase YYCG; ATP binding, intact | 85.12 | |
| 2eqb_B | 97 | RAB guanine nucleotide exchange factor SEC2; coile | 84.96 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 84.75 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 84.67 | |
| 2zbk_B | 530 | Type 2 DNA topoisomerase 6 subunit B; DNA binding | 84.51 | |
| 2v4h_A | 110 | NF-kappa-B essential modulator; transcription, met | 84.31 | |
| 3a7p_A | 152 | Autophagy protein 16; coiled-coil, coiled coil, cy | 83.59 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 83.56 | |
| 1y8o_A | 419 | [pyruvate dehydrogenase [lipoamide]] kinase isozy; | 83.36 | |
| 3a0y_A | 152 | Sensor protein; ATP-LID, kinase, phosphoprotein, t | 83.11 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 82.74 | |
| 1id0_A | 152 | PHOQ histidine kinase; PHOQ/PHOP, signal transduct | 82.73 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 82.22 | |
| 2oto_A | 155 | M protein; helical coiled coil, fibrinogen-binding | 81.64 | |
| 1i58_A | 189 | Chemotaxis protein CHEA; beta-alpha sandwich, sign | 80.87 | |
| 2dq0_A | 455 | Seryl-tRNA synthetase; coiled-coil, homodimer, str | 80.08 |
| >1y4s_A Chaperone protein HTPG; HSP90, molecular chaperone, ATPase; HET: ADP; 2.90A {Escherichia coli} PDB: 1y4u_A | Back alignment and structure |
|---|
Probab=98.88 E-value=1.5e-08 Score=113.13 Aligned_cols=62 Identities=27% Similarity=0.474 Sum_probs=50.4
Q ss_pred CcceEEEEECCCCCCHHHHHHHH-hcCCCCCC-----------CccccccccCCcccccccccCCeEEEEeeecC
Q 005993 26 SFHCICFADNGGGMNPDKMRHCM-SLGYSAKS-----------KAANTIGQYGNGFKTSTMRLGADVIVFSCCCG 88 (666)
Q Consensus 26 G~~~L~I~DDG~GMd~~el~~~m-sfG~s~k~-----------~~~~~IGrYGnGfKTgSMRLGkdviVfSK~~g 88 (666)
+...|.|.|||.||+.+++..++ ++|.|.+. .....||+||.||.| ++.+|..|.|.||+.+
T Consensus 72 ~~~~I~I~DnGiGMt~edl~~~l~tiA~Sg~~~f~e~l~~~~~~~~~~iG~fGvGfyS-~f~VadkV~V~Sr~~~ 145 (559)
T 1y4s_A 72 DKRTLTISDNGVGMTRDEVIDHLGTIAKSGTKSFLESLGSDQAKDSQLIGQFGVGFYS-AFIVADKVTVRTRAAG 145 (559)
T ss_dssp TTTEEEEEECSSCCCHHHHHHHHSCCSCCCCCCTTCC--------CCCCSSCCCSGGG-HHHHEEEEEEEEECSS
T ss_pred CCcEEEEEECCCCCCHHHHHHHHhhhcccccHHHHHHhhccccccccccCCCCcchhh-hhhccCeEEEEEcCCC
Confidence 34699999999999999998887 67777532 123579999999997 5668999999999864
|
| >2o1u_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, AMP-PNP, GP96; HET: ANP; 2.40A {Canis lupus familiaris} PDB: 2o1v_A* 2o1w_A 2o1t_A | Back alignment and structure |
|---|
| >2ioq_A Chaperone protein HTPG; heat shock protein, HSP90; 3.50A {Escherichia coli} PDB: 2iop_A | Back alignment and structure |
|---|
| >2ior_A Chaperone protein HTPG; heat shock protein, HSP90; HET: ADP; 1.65A {Escherichia coli} | Back alignment and structure |
|---|
| >1yc1_A HSP 86, heat shock protein HSP 90-alpha; cell-cycle, cancer, drug design, cell cycle; HET: 4BC; 1.70A {Homo sapiens} SCOP: d.122.1.1 PDB: 1yc3_A* 1yc4_A* | Back alignment and structure |
|---|
| >3peh_A Endoplasmin homolog; structural genomics, structural genomics consortium, SGC, HE protein, chaperone, ATP binding; HET: IBD; 2.75A {Plasmodium falciparum 3D7} PDB: 3pej_A* | Back alignment and structure |
|---|
| >2wer_A ATP-dependent molecular chaperone HSP82; ATPase, ATP-binding, phosphoprotein, stress respo nucleotide-binding; HET: RDC; 1.60A {Saccharomyces cerevisiae} PDB: 2weq_A* 2wep_A* 1zwh_A* 1zw9_A* 2fxs_A* 3c11_A* 3c0e_A* 2yge_A* 2ygf_A* 2akp_A | Back alignment and structure |
|---|
| >3nmq_A Heat shock protein HSP 90-beta; ATPase, chaperone-chaperone inhibitor complex; HET: 7PP; 2.20A {Homo sapiens} SCOP: d.122.1.1 | Back alignment and structure |
|---|
| >3ied_A Heat shock protein; HSP90, chaperone, structural genomics, structura genomics consortium, SGC, stress response; HET: AN2; 2.01A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3o0i_A HSP90AA1 protein; HSP90 heat-shock proteins, chaperone-inhibitor complex; HET: P54; 1.47A {Homo sapiens} PDB: 2fwz_A* 2fwy_A* 2h55_A* | Back alignment and structure |
|---|
| >3t0h_A Heat shock protein HSP 90-alpha; chaperone, ATPase; 1.20A {Homo sapiens} SCOP: d.122.1.1 PDB: 3r4m_A 3t0z_A* 3t10_A* 3t1k_A* 3t2s_A* 1uyl_A 1uy7_A* 1uy8_A* 1uy9_A* 1uyc_A* 1uyd_A* 1uye_A* 1uyf_A* 1uyg_A* 1uyh_A* 1uyk_A* 1uy6_A 2cdd_A* 2uwd_A* 2vci_A* ... | Back alignment and structure |
|---|
| >2gqp_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, ligand, NECA, NPCA, adenosine; HET: PA7 PG4 1PE; 1.50A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1tc0_A* 1tbw_A* 1u0z_A* 1u2o_A* 1ysz_A* 1yt0_A* 1yt1_A* 2exl_A* 2fyp_A* 2gfd_A* 1tc6_A* 2h8m_A* 2hch_A* 2hg1_A* 3o2f_A* 2esa_A* | Back alignment and structure |
|---|
| >1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* | Back alignment and structure |
|---|
| >2cg9_A ATP-dependent molecular chaperone HSP82; chaperone complex, HSP90, heat shock protein, ATP-binding, heat shock, nucleotide-binding, acetylation; HET: ATP; 3.1A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1b63_A MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A {Escherichia coli K12} SCOP: d.14.1.3 d.122.1.2 PDB: 1nhh_A* 1nhi_A* 1bkn_A 1nhj_A* 1b62_A* | Back alignment and structure |
|---|
| >3na3_A DNA mismatch repair protein MLH1; MUTL protein homolog 1, DNA damag repair, structural genomics consortium, SGC, protein bindin; HET: DNA ATP; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1h7s_A PMS1 protein homolog 2; DNA repair, GHL ATPase, mismatch repair, HNPCC; 1.95A {Homo sapiens} SCOP: d.14.1.3 d.122.1.2 PDB: 1h7u_A* 1ea6_A* | Back alignment and structure |
|---|
| >3h4l_A DNA mismatch repair protein PMS1; ATP binding, DNA repair, DNA damage, nucleus, phosphop DNA binding protein, protein binding; HET: DNA ANP; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1kij_A DNA gyrase subunit B; topoisomerase, gyrase B-coumarin complex, isomerase; HET: DNA NOV; 2.30A {Thermus thermophilus} SCOP: d.14.1.3 d.122.1.2 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3fv5_A DNA topoisomerase 4 subunit B; topoisomerase IV B subunit complex, antibiotic resistance, ATP-binding, nucleotide-binding; HET: DNA 1EU; 1.80A {Escherichia coli} PDB: 1s14_A* | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >1ei1_A DNA gyrase B, GYRB; ATPase domain, dimer, isomerase; HET: DNA ANP; 2.30A {Escherichia coli} SCOP: d.14.1.3 d.122.1.2 | Back alignment and structure |
|---|
| >1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >1mu5_A Type II DNA topoisomerase VI subunit B; GHKL ATPase, helix two-turns helix; 2.00A {Sulfolobus shibatae} SCOP: a.156.1.3 d.14.1.3 d.122.1.2 PDB: 1mx0_A* 1z5b_A* 1z5a_A* 1z59_A* 1z5c_A* 2hkj_A* | Back alignment and structure |
|---|
| >2btz_A Pyruvate dehydrogenase kinase isoenzyme 2; GHKL motif regulation, transferase; 2.2A {Homo sapiens} PDB: 2bu2_A* 2bu5_A* 2bu6_A* 2bu7_A* 2bu8_A* 3crk_A* 1jm6_A* 3crl_A* | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >2e0a_A Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP-binding, structural genomics, NPPSFA, NATI project on protein structural and functional analyses; HET: ANP; 1.86A {Homo sapiens} PDB: 2zdx_A* 2zdy_A* 2zkj_A* 3d2r_A* | Back alignment and structure |
|---|
| >1ses_A Seryl-tRNA synthetase; ligase; HET: AHX AMP; 2.50A {Thermus thermophilus} SCOP: a.2.7.1 d.104.1.1 PDB: 1ser_A* 1set_A* 1sry_A | Back alignment and structure |
|---|
| >2q8g_A [pyruvate dehydrogenase [lipoamide]] kinase isozy; GHKL ATPase/kinase family, pyruvate dehydrogenase complex, mitochondrial kinase; HET: AZX; 1.90A {Homo sapiens} PDB: 2q8f_A* 2q8h_A | Back alignment and structure |
|---|
| >3d36_A Sporulation kinase B; GHKL ATPase, four helix bundle, class I two-component histidine kinase, phosphoprotein; HET: ADP; 2.03A {Geobacillus stearothermophilus} | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >2c2a_A Sensor histidine kinase; phosphotransfer, PHOQ, selenomethionyl MAD, two-component systems, transferase; HET: ADP; 1.9A {Thermotoga maritima} SCOP: a.30.2.1 d.122.1.3 PDB: 3dge_A* | Back alignment and structure |
|---|
| >1s16_A Topoisomerase IV subunit B; two-domain protein complexed with ADPNP; HET: ANP; 2.10A {Escherichia coli} SCOP: d.14.1.3 d.122.1.2 | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
| >3sl2_A Sensor histidine kinase YYCG; ATP binding, intact ATP, bergerat fold, TR; HET: ATP; 1.61A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2zbk_B Type 2 DNA topoisomerase 6 subunit B; DNA binding protein, decatenation, ATPase, drug design, DNA-binding, magnesium, metal-binding; HET: RDC; 3.56A {Sulfolobus shibatae} | Back alignment and structure |
|---|
| >2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} | Back alignment and structure |
|---|
| >3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1y8o_A [pyruvate dehydrogenase [lipoamide]] kinase isozy; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: a.29.5.1 d.122.1.4 PDB: 1y8n_A* 1y8p_A* 2pnr_A* 2q8i_A* | Back alignment and structure |
|---|
| >3a0y_A Sensor protein; ATP-LID, kinase, phosphoprotein, transferase, two-component regulatory system; 1.57A {Thermotoga maritima} PDB: 3a0t_A* 3a0x_A 3a0w_A 3a0z_A | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1id0_A PHOQ histidine kinase; PHOQ/PHOP, signal transduction, transferase; HET: ANP; 1.60A {Escherichia coli} SCOP: d.122.1.3 PDB: 3cgz_A 3cgy_A | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2oto_A M protein; helical coiled coil, fibrinogen-binding, virulence factor, S active protein, toxin; 3.04A {Streptococcus pyogenes serotype M1} PDB: 2xny_M | Back alignment and structure |
|---|
| >1i58_A Chemotaxis protein CHEA; beta-alpha sandwich, signaling protein, transferase; HET: ACP ADP; 1.60A {Thermotoga maritima} SCOP: d.122.1.3 PDB: 1i59_A* 1i5a_A* 1i5b_A* 1i5c_A* 1i5d_A* | Back alignment and structure |
|---|
| >2dq0_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: SSA; 2.60A {Pyrococcus horikoshii} PDB: 2dq1_A* 2dq2_A 2zr2_A* 2zr3_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 666 | ||||
| d1f5na1 | 300 | a.114.1.1 (A:284-583) Interferon-induced guanylate | 3e-04 | |
| d1t7sa_ | 129 | a.7.7.1 (A:) BAG-family molecular chaperon regulat | 0.002 |
| >d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain superfamily: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain family: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain domain: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain species: Human (Homo sapiens) [TaxId: 9606]
Score = 41.3 bits (96), Expect = 3e-04
Identities = 14/75 (18%), Positives = 39/75 (52%), Gaps = 5/75 (6%)
Query: 565 QLKQENHELKKRLEKKEGELQE--ERERCRSLEAQLKVMQQTIEELNKEQESLIDIFAEE 622
+ +Q + ++ ++ +L E E +R + L+ Q + + ++E +++ L + F +E
Sbjct: 229 KNEQMMEQKERSYQEHLKQLTEKMENDRVQLLKEQERTLALKLQE---QEQLLKEGFQKE 285
Query: 623 RDRREREEENLRKKI 637
+ E ++L+ K+
Sbjct: 286 SRIMKNEIQDLQTKM 300
|
| >d1t7sa_ a.7.7.1 (A:) BAG-family molecular chaperon regulator-1, BAG1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 129 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 666 | |||
| d2iwxa1 | 213 | HSP90 {Baker's yeast (Saccharomyces cerevisiae) [T | 98.21 | |
| d1uyla_ | 208 | HSP90 {Human (Homo sapiens) [TaxId: 9606]} | 98.2 | |
| d2gqpa1 | 227 | HSP90 {Dog (Canis familiaris) [TaxId: 9615]} | 98.15 | |
| d2hkja3 | 219 | Topoisomerase VI-B subunit {Archaeon Sulfolobus sh | 97.12 | |
| d1h7sa2 | 203 | DNA mismatch repair protein PMS2 {Human (Homo sapi | 97.11 | |
| d1b63a2 | 218 | DNA mismatch repair protein MutL {Escherichia coli | 96.16 | |
| d1ixma_ | 179 | Sporulation response regulatory protein Spo0B {Bac | 90.9 | |
| d2c2aa2 | 161 | Sensor histidine kinase TM0853 {Thermotoga maritim | 88.85 | |
| d1gkza2 | 193 | Branched-chain alpha-ketoacid dehydrogenase kinase | 87.08 | |
| d1seta1 | 110 | Seryl-tRNA synthetase (SerRS) {Thermus thermophilu | 86.39 | |
| d1jm6a2 | 190 | Pyruvate dehydrogenase kinase {Rat (Rattus norvegi | 86.32 | |
| d1bxda_ | 161 | Histidine kinase domain of the osmosensor EnvZ {Es | 84.11 | |
| d1ysra1 | 148 | Sensor-type histidine kinase PrrB {Mycobacterium t | 83.62 | |
| d1id0a_ | 146 | Histidine kinase PhoQ domain {Escherichia coli [Ta | 82.96 |
| >d2iwxa1 d.122.1.1 (A:2-214) HSP90 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase superfamily: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase family: Heat shock protein 90, HSP90, N-terminal domain domain: HSP90 species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=98.21 E-value=3.4e-07 Score=88.76 Aligned_cols=62 Identities=23% Similarity=0.347 Sum_probs=52.0
Q ss_pred CcceEEEEECCCCCCHHHHHHHH-hcCCCCCCC---------ccccccccCCcccccccccCCeEEEEeeecC
Q 005993 26 SFHCICFADNGGGMNPDKMRHCM-SLGYSAKSK---------AANTIGQYGNGFKTSTMRLGADVIVFSCCCG 88 (666)
Q Consensus 26 G~~~L~I~DDG~GMd~~el~~~m-sfG~s~k~~---------~~~~IGrYGnGfKTgSMRLGkdviVfSK~~g 88 (666)
+...|.|.|||.||+.+++.+-| .+|.|.+.. ..+.|||||.||=|+ |-+|..|.|.||+.+
T Consensus 70 ~~~~l~i~DnGiGMt~~~~~~~l~~ia~S~~~~~~~~~~~~~~~~~IGqFGIGfyS~-Fmvad~v~V~trs~~ 141 (213)
T d2iwxa1 70 EQKVLEIRDSGIGMTKAELINNLGTIAKSGTKAFMEALSAGADVSMIGQFGVGFYSL-FLVADRVQVISKSND 141 (213)
T ss_dssp GGTEEEEEECSSCCCHHHHHHHHTTCCCSTHHHHHHHHHHTCCGGGGGGGTCGGGGG-GGTEEEEEEEEECTT
T ss_pred ccceeEEecCCccccHHHHHHHHhhhhcccchHHHhhhhhhhhhhhhcccccchhhh-hhhccceeEEeecCC
Confidence 56789999999999999999888 788876531 235799999999766 569999999999764
|
| >d1uyla_ d.122.1.1 (A:) HSP90 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gqpa1 d.122.1.1 (A:74-337) HSP90 {Dog (Canis familiaris) [TaxId: 9615]} | Back information, alignment and structure |
|---|
| >d2hkja3 d.122.1.2 (A:10-228) Topoisomerase VI-B subunit {Archaeon Sulfolobus shibatae [TaxId: 2286]} | Back information, alignment and structure |
|---|
| >d1h7sa2 d.122.1.2 (A:29-231) DNA mismatch repair protein PMS2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ixma_ d.123.1.1 (A:) Sporulation response regulatory protein Spo0B {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2c2aa2 d.122.1.3 (A:321-481) Sensor histidine kinase TM0853 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1gkza2 d.122.1.4 (A:186-378) Branched-chain alpha-ketoacid dehydrogenase kinase (BCK) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1seta1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1jm6a2 d.122.1.4 (A:1177-1366) Pyruvate dehydrogenase kinase {Rat (Rattus norvegicus), isozyme 2 [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1bxda_ d.122.1.3 (A:) Histidine kinase domain of the osmosensor EnvZ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ysra1 d.122.1.3 (A:299-446) Sensor-type histidine kinase PrrB {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1id0a_ d.122.1.3 (A:) Histidine kinase PhoQ domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|