Citrus Sinensis ID: 005993


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660------
MFLFVDGLFSNSKMLQLCSNLPSLWSFHCICFADNGGGMNPDKMRHCMSLGYSAKSKAANTIGQYGNGFKTSTMRLGADVIVFSCCCGKDGKSPTRSIGLLSYTFLRSTGKEDIVVPMLDYEGSQQEWKKIIRSSLDDWNRNVETIVQWSPFSSEADLLHQFNLMKDHGTRIIIYNLWEDDQGLLELDFDSDKHDIQLRGVNRDEQNIKMAQHYPNSRHFLTYRHSLRSYASILYLRLPPGFRIIIRGKDVEHHNIVNDMMLSKKVTYRPQPGASGIPTDLHMAVDVTIGFVKDAKHHIDVQGFNVYHKNRLIKPFWRLWNASGSDGRGVIGVLEANFVEPAHDKQGFERTTVLARLEARLIQMQKDYWNNNCHEIGYAPRRYKKYIKDSYDREISSKKSYPSRHKITDSSHSDKHQLHSNQRWEGKDSKRLPEASNYGDRKGHESSKGKYKMKTPVKYREGASVSEPLSPSAEDASDDDMHVMVTARGANGSSQKILAAEKSFGKDGLHRTHPSACLVDSESQQDGASGGSSVRPFMPSQSKGSEVNYPEHFLSDCSLGANLGQLKQENHELKKRLEKKEGELQEERERCRSLEAQLKVMQQTIEELNKEQESLIDIFAEERDRREREEENLRKKIKDASDTIQDLLDKIKLLEKMKTPSIRAGR
cEEEEEccccccccccEEccccccccEEEEEEEEccccccHHHHHHcHHccccccccccccccccccccccccccccccEEEEccccccccccccEEEEEEcHHHHHHcccccEEEEEEEEcccccccHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHccccccccEEEEEcccccccccEEEccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccEEEEccEEEccccHHHHHHHHHHHHccccccccccccccccEEEEEEEEcccccccccccEEEEEEcccccHHHHHHcccccccccEEEEEEEccEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHccc
cEEEEcccccccHEEEEccccHHHcccEEEEEEEccccccHHHHHHHHHccccccccccccEEEcccccccccccccccEEEEEEccccccccccEEEEEHHHHHHHHcccccEEEEcccccccccccEEEEcccHHHHHHHHHHHHHccccccHHHHHHHHHHccccccEEEEEEEcccccccEEEcccccccHEEEccccccccccccccccccccccccHHHHHHHHHHHHHHccccccEEEEEccEEccHHHHHHcccccEEEEcccccccccccHccEEEEEEEEEcccccccEEEEEEEEEEcccEEEEEEEEcccccccccEEEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHccccccccccEEccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc
mflfvdglfsnskmlqlcsnlpslwsfhcicfadngggmnpdkmrhcmslgysakskaantigqygngfktstmrLGADVIVFScccgkdgksptrsiglLSYTFLrstgkedivvpmldyegsQQEWKKIIRSSLDDWNRNVETIvqwspfsseadLLHQFNLMKDHGTRIIIYNLweddqglleldfdsdkhdiqlrgvnrdeQNIKMaqhypnsrhflTYRHSLRSYASILYLrlppgfriiirgkdvehhnivndmmlskkvtyrpqpgasgiptdlhMAVDVTIGFVkdakhhidvqgfnvyhknrlikpfwrlwnasgsdgrgvIGVLEanfvepahdkqgfeRTTVLARLEARLIQMQKDYwnnncheigyaprrykkYIKDSYdreisskksypsrhkitdsshsdkhqlhsnqrwegkdskrlpeasnygdrkghesskgkykmktpvkyregasvseplspsaedasdddMHVMVTARGANGSSQKILAAEKsfgkdglhrthpsaclvdsesqqdgasggssvrpfmpsqskgsevnypehflsdcslganlgQLKQENHELKKRLEKKEGELQEERERCRSLEAQLKVMQQTIEELNKEQESLIDIFAEERDRREREEENLRKKIKDASDTIQDLLDKIKLLEkmktpsiragr
MFLFVDGLFSNSKMLQLCSNLPSLWSFHCICFADNGGGMNPDKMRHCMSLGYSAKSKAANTIGQYGNGFKTSTMRLGADVIVFSCCCGkdgksptrsigLLSYTFLRSTGKEDIVVPMLDYEGSQQEWKKIIRSSLDDWNRNVETIVQWSPFSSEADLLHQFNLMKDHGTRIIIYNLWEDDQGLLELDFDSDKHDIQLRGVNRDEQNIKMAQHYPNSRHFLTYRHSLRSYASILYLRLPPGFRIIIRGKDVEHHNIVNDMMLSKKVTYRPQPGASGIPTDLHMAVDVTIGFVKDAKHHIDVQGFNVYHKNRLIKPFWRLWNASGSDGRGVIGVLEANFvepahdkqgferTTVLARLEARLIQMQkdywnnncheigyaprrykKYIKDSYDReisskksypsrhkitdsshsdkhqlhsnqrwegkdskrlpeasnygdrkghesskgkykmktpvkyregasvseplspsaedasddDMHVMVTArgangssqkILAAEKSFGKDGLHRTHPSACLVDSESQQDGASGGSSVRPFMPSQSKGSEVNYPEHFLSDCSLGANLGQLKQENHELKKRlekkegelqeereRCRSLEAQLKVMQQTIEELNKEQESLidifaeerdrrereeenlrkkikdasdtiQDLLDKikllekmktpsiragr
MFLFVDGLFSNSKMLQLCSNLPSLWSFHCICFADNGGGMNPDKMRHCMSLGYSAKSKAANTIGQYGNGFKTSTMRLGADVIVFSCCCGKDGKSPTRSIGLLSYTFLRSTGKEDIVVPMLDYEGSQQEWKKIIRSSLDDWNRNVETIVQWSPFSSEADLLHQFNLMKDHGTRIIIYNLWEDDQGLLELDFDSDKHDIQLRGVNRDEQNIKMAQHYPNSRHFLTYRHSLRSYASILYLRLPPGFRIIIRGKDVEHHNIVNDMMLSKKVTYRPQPGASGIPTDLHMAVDVTIGFVKDAKHHIDVQGFNVYHKNRLIKPFWRLWNASGSDGRGVIGVLEANFVEPAHDKQGFERTTVLARLEARLIQMQKDYWNNNCHEIGYAPRRYKKYIKDSYDREISSKKSYPSRHKITDSSHSDKHQLHSNQRWEGKDSKRLPEASNYGDRKGHESSKGKYKMKTPVKYREGASVSEPLSPSAEDASDDDMHVMVTARGANGSSQKILAAEKSFGKDGLHRTHPSACLVDSESQQDGASGGSSVRPFMPSQSKGSEVNYPEHFLSDCSLGANLGQLKQENHelkkrlekkegelqeererCRSLEAQLKVMQQTIEELNKEQESLIDIFAeerdrrereeeNLRKKIKDASDTIQDLLDKIKLLEKMKTPSIRAGR
*FLFVDGLFSNSKMLQLCSNLPSLWSFHCICFADNGGGMNPDKMRHCMSLGYSAKSKAANTIGQYGNGFKTSTMRLGADVIVFSCCCGKDGKSPTRSIGLLSYTFLRSTGKEDIVVPMLDYEGSQQEWKKIIRSSLDDWNRNVETIVQWSPFSSEADLLHQFNLMKDHGTRIIIYNLWEDDQGLLELDFDSDKHDIQLRGVNR**QNIKMAQHYPNSRHFLTYRHSLRSYASILYLRLPPGFRIIIRGKDVEHHNIVNDMMLSKKVTYRPQPGASGIPTDLHMAVDVTIGFVKDAKHHIDVQGFNVYHKNRLIKPFWRLWNASGSDGRGVIGVLEANFVEPAHDKQGFERTTVLARLEARLIQMQKDYWNNNCHEIGYAPRRYKKYIKD*************************************************************************************************************************************************************************************************************************************************************************************
MFLFVD*LFSNSKMLQLCSNLPSLWSFHCICFADNGGGMNPDKMRHCMSLGY*********IGQYGNGFKTSTMRLGADVIVFSCCCGKDGKSPTRSIGLLSYTFLRSTGKEDIVVPMLDYEGSQQEWKKIIRSSLDDWNRNVETIVQWSPFSSEADLLHQFNLMKDHGTRIIIYNLWEDDQGLLELDFDSDKHDIQL**********************LTYRHSLRSYASILYLRLPPGFRIIIRGKDVEHHNIVNDMMLSKKVTYRPQPGAS***TDLHMAVDVTIGFVKDAKHHIDVQGFNVYHKNRLIKPFWRLWNASGSDGRGVIGVLEANFVEPAHDKQGFERTTVLARLEARLIQMQKDYWNNNCHEIGYAPRRYKKYIK**************************************************************************************************************************************************************************************************************************************************************************************
MFLFVDGLFSNSKMLQLCSNLPSLWSFHCICFADNGGGMNPDKMRHCMSLGYSAKSKAANTIGQYGNGFKTSTMRLGADVIVFSCCCGKDGKSPTRSIGLLSYTFLRSTGKEDIVVPMLDYEGSQQEWKKIIRSSLDDWNRNVETIVQWSPFSSEADLLHQFNLMKDHGTRIIIYNLWEDDQGLLELDFDSDKHDIQLRGVNRDEQNIKMAQHYPNSRHFLTYRHSLRSYASILYLRLPPGFRIIIRGKDVEHHNIVNDMMLSKKVTYRPQPGASGIPTDLHMAVDVTIGFVKDAKHHIDVQGFNVYHKNRLIKPFWRLWNASGSDGRGVIGVLEANFVEPAHDKQGFERTTVLARLEARLIQMQKDYWNNNCHEIGYAPRRYKKYIKDSY************************************************************KMKTPVK******************SDDDMHVMVTARGANGSSQKILAAEKSFGKDGLHRTHPSACLV*****************FMPSQSKGSEVNYPEHFLSDCSLGANLGQLKQENHELKKRLEKK**********CRSLEAQLKVMQQTIEELNKEQESLIDIFAEER***********KKIKDASDTIQDLLDKIKLLEKMK********
MFLFVDGLFSNSKMLQLCSNLPSLWSFHCICFADNGGGMNPDKMRHCMSLGYSAKSKAANTIGQYGNGFKTSTMRLGADVIVFSCCCGKDGKSPTRSIGLLSYTFLRSTGKEDIVVPMLDYEGSQQEWKKIIRSSLDDWNRNVETIVQWSPFSSEADLLHQFNLMKDHGTRIIIYNLWEDDQGLLELDFDSDKHDIQLRGV***********HY*NSRHFLTYRHSLRSYASILYLRLPPGFRIIIRGKDVEHHNIVNDMMLSKKVTYRPQPGASGIPTDLHMAVDVTIGFVKDAKHHIDVQGFNVYHKNRLIKPFWRLWNASGSDGRGVIGVLEANFVEPAHDKQGFERTTVLARLEARLIQMQKDYWNNNCHEIGYAP**************************ITDSSHSDKHQLHSNQRWEGKDSKRLPE***********************************************************************************************************************LSDCSLGANLGQLKQENHELKKRLEKKEGELQEERERCRSLEAQLKVMQQTIEELNKEQESLIDIFAEERDRREREEENLRKKIKDASDTIQDLLDKIKLLEK**********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFLFVDGLFSNSKMLQLCSNLPSLWSFHCICFADNGGGMNPDKMRHCMSLGYSAKSKAANTIGQYGNGFKTSTMRLGADVIVFSCCCGKDGKSPTRSIGLLSYTFLRSTGKEDIVVPMLDYEGSQQEWKKIIRSSLDDWNRNVETIVQWSPFSSEADLLHQFNLMKDHGTRIIIYNLWEDDQGLLELDFDSDKHDIQLRGVNRDEQNIKMAQHYPNSRHFLTYRHSLRSYASILYLRLPPGFRIIIRGKDVEHHNIVNDMMLSKKVTYRPQPGASGIPTDLHMAVDVTIGFVKDAKHHIDVQGFNVYHKNRLIKPFWRLWNASGSDGRGVIGVLEANFVEPAHDKQGFERTTVLARLEARLIQMQKDYWNNNCHEIGYAPRRYKKYIKDSYDREISSKKSYPSRHKITDSSHSDKHQLHSNQRWEGKDSKRLPEASNYGDRKGHESSKGKYKMKTPVKYREGASVSEPLSPSAEDASDDDMHVMVTARGANGSSQKILAAEKSFGKDGLHRTHPSACLVDSESQQDGASGGSSVRPFMPSQSKGSEVNYPEHFLSDCSLGANxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKTPSIRAGR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query666 2.2.26 [Sep-21-2011]
Q8BMD7 928 MORC family CW-type zinc yes no 0.496 0.356 0.334 3e-47
Q8TE76 937 MORC family CW-type zinc yes no 0.466 0.331 0.339 2e-44
Q14149 939 MORC family CW-type zinc no no 0.460 0.326 0.344 5e-44
Q9Y6X9 1032 MORC family CW-type zinc no no 0.303 0.195 0.331 3e-26
Q86VD1 984 MORC family CW-type zinc no no 0.477 0.323 0.269 5e-26
Q9WVL5 950 MORC family CW-type zinc no no 0.475 0.333 0.248 1e-25
Q8C5W4 1022 MORC family CW-type zinc no no 0.321 0.209 0.307 1e-25
Q69ZX6 1030 MORC family CW-type zinc no no 0.303 0.196 0.327 2e-25
>sp|Q8BMD7|MORC4_MOUSE MORC family CW-type zinc finger protein 4 OS=Mus musculus GN=Morc4 PE=2 SV=2 Back     alignment and function desciption
 Score =  190 bits (482), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 123/368 (33%), Positives = 194/368 (52%), Gaps = 37/368 (10%)

Query: 29  CICFADNGGGMNPDKMRHCMSLGYSAK--SKAANTIGQYGNGFKTSTMRLGADVIVFSCC 86
           C+ F D+G GM P K+   +S G++ K   K+   IG +GNGFK+ +MRLG D +VF+  
Sbjct: 83  CLTFTDDGCGMTPHKLHRMLSFGFTDKVIKKSQRPIGVFGNGFKSGSMRLGKDALVFT-- 140

Query: 87  CGKDGKSPTRSIGLLSYTFLRSTGKEDIVVPMLDYEGSQQEWKKIIRSSLDDWNRNVETI 146
             K+G   T ++GLLS T+L     + ++VP++ +  SQQ  K I+    +D   ++E I
Sbjct: 141 --KNGN--TLAVGLLSQTYLECIQAQAVIVPIVPF--SQQNKKMIV---TEDSLPSLEAI 191

Query: 147 VQWSPFSSEADLLHQFNLMK-DHGTRIIIYNLWEDDQGLLELDFDSDKHDIQLRGVNRDE 205
           + +S F+ E DLL QF+ +    GTR++I+N+  +  G  ELDFD+D++DI +   + +E
Sbjct: 192 LNYSIFNCEKDLLSQFDAIPGKKGTRVLIWNIRRNKDGKSELDFDTDQYDILVSDFDAEE 251

Query: 206 QNIK-MAQHYPNSRHFLTYRHSLRSYASILYLRLPPGFRIIIRGKDVEHHNIVNDMMLSK 264
           + I  +    P + +      SLR++ SILY++  P  +I +R K V    I   +   +
Sbjct: 252 KEIGGVTSELPETEY------SLRAFCSILYMK--PRMKIFLRQKKVTTQMIAKSLANVE 303

Query: 265 KVTYRPQPGASGIPTDLHMAVDVTIGFVKDAKHHIDVQGFNVYHKNRLIKPFWRL---WN 321
              Y+P        T  +  V +T GF    K+H    G  +YH NRLIK F +      
Sbjct: 304 YDIYKP--------TSTNKQVRITFGF--SCKYHNQF-GVMMYHNNRLIKAFEKAGCQLK 352

Query: 322 ASGSDGRGVIGVLEANFVEPAHDKQGFERTTVLARLEARLIQMQKDYWNNNCHEIGYAPR 381
            +  +G GVIGV+E NF++PA++KQ FE T         L +    YW     +  + P 
Sbjct: 353 PTCGEGVGVIGVIECNFLKPAYNKQDFEYTKEYRLTINALARKLNAYWKEKISQENFEPL 412

Query: 382 RYKKYIKD 389
              + I D
Sbjct: 413 PTSRRIPD 420





Mus musculus (taxid: 10090)
>sp|Q8TE76|MORC4_HUMAN MORC family CW-type zinc finger protein 4 OS=Homo sapiens GN=MORC4 PE=1 SV=2 Back     alignment and function description
>sp|Q14149|MORC3_HUMAN MORC family CW-type zinc finger protein 3 OS=Homo sapiens GN=MORC3 PE=1 SV=3 Back     alignment and function description
>sp|Q9Y6X9|MORC2_HUMAN MORC family CW-type zinc finger protein 2 OS=Homo sapiens GN=MORC2 PE=1 SV=2 Back     alignment and function description
>sp|Q86VD1|MORC1_HUMAN MORC family CW-type zinc finger protein 1 OS=Homo sapiens GN=MORC1 PE=2 SV=2 Back     alignment and function description
>sp|Q9WVL5|MORC1_MOUSE MORC family CW-type zinc finger protein 1 OS=Mus musculus GN=Morc1 PE=2 SV=1 Back     alignment and function description
>sp|Q8C5W4|MOR2B_MOUSE MORC family CW-type zinc finger protein 2B OS=Mus musculus GN=Morc2b PE=2 SV=2 Back     alignment and function description
>sp|Q69ZX6|MOR2A_MOUSE MORC family CW-type zinc finger protein 2A OS=Mus musculus GN=Morc2a PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query666
255540135 816 zinc finger protein, putative [Ricinus c 0.909 0.742 0.655 0.0
297734460 830 unnamed protein product [Vitis vinifera] 0.906 0.727 0.635 0.0
359491569 2234 PREDICTED: uncharacterized protein LOC10 0.906 0.270 0.635 0.0
224119746 862 predicted protein [Populus trichocarpa] 0.900 0.696 0.647 0.0
356527801 820 PREDICTED: uncharacterized protein LOC10 0.885 0.719 0.605 0.0
449440961 824 PREDICTED: uncharacterized protein LOC10 0.900 0.728 0.635 0.0
449501464 794 PREDICTED: uncharacterized LOC101222073 0.866 0.726 0.609 0.0
297792383 804 hypothetical protein ARALYDRAFT_495140 [ 0.840 0.696 0.576 0.0
240256429 819 Histidine kinase-, DNA gyrase B-, and HS 0.867 0.705 0.557 0.0
9757986 823 unnamed protein product [Arabidopsis tha 0.851 0.688 0.556 0.0
>gi|255540135|ref|XP_002511132.1| zinc finger protein, putative [Ricinus communis] gi|223550247|gb|EEF51734.1| zinc finger protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  826 bits (2134), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/654 (65%), Positives = 485/654 (74%), Gaps = 48/654 (7%)

Query: 30  ICFADNGGGMNPDKMRHCMSLGYSAKSKAANTIGQYGNGFKTSTMRLGADVIVFSCCCGK 89
           +   DNGGGM+PDKMR CMSLGYSAKSK ANTIGQYGNGFKTSTMRLGADVIVFS C GK
Sbjct: 194 LLIEDNGGGMDPDKMRQCMSLGYSAKSKVANTIGQYGNGFKTSTMRLGADVIVFSRCPGK 253

Query: 90  DGKSPTRSIGLLSYTFLRSTGKEDIVVPMLDYEGSQQEWKKIIRSSLDDWNRNVETIVQW 149
           DGKSPT+SIGLLSYTFLRSTGKEDIVVPMLDYE   QEW K+IRSS  DWNRNVETIVQW
Sbjct: 254 DGKSPTQSIGLLSYTFLRSTGKEDIVVPMLDYERKGQEWNKMIRSSSGDWNRNVETIVQW 313

Query: 150 SPFSSEADLLHQFNLMKDHGTRIIIYNLWEDDQGLLELDFDSDKHDIQLRGVNRDEQNIK 209
           SPFSSEADLL QFNLM DHGTRI+IYNLWEDD+G LELDFD+D HDIQLRGVNRDE+NI+
Sbjct: 314 SPFSSEADLLRQFNLMSDHGTRIVIYNLWEDDEGSLELDFDTDPHDIQLRGVNRDEKNIQ 373

Query: 210 MAQHYPNSRHFLTYRHSLRSYASILYLRLPPGFRIIIRGKDVEHHNIVNDMMLSKKVTYR 269
           MA+ +PNSRHFLTYRHSLRSYASILYLRLPP FRII+RGKDVEHHNIVNDMMLS+++TYR
Sbjct: 374 MAKEFPNSRHFLTYRHSLRSYASILYLRLPPCFRIILRGKDVEHHNIVNDMMLSQEITYR 433

Query: 270 PQPGASGIPTDL---HMAVDVTIGFVKDAKHHIDVQGFNVYHKNRLIKPFWRLWNASGSD 326
           PQ  A G+  D    HMA  VTIGFVKDAKHHIDVQGFNVYHKNRLIKPFWRLWNA+GSD
Sbjct: 434 PQ-SADGVAKDFNLNHMAAIVTIGFVKDAKHHIDVQGFNVYHKNRLIKPFWRLWNAAGSD 492

Query: 327 GRGVIGVLEANFVEPAHDKQGFERTTVLARLEARLIQMQKDYWNNNCHEIGYAPRRYKKY 386
           GRGVIGVLEANFVEPAHDKQGFERTTVLARLEARL+QMQK YW+ NCH+IGYAPRR K++
Sbjct: 493 GRGVIGVLEANFVEPAHDKQGFERTTVLARLEARLVQMQKTYWSTNCHKIGYAPRRNKRF 552

Query: 387 IKDSYD-------REISSK-KSYPSRHKITDSSHSDKHQLHSNQRWEGKDSKRLPEASNY 438
           I +S D        ++SS+ K Y +      SS SDK   H+NQ   GK S    +  N 
Sbjct: 553 INESTDGGSSPDYSQVSSQSKKYSALRGKGLSSLSDKFYSHANQN-GGKRSDTFAKNGNP 611

Query: 439 GDRKGHESSKGKYKMKTPVKYREGASVSEPLSPSAEDASDDDMHVMVTARGANGSSQKIL 498
               GH SS G    KT            P SPS  D  D+D H+ +  R          
Sbjct: 612 AYANGHVSSNGSDGTKTSTGSGRKTHSKAPSSPSLHDVDDNDAHIALPTR---------- 661

Query: 499 AAEKSFGKDGLHRTHPSACLVDSESQQDGASGGSSVRPFMPSQSKGSEVNYPEHFLSDCS 558
                  +DGLH    S+ L D+  Q               SQSK  +V+  +H L +  
Sbjct: 662 -------QDGLHMVRLSSPLEDTTQQ-----------AVTRSQSKAGKVDNSQHVLPESD 703

Query: 559 LGANLGQLKQENHELKKRLEKKEGELQEER------ERCRSLEAQLKVMQQTIEELNKEQ 612
           L  N+ +LKQEN EL++RL+K+E E Q E        +C+SLE QL+  QQ IEELNKEQ
Sbjct: 704 L-CNINELKQENQELRERLKKREAEFQGEMMHGSMCNKCKSLEIQLQEAQQKIEELNKEQ 762

Query: 613 ESLIDIFAEERDRREREEENLRKKIKDASDTIQDLLDKIKLLEKMKTPSIRAGR 666
           ESLIDIF+EERDRR++EEENLRKK KDAS+TIQ LLDK++LLEKMK+P+ RA R
Sbjct: 763 ESLIDIFSEERDRRDKEEENLRKKYKDASNTIQQLLDKVRLLEKMKSPNYRAER 816




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|297734460|emb|CBI15707.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359491569|ref|XP_002280533.2| PREDICTED: uncharacterized protein LOC100266246 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224119746|ref|XP_002318152.1| predicted protein [Populus trichocarpa] gi|222858825|gb|EEE96372.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356527801|ref|XP_003532495.1| PREDICTED: uncharacterized protein LOC100816702 [Glycine max] Back     alignment and taxonomy information
>gi|449440961|ref|XP_004138252.1| PREDICTED: uncharacterized protein LOC101222073 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449501464|ref|XP_004161374.1| PREDICTED: uncharacterized LOC101222073 [Cucumis sativus] Back     alignment and taxonomy information
>gi|297792383|ref|XP_002864076.1| hypothetical protein ARALYDRAFT_495140 [Arabidopsis lyrata subsp. lyrata] gi|297309911|gb|EFH40335.1| hypothetical protein ARALYDRAFT_495140 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|240256429|ref|NP_199891.4| Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase family protein [Arabidopsis thaliana] gi|332008608|gb|AED95991.1| Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase family protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|9757986|dbj|BAA96991.2| unnamed protein product [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query666
TAIR|locus:2117358707 AT4G24970 [Arabidopsis thalian 0.599 0.564 0.737 8.3e-177
TAIR|locus:2163320819 AT5G50780 [Arabidopsis thalian 0.558 0.454 0.726 1.5e-166
TAIR|locus:2179837708 AT5G13130 [Arabidopsis thalian 0.534 0.502 0.652 1.5e-138
TAIR|locus:2122264635 CRT1 "compromised recognition 0.510 0.535 0.508 1.1e-91
TAIR|locus:2122254626 CRH1 "CRT1 Homologue 1" [Arabi 0.509 0.541 0.498 2.9e-87
TAIR|locus:2011226663 DMS11 "DEFECTIVE IN MERISTEM S 0.493 0.496 0.510 3.9e-83
TAIR|locus:2122244486 AT4G36270 "AT4G36270" [Arabido 0.483 0.662 0.446 7.2e-68
ZFIN|ZDB-GENE-060929-544422 zgc:152774 "zgc:152774" [Danio 0.519 0.819 0.328 1.9e-44
ZFIN|ZDB-GENE-030131-1502 1079 morc3a "MORC family CW-type zi 0.486 0.300 0.348 7.1e-44
ZFIN|ZDB-GENE-040801-98763 morc3b "MORC family CW-type zi 0.267 0.233 0.343 7.4e-35
TAIR|locus:2117358 AT4G24970 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1583 (562.3 bits), Expect = 8.3e-177, Sum P(2) = 8.3e-177
 Identities = 301/408 (73%), Positives = 342/408 (83%)

Query:    34 DNGGGMNPDKMRHCMSLGYSAKSKAANTIGQYGNGFKTSTMRLGADVIVFSCCCGKDGKS 93
             DNGGGM+P+KMR CMSLGYSAKSK ANTIGQYGNGFKTSTMRLGADVIVFS C GKDGKS
Sbjct:   220 DNGGGMDPEKMRQCMSLGYSAKSKLANTIGQYGNGFKTSTMRLGADVIVFSRCPGKDGKS 279

Query:    94 PTRSIGLLSYTFLRSTGKEDIVVPMLDYEGSQQEWKKIIRSSLDDWNRNVETIVQWSPFS 153
              T+SIGLLSYTFLRSTGKEDIVVPMLDYE    EW KIIRSS  DW++NVETI+QWSPFS
Sbjct:   280 STQSIGLLSYTFLRSTGKEDIVVPMLDYERRDPEWSKIIRSSTRDWDKNVETIIQWSPFS 339

Query:   154 SEADLLHQFNLMKDHGTRIIIYNLWEDDQGLLELDFDSDKHDIQLRGVNRDEQNIKMAQH 213
             SE DLLHQF+LMKD GTRIIIYNLWEDDQG+LELDFD+D +DIQLRGVNR+E+NIKMA  
Sbjct:   340 SEEDLLHQFDLMKDRGTRIIIYNLWEDDQGMLELDFDADPYDIQLRGVNREERNIKMASQ 399

Query:   214 YPNSRHFLTYRHSLRSYASILYLRLPPGFRIIIRGKDVEHHNIVNDMMLSKKVTYRPQPG 273
             +PNSRHFLTY+HSLRSY SILYLR+PPGFRII+RG DVEHH++VNDMM ++++TYRPQ  
Sbjct:   400 FPNSRHFLTYKHSLRSYVSILYLRIPPGFRIILRGIDVEHHSVVNDMMQTEQITYRPQSE 459

Query:   274 ASGIPTDLHMAVDVTIGFVKDAKHHIDVQGFNVYHKNRLIKPFWRLWNASGSDGRGVIGV 333
             + G+ T+  M+  V IGFVKDAKHH+DVQGFNVYHKNRLIKPFWR+WNA+GSDGRGVIGV
Sbjct:   460 SYGVVTN--MSAIVIIGFVKDAKHHVDVQGFNVYHKNRLIKPFWRIWNATGSDGRGVIGV 517

Query:   334 LEANFVEPAHDKQGFERTTVLARLEARLIQMQKDYWNNNCHEIGYAPRRYKK--YIKDSY 391
             LEANFVEPAHDKQGFERTTVLARLE+RL+QMQK YW+ NCH+IGYAPRR +K  Y  D+ 
Sbjct:   518 LEANFVEPAHDKQGFERTTVLARLESRLVQMQKTYWSTNCHKIGYAPRRREKSAYGYDNR 577

Query:   392 DREISSKKSYPSRHKI----TDSSHSDKHQLHSNQRW-EGKDSKRLPE 434
             D    + +  PS  K     +D  +S  +  H+      GKD  RL E
Sbjct:   578 DSSPENDREGPSSIKTPTPASDKFYSSSYPNHNGDNGVSGKDGARLQE 625


GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0016020 "membrane" evidence=IDA
TAIR|locus:2163320 AT5G50780 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2179837 AT5G13130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122264 CRT1 "compromised recognition of TCV 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122254 CRH1 "CRT1 Homologue 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011226 DMS11 "DEFECTIVE IN MERISTEM SILENCING 11" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122244 AT4G36270 "AT4G36270" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060929-544 zgc:152774 "zgc:152774" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-1502 morc3a "MORC family CW-type zinc finger 3a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040801-98 morc3b "MORC family CW-type zinc finger 3b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query666
pfam13589134 pfam13589, HATPase_c_3, Histidine kinase-, DNA gyr 1e-09
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 4e-08
pfam05103131 pfam05103, DivIVA, DivIVA protein 4e-07
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 8e-07
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-06
COG2433 652 COG2433, COG2433, Uncharacterized conserved protei 1e-06
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 2e-06
PRK00409 782 PRK00409, PRK00409, recombination and DNA strand e 2e-06
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 5e-06
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 6e-06
pfam07888 546 pfam07888, CALCOCO1, Calcium binding and coiled-co 6e-06
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 1e-05
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-05
PRK12704 520 PRK12704, PRK12704, phosphodiesterase; Provisional 2e-05
smart00935140 smart00935, OmpH, Outer membrane protein (OmpH-lik 3e-05
COG4026290 COG4026, COG4026, Uncharacterized protein containi 4e-05
COG4026290 COG4026, COG4026, Uncharacterized protein containi 5e-05
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 6e-05
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 7e-05
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-04
pfam00769 244 pfam00769, ERM, Ezrin/radixin/moesin family 1e-04
pfam11559149 pfam11559, ADIP, Afadin- and alpha -actinin-Bindin 1e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-04
PRK12704 520 PRK12704, PRK12704, phosphodiesterase; Provisional 2e-04
pfam04156186 pfam04156, IncA, IncA protein 2e-04
TIGR04211198 TIGR04211, SH3_and_anchor, SH3 domain protein 2e-04
pfam13514 1118 pfam13514, AAA_27, AAA domain 2e-04
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 2e-04
pfam13851201 pfam13851, GAS, Growth-arrest specific micro-tubul 2e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 3e-04
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 3e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 3e-04
PRK03918 880 PRK03918, PRK03918, chromosome segregation protein 3e-04
pfam03938157 pfam03938, OmpH, Outer membrane protein (OmpH-like 3e-04
pfam00038312 pfam00038, Filament, Intermediate filament protein 3e-04
pfam09726 680 pfam09726, Macoilin, Transmembrane protein 4e-04
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 5e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 5e-04
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 5e-04
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 5e-04
TIGR00414 418 TIGR00414, serS, seryl-tRNA synthetase 5e-04
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 6e-04
pfam04156186 pfam04156, IncA, IncA protein 6e-04
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 6e-04
PRK03918 880 PRK03918, PRK03918, chromosome segregation protein 9e-04
pfam03962188 pfam03962, Mnd1, Mnd1 family 9e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.001
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.001
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.001
smart00935140 smart00935, OmpH, Outer membrane protein (OmpH-lik 0.001
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.001
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.001
pfam06148133 pfam06148, COG2, COG (conserved oligomeric Golgi) 0.001
TIGR03185 650 TIGR03185, DNA_S_dndD, DNA sulfur modification pro 0.001
PRK02224 880 PRK02224, PRK02224, chromosome segregation protein 0.001
COG1579 239 COG1579, COG1579, Zn-ribbon protein, possibly nucl 0.001
pfam10174 774 pfam10174, Cast, RIM-binding protein of the cytoma 0.001
smart00787312 smart00787, Spc7, Spc7 kinetochore protein 0.001
pfam13868 349 pfam13868, Trichoplein, Tumour suppressor, Mitosta 0.001
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.002
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 0.002
pfam04156186 pfam04156, IncA, IncA protein 0.002
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.002
PRK03918 880 PRK03918, PRK03918, chromosome segregation protein 0.002
PRK03918 880 PRK03918, PRK03918, chromosome segregation protein 0.002
PRK03918 880 PRK03918, PRK03918, chromosome segregation protein 0.002
COG4942 420 COG4942, COG4942, Membrane-bound metallopeptidase 0.002
COG0172 429 COG0172, SerS, Seryl-tRNA synthetase [Translation, 0.002
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.003
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.003
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.003
COG1579239 COG1579, COG1579, Zn-ribbon protein, possibly nucl 0.003
pfam05622 713 pfam05622, HOOK, HOOK protein 0.003
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.004
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.004
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.004
pfam00769 244 pfam00769, ERM, Ezrin/radixin/moesin family 0.004
pfam13514 1118 pfam13514, AAA_27, AAA domain 0.004
pfam13863126 pfam13863, DUF4200, Domain of unknown function (DU 0.004
PRK04863 1486 PRK04863, mukB, cell division protein MukB; Provis 0.004
>gnl|CDD|222246 pfam13589, HATPase_c_3, Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase Back     alignment and domain information
 Score = 56.5 bits (137), Expect = 1e-09
 Identities = 27/93 (29%), Positives = 48/93 (51%), Gaps = 8/93 (8%)

Query: 30  ICFADNGGGMNPDKMRHCMSLGYSAKSKA--ANTIGQYGNGFKTSTMRLGADVIVFSCCC 87
           I   DNGGGM+ +++R+ + LG S+K     + T+G+ G G K +++ LG  + V S   
Sbjct: 35  ISIEDNGGGMSYEELRNALKLGRSSKEGERDSTTLGRKGIGMKLASLSLGRKLTVTS--- 91

Query: 88  GKDGKSPTRSIGLLSYTFLRSTGKEDIVVPMLD 120
            K+G+S T ++       +   G+ D+      
Sbjct: 92  KKEGESSTLTL---DLDDIDKEGEWDLPELTSA 121


This family represents, additionally, the structurally related ATPase domains of histidine kinase, DNA gyrase B and HSP90. Length = 134

>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|218434 pfam05103, DivIVA, DivIVA protein Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|225288 COG2433, COG2433, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|116500 pfam07888, CALCOCO1, Calcium binding and coiled-coil domain (CALCOCO1) like Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional Back     alignment and domain information
>gnl|CDD|214922 smart00935, OmpH, Outer membrane protein (OmpH-like) Back     alignment and domain information
>gnl|CDD|226513 COG4026, COG4026, Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>gnl|CDD|226513 COG4026, COG4026, Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|216108 pfam00769, ERM, Ezrin/radixin/moesin family Back     alignment and domain information
>gnl|CDD|192773 pfam11559, ADIP, Afadin- and alpha -actinin-Binding Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional Back     alignment and domain information
>gnl|CDD|217933 pfam04156, IncA, IncA protein Back     alignment and domain information
>gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein Back     alignment and domain information
>gnl|CDD|205692 pfam13514, AAA_27, AAA domain Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|222417 pfam13851, GAS, Growth-arrest specific micro-tubule binding Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|217803 pfam03938, OmpH, Outer membrane protein (OmpH-like) Back     alignment and domain information
>gnl|CDD|200948 pfam00038, Filament, Intermediate filament protein Back     alignment and domain information
>gnl|CDD|220365 pfam09726, Macoilin, Transmembrane protein Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|232965 TIGR00414, serS, seryl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|217933 pfam04156, IncA, IncA protein Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|202833 pfam03962, Mnd1, Mnd1 family Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|214922 smart00935, OmpH, Outer membrane protein (OmpH-like) Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|218912 pfam06148, COG2, COG (conserved oligomeric Golgi) complex component, COG2 Back     alignment and domain information
>gnl|CDD|234141 TIGR03185, DNA_S_dndD, DNA sulfur modification protein DndD Back     alignment and domain information
>gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>gnl|CDD|220614 pfam10174, Cast, RIM-binding protein of the cytomatrix active zone Back     alignment and domain information
>gnl|CDD|197874 smart00787, Spc7, Spc7 kinetochore protein Back     alignment and domain information
>gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|217933 pfam04156, IncA, IncA protein Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|223250 COG0172, SerS, Seryl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>gnl|CDD|218661 pfam05622, HOOK, HOOK protein Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|216108 pfam00769, ERM, Ezrin/radixin/moesin family Back     alignment and domain information
>gnl|CDD|205692 pfam13514, AAA_27, AAA domain Back     alignment and domain information
>gnl|CDD|206034 pfam13863, DUF4200, Domain of unknown function (DUF4200) Back     alignment and domain information
>gnl|CDD|235316 PRK04863, mukB, cell division protein MukB; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 666
KOG1845775 consensus MORC family ATPases [Cell cycle control, 100.0
KOG1845 775 consensus MORC family ATPases [Cell cycle control, 99.97
PF13589137 HATPase_c_3: Histidine kinase-, DNA gyrase B-, and 99.08
PRK05218613 heat shock protein 90; Provisional 99.02
PRK14083601 HSP90 family protein; Provisional 98.51
COG0326623 HtpG Molecular chaperone, HSP90 family [Posttransl 97.59
PTZ00130814 heat shock protein 90; Provisional 97.57
PRK00095617 mutL DNA mismatch repair protein; Reviewed 97.41
PTZ00272701 heat shock protein 83 kDa (Hsp83); Provisional 97.35
TIGR00585312 mutl DNA mismatch repair protein MutL. All protein 96.75
KOG0019656 consensus Molecular chaperone (HSP90 family) [Post 96.17
COG1389538 DNA topoisomerase VI, subunit B [DNA replication, 96.08
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 95.41
PF10267395 Tmemb_cc2: Predicted transmembrane and coiled-coil 95.4
PRK14868795 DNA topoisomerase VI subunit B; Provisional 95.39
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 95.24
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 95.18
KOG0020785 consensus Endoplasmic reticulum glucose-regulated 95.08
KOG3850455 consensus Predicted membrane protein [Function unk 94.89
PF09726 697 Macoilin: Transmembrane protein; InterPro: IPR0191 94.7
COG2433 652 Uncharacterized conserved protein [Function unknow 94.52
PRK04184535 DNA topoisomerase VI subunit B; Validated 94.11
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 93.72
PF02518111 HATPase_c: Histidine kinase-, DNA gyrase B-, and H 93.42
PF06705247 SF-assemblin: SF-assemblin/beta giardin 92.99
TIGR01052488 top6b DNA topoisomerase VI, B subunit. This model 92.61
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 92.04
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 91.87
PRK10884206 SH3 domain-containing protein; Provisional 91.22
PF14362301 DUF4407: Domain of unknown function (DUF4407) 90.87
PF10186 302 Atg14: UV radiation resistance protein and autopha 90.85
PRK11637 428 AmiB activator; Provisional 90.42
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 90.4
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 89.84
PF15254 861 CCDC14: Coiled-coil domain-containing protein 14 89.44
KOG0243 1041 consensus Kinesin-like protein [Cytoskeleton] 89.42
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 89.25
KOG0977 546 consensus Nuclear envelope protein lamin, intermed 89.03
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 88.87
COG0323638 MutL DNA mismatch repair enzyme (predicted ATPase) 88.45
PF07200150 Mod_r: Modifier of rudimentary (Mod(r)) protein; I 88.35
smart00387111 HATPase_c Histidine kinase-like ATPases. Histidine 88.12
COG4026290 Uncharacterized protein containing TOPRIM domain, 87.98
TIGR03185 650 DNA_S_dndD DNA sulfur modification protein DndD. T 87.85
PRK04778 569 septation ring formation regulator EzrA; Provision 87.78
COG3290537 CitA Signal transduction histidine kinase regulati 87.67
TIGR02169 1164 SMC_prok_A chromosome segregation protein SMC, pri 87.41
PRK10604433 sensor protein RstB; Provisional 87.12
PF00038312 Filament: Intermediate filament protein; InterPro: 87.11
TIGR03185 650 DNA_S_dndD DNA sulfur modification protein DndD. T 87.05
KOG1962216 consensus B-cell receptor-associated protein and r 86.12
PRK11637 428 AmiB activator; Provisional 86.11
PF15294278 Leu_zip: Leucine zipper 85.97
TIGR03752 472 conj_TIGR03752 integrating conjugative element pro 85.6
PF03962188 Mnd1: Mnd1 family; InterPro: IPR005647 This family 85.5
PRK11100475 sensory histidine kinase CreC; Provisional 85.41
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 85.0
PRK14867659 DNA topoisomerase VI subunit B; Provisional 84.98
cd00075103 HATPase_c Histidine kinase-like ATPases; This fami 84.61
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 84.55
KOG2129 552 consensus Uncharacterized conserved protein H4 [Fu 84.47
TIGR0244965 conserved hypothetical protein TIGR02449. Members 84.44
PF15236157 CCDC66: Coiled-coil domain-containing protein 66 84.34
KOG4360 596 consensus Uncharacterized coiled coil protein [Fun 84.34
PRK05431 425 seryl-tRNA synthetase; Provisional 84.22
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 84.21
PRK04863 1486 mukB cell division protein MukB; Provisional 84.15
PF06785 401 UPF0242: Uncharacterised protein family (UPF0242); 84.1
PLN02320 502 seryl-tRNA synthetase 83.95
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 83.55
PF13851201 GAS: Growth-arrest specific micro-tubule binding 83.49
PHA02562562 46 endonuclease subunit; Provisional 83.41
PRK00409 782 recombination and DNA strand exchange inhibitor pr 83.4
TIGR01069 771 mutS2 MutS2 family protein. Function of MutS2 is u 83.32
PRK09470461 cpxA two-component sensor protein; Provisional 83.29
PF09789 319 DUF2353: Uncharacterized coiled-coil protein (DUF2 83.21
PRK10884206 SH3 domain-containing protein; Provisional 83.15
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 82.88
smart00502127 BBC B-Box C-terminal domain. Coiled coil region C- 82.85
KOG1962216 consensus B-cell receptor-associated protein and r 82.84
TIGR01386457 cztS_silS_copS heavy metal sensor kinase. Members 82.84
PRK04778 569 septation ring formation regulator EzrA; Provision 82.8
PRK10780165 periplasmic chaperone; Provisional 82.67
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 82.4
PF04949159 Transcrip_act: Transcriptional activator; InterPro 82.11
PF02403108 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom 82.01
PRK09303380 adaptive-response sensory kinase; Validated 81.81
KOG1853 333 consensus LIS1-interacting protein NUDE [Cytoskele 81.81
PF04111 314 APG6: Autophagy protein Apg6; InterPro: IPR007243 81.8
PF13851201 GAS: Growth-arrest specific micro-tubule binding 81.01
KOG0971 1243 consensus Microtubule-associated protein dynactin 80.86
PRK02224 880 chromosome segregation protein; Provisional 80.84
PF0733476 IFP_35_N: Interferon-induced 35 kDa protein (IFP 3 80.66
PF12777344 MT: Microtubule-binding stalk of dynein motor; Int 80.48
KOG0971 1243 consensus Microtubule-associated protein dynactin 80.35
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 80.2
PRK09039 343 hypothetical protein; Validated 80.02
PRK10549466 signal transduction histidine-protein kinase BaeS; 80.01
>KOG1845 consensus MORC family ATPases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
Probab=100.00  E-value=1.7e-53  Score=481.13  Aligned_cols=558  Identities=37%  Similarity=0.554  Sum_probs=406.3

Q ss_pred             cccccccchhcccCCCCCCCcceEEEE-----ECCCCCCHHHHHHHHhcCCCCCCCccccccccCCcccccccccCCeEE
Q 005993            7 GLFSNSKMLQLCSNLPSLWSFHCICFA-----DNGGGMNPDKMRHCMSLGYSAKSKAANTIGQYGNGFKTSTMRLGADVI   81 (666)
Q Consensus         7 ~~~~~a~a~n~~i~~~~~~G~~~L~I~-----DDG~GMd~~el~~~msfG~s~k~~~~~~IGrYGnGfKTgSMRLGkdvi   81 (666)
                      ++|+..+-+|-+.|.    -.+.++|+     |||+||+++-+..||.+|++++......+|||||||||++||||++++
T Consensus       166 ~tf~~vd~I~p~~d~----~i~a~~v~~~~~s~~gg~~~~~~i~~~m~l~~~~k~e~~~tv~q~~~gfktst~rlGa~~i  241 (775)
T KOG1845|consen  166 ATFVRVDYINPVMDI----FIRALVVQLKRISDDGGGMKPEVIRKCMSLGYSSKKEANSTVGQYGNGFKTSTMRLGADAI  241 (775)
T ss_pred             cceEEeeeecccccc----cceeEEeeccceeccccccCHHHHHHHHHhhhhhhhhhhhhhhhhccccccchhhhcccee
Confidence            577666666666553    26788888     679999999999999999999975578999999999999999999999


Q ss_pred             EEeeecCCCCCCCceeEeehhhhhhhhcCCCceEEee----eeeccCccceeeeeccchhhHHHHHHH-----HhhcCCC
Q 005993           82 VFSCCCGKDGKSPTRSIGLLSYTFLRSTGKEDIVVPM----LDYEGSQQEWKKIIRSSLDDWNRNVET-----IVQWSPF  152 (666)
Q Consensus        82 VfSK~~g~~~~~~t~SigLLS~TFL~~~g~deIvVPm----vswdld~~~~~~ii~~~~~dw~~nL~i-----IlkySPF  152 (666)
                      ||+|..+..|...+++|||||||||+.++.++++|||    ..++...+.|.+|++.+..+|..|+.+     +++|+||
T Consensus       242 ~~~R~~~~~~~kstqsiglls~tfL~~t~~~d~iv~~~~i~~~~e~~~~~~~~i~~~s~~~~~~n~~i~~~~~~L~w~p~  321 (775)
T KOG1845|consen  242 VFSRCESRRGLKSTQSIGLLSYTFLRKTGKRDFIVPMRLIKMDYEKSDQLWQGILYKSGVDWAVNLEIEVTERFLKWSPY  321 (775)
T ss_pred             EeehhhhhccCCcceeEEEEEEeeeccccCCceeEecchhhhhhhcccccccceeeccccccceeeeeHHHHHHhhcCcc
Confidence            9999877789999999999999999999999999999    889988888999998889999999998     9999999


Q ss_pred             CCHHHHHHH---------------HhhcCCCeeEEEEEcc--ccccCCceeecCCCCCCceeecCCcchhhhhhhhcCCC
Q 005993          153 SSEADLLHQ---------------FNLMKDHGTRIIIYNL--WEDDQGLLELDFDSDKHDIQLRGVNRDEQNIKMAQHYP  215 (666)
Q Consensus       153 ~sE~eLl~Q---------------fd~Ig~~GT~III~NL--~r~~~G~~ELDFdtD~~DI~I~g~~~d~k~~q~a~~~P  215 (666)
                      .++.+++.|               |+.+..+||.||+||+  |+.+.|.+|+||+.++++|.                  
T Consensus       322 ~~~~~~l~q~~v~~~~~~~ef~~~~~~~~~~g~~~I~Y~~~~~~~~~g~~e~df~l~~~~i~------------------  383 (775)
T KOG1845|consen  322 SHLLDLLGQNSVQYSKDFPEFGHQFNIMNKPGTDVIIYNLRRWKGDEGILELDFDLDPHVIP------------------  383 (775)
T ss_pred             ccHHHHhhhhhhhhccccchhcchhhhccCCCceeeeechhhhcccccceeeccccCccccc------------------
Confidence            999999999               8888999999999999  99899999999999999985                  


Q ss_pred             CccchhhhHhhHHHHHHHhhccCCCCeEEEEcCeeeccccccccccccceEEeecCCCCCCCCccccceeeEEEeeecCc
Q 005993          216 NSRHFLTYRHSLRSYASILYLRLPPGFRIIIRGKDVEHHNIVNDMMLSKKVTYRPQPGASGIPTDLHMAVDVTIGFVKDA  295 (666)
Q Consensus       216 ~~~h~~~~~ySLRaYLSILYLr~pprmrIiLrGkkVe~~~~~~dL~~~e~i~YkPq~~~~~lp~~l~~~v~vtiGflk~a  295 (666)
                           ..+.++++.|.+|||+..+++++++++|.++.|+.+..+++..+.++|+|+....+.+ .-.+.+....||.+.+
T Consensus       384 -----~~~~~~~~s~~sil~~~~~~~~~~v~~~~~~~h~sv~~~q~~~~~~~~~p~r~~~~~~-~~~~~~~~~~~~~~~~  457 (775)
T KOG1845|consen  384 -----WTYCHSHLSEASILLLTRRLRFKSVLRGKDVEHHSVINYQVQTEEILYQPQRAPADGK-QRLIKLSPKPGFVKDA  457 (775)
T ss_pred             -----ccchhhhhhcccccchhccccchhccccccchhhhHHHHHHHHHHHhcccccccCCcc-chhhcccCCCCccccc
Confidence                 1356889999999999999999999999999999999999999999999995432211 1134445689999999


Q ss_pred             cccccccceeEEecCcccc----chhhcccCCCCCCcceeEEEecccccccccccccchhHHHHHHHHHHHHHHHHHhhh
Q 005993          296 KHHIDVQGFNVYHKNRLIK----PFWRLWNASGSDGRGVIGVLEANFVEPAHDKQGFERTTVLARLEARLIQMQKDYWNN  371 (666)
Q Consensus       296 ~~~~~~qGf~VYhkNRLIk----~y~rVg~~~~s~GrGVIGVvEanflePtHNKQdFe~t~ly~rLe~rL~q~~~eYW~~  371 (666)
                      +++++++|++|||++|||+    |+||.++..++.+++|++++.+||++|+|++|+|+++...++.+.++.++++.||..
T Consensus       458 ~~~~~~~~~nV~~~~~lie~~~~~~~k~~n~~~s~~~~~~~il~~n~~~~a~~~~~v~~~~v~a~~es~~~~~~~~~~~~  537 (775)
T KOG1845|consen  458 PRPIDVQQFNVSHGPRLIEHGCRPFVKIDNATGSLGQAVIPILVGNFVETAPDSQGVEKTIVLASSESRDKQSLNTYEEK  537 (775)
T ss_pred             CCCCCccCCccccCCcchhhcccceeeecCCCccccccccceecccccccCCCccccccccccccchhhhhhcccccccc
Confidence            9999999999999999999    999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccccccccccccccccc--ccccccCCCCCCCCCcccCCCCCCCcccccccccccccCCCCCCcccCCCCCCCCCCCcc
Q 005993          372 NCHEIGYAPRRYKKYIKD--SYDREISSKKSYPSRHKITDSSHSDKHQLHSNQRWEGKDSKRLPEASNYGDRKGHESSKG  449 (666)
Q Consensus       372 ~c~~iGy~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  449 (666)
                      .|++++|.+....+..+.  ++.++..|  +..  |.   + .++.-++      -.      +.+.-.           
T Consensus       538 ~~~~i~~~~~q~~~~~~~~~~~~Ke~~~--~~~--~~---~-~~~~~~~------~~------~~~~~~-----------  586 (775)
T KOG1845|consen  538 KCLRIDEAGRQLQKERESTTTVVKEEKP--ENN--HL---S-SSKRTQR------RK------STGRAI-----------  586 (775)
T ss_pred             cccccCccchhhhhhhcccceeeccccc--ccc--hh---c-chhcccc------cc------cccccc-----------
Confidence            999999999776666543  23333333  211  10   0 1111000      00      000000           


Q ss_pred             cccccCCccccCCCcccCCCCCCCCCCCcccchhhhccccCCCCcccccccccccCCCCCCcCCCCccccccccccCCCC
Q 005993          450 KYKMKTPVKYREGASVSEPLSPSAEDASDDDMHVMVTARGANGSSQKILAAEKSFGKDGLHRTHPSACLVDSESQQDGAS  529 (666)
Q Consensus       450 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  529 (666)
                          ..++-....++...|.+.        ..+|+.-.   .+....+..-.+.+.. ..++.-..+..-+ ..|-||+.
T Consensus       587 ----~~~~~~~~~~~~~~~~~~--------~~~v~sq~---~~~~~e~e~~k~~~~~-~~~a~~~~~~~~~-~~~~~~~~  649 (775)
T KOG1845|consen  587 ----SVAVEKFNLRSGPNGRGQ--------IDMVESQE---TPLLKEVERLKKKRRR-AALALEVQSSKNE-EEQSDDDE  649 (775)
T ss_pred             ----ccchhhhccccccCCcCC--------cccccccc---chhhhHHHHhhhhhhh-hhhhhhhccccch-hhhhccch
Confidence                000000011111111110        00000000   0000000000001110 0000000000001 11333333


Q ss_pred             CCCCCCCCCCCCCCCcccCCCCCccCccccchhhhhhhhhhhHHHHHHHHhHH-------hHHHHHHhhhcHHHHHHHHH
Q 005993          530 GGSSVRPFMPSQSKGSEVNYPEHFLSDCSLGANLGQLKQENHELKKRLEKKEG-------ELQEERERCRSLEAQLKVMQ  602 (666)
Q Consensus       530 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~~-------~~~~e~~~~~~l~~~~~~~~  602 (666)
                      ---++...-... .-       .....+  . .+-+|++.+.+.-+++.....       ++.++.+..+.|+.++++..
T Consensus       650 ~~~~e~~~~~~~-~~-------~~~~~~--~-~~~~l~~~~~~~l~~~~~~~~t~~~q~~~~n~~~~~~~~~~~~~k~~~  718 (775)
T KOG1845|consen  650 DSLNEVRRKSAK-LK-------SEQKQK--K-TLVELEETRKKWLRSMLNQSLTAGEQLKSLNQQEDFDKTLEVELKESR  718 (775)
T ss_pred             hhhhHHhhhccc-cc-------hhhccc--H-HHHHHHHHHHHHHHHhhhhhhhhhhhhcccccccccccchHHHHHHHH
Confidence            211111100000 00       001112  2 377777777777666654333       24555588999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHh
Q 005993          603 QTIEELNKEQESLIDIFAEERDRREREEENLRKKIKDASDTIQDLLDKIK  652 (666)
Q Consensus       603 ~~~~~~~keq~~li~~f~eer~~~~~e~~~lr~kl~~~~~~i~~~~~~~~  652 (666)
                      .+|..+.+.|+++.+.|..||.+|+.||..+|.||..+ .+.++++..+.
T Consensus       719 n~l~~~~~~~~s~~~~~~~~~~~~~~e~~l~~~k~~~~-~~~~~~~~~~~  767 (775)
T KOG1845|consen  719 NKLQNLRNKLQSLADMFIQERADRDKEEDLQRFKLPVS-GTLEKVLKDIE  767 (775)
T ss_pred             HHHHHHHHHHHhcchhhhhHHHhhhhhhhhhhhcccch-hhHHHHhhhhH
Confidence            99999999999999999999999999999999999754 45556655544



>KOG1845 consensus MORC family ATPases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13589 HATPase_c_3: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; PDB: 3IED_A 2XCM_B 2JKI_B 3OPD_A 2O1V_B 2GQP_A 2O1W_C 1YT2_A 1TC6_A 2H8M_B Back     alignment and domain information
>PRK05218 heat shock protein 90; Provisional Back     alignment and domain information
>PRK14083 HSP90 family protein; Provisional Back     alignment and domain information
>COG0326 HtpG Molecular chaperone, HSP90 family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00130 heat shock protein 90; Provisional Back     alignment and domain information
>PRK00095 mutL DNA mismatch repair protein; Reviewed Back     alignment and domain information
>PTZ00272 heat shock protein 83 kDa (Hsp83); Provisional Back     alignment and domain information
>TIGR00585 mutl DNA mismatch repair protein MutL Back     alignment and domain information
>KOG0019 consensus Molecular chaperone (HSP90 family) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1389 DNA topoisomerase VI, subunit B [DNA replication, recombination, and repair] Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>PF10267 Tmemb_cc2: Predicted transmembrane and coiled-coil 2 protein; InterPro: IPR019394 This family of transmembrane coiled-coil containing proteins is conserved from worms to humans Back     alignment and domain information
>PRK14868 DNA topoisomerase VI subunit B; Provisional Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>KOG0020 consensus Endoplasmic reticulum glucose-regulated protein (GRP94/endoplasmin), HSP90 family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3850 consensus Predicted membrane protein [Function unknown] Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK04184 DNA topoisomerase VI subunit B; Validated Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>PF02518 HATPase_c: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; InterPro: IPR003594 This domain is found in several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases [], heat shock protein HSP90 [, , ], phytochrome-like ATPases and DNA mismatch repair proteins Back     alignment and domain information
>PF06705 SF-assemblin: SF-assemblin/beta giardin Back     alignment and domain information
>TIGR01052 top6b DNA topoisomerase VI, B subunit Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PF14362 DUF4407: Domain of unknown function (DUF4407) Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>PF15254 CCDC14: Coiled-coil domain-containing protein 14 Back     alignment and domain information
>KOG0243 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>COG0323 MutL DNA mismatch repair enzyme (predicted ATPase) [DNA replication, recombination, and repair] Back     alignment and domain information
>PF07200 Mod_r: Modifier of rudimentary (Mod(r)) protein; InterPro: IPR009851 This entry represents a conserved region approximately 150 residues long within a number of eukaryotic proteins that show homology with Drosophila melanogaster Modifier of rudimentary (Mod(r)) proteins Back     alignment and domain information
>smart00387 HATPase_c Histidine kinase-like ATPases Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>COG3290 CitA Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>PRK10604 sensor protein RstB; Provisional Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF15294 Leu_zip: Leucine zipper Back     alignment and domain information
>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family Back     alignment and domain information
>PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>PRK11100 sensory histidine kinase CreC; Provisional Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>PRK14867 DNA topoisomerase VI subunit B; Provisional Back     alignment and domain information
>cd00075 HATPase_c Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown] Back     alignment and domain information
>TIGR02449 conserved hypothetical protein TIGR02449 Back     alignment and domain information
>PF15236 CCDC66: Coiled-coil domain-containing protein 66 Back     alignment and domain information
>KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] Back     alignment and domain information
>PRK05431 seryl-tRNA synthetase; Provisional Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function Back     alignment and domain information
>PLN02320 seryl-tRNA synthetase Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>TIGR01069 mutS2 MutS2 family protein Back     alignment and domain information
>PRK09470 cpxA two-component sensor protein; Provisional Back     alignment and domain information
>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>smart00502 BBC B-Box C-terminal domain Back     alignment and domain information
>KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] Back     alignment and domain information
>TIGR01386 cztS_silS_copS heavy metal sensor kinase Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>PRK10780 periplasmic chaperone; Provisional Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PF04949 Transcrip_act: Transcriptional activator; InterPro: IPR007033 Golgins are a family of coiled-coil proteins associated with the Golgi apparatus necessary for tethering events in membrane fusion and as structural supports for Golgi cisternae [] Back     alignment and domain information
>PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK09303 adaptive-response sensory kinase; Validated Back     alignment and domain information
>KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>PF07334 IFP_35_N: Interferon-induced 35 kDa protein (IFP 35) N-terminus; InterPro: IPR009938 This entry represents the N terminus of interferon-induced 35 kDa protein (IFP 35) (approximately 80 residues long), which contains a leucine zipper motif in an alpha helical configuration [] Back     alignment and domain information
>PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PRK10549 signal transduction histidine-protein kinase BaeS; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query666
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 4e-09
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-08
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 8e-08
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 2e-07
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 5e-07
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 7e-07
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 9e-07
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 9e-07
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 7e-06
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 9e-06
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 3e-05
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 5e-08
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-06
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 4e-06
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 2e-04
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 2e-04
2efr_A155 General control protein GCN4 and tropomyosin 1 Al; 1e-07
2efr_A155 General control protein GCN4 and tropomyosin 1 Al; 1e-04
2efr_A155 General control protein GCN4 and tropomyosin 1 Al; 2e-04
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 9e-07
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 4e-06
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 1e-06
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 2e-05
1c1g_A 284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 3e-05
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 9e-05
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 2e-06
2ocy_A154 RAB guanine nucleotide exchange factor SEC2; RAB, 3e-06
2e7s_A135 RAB guanine nucleotide exchange factor SEC2; coile 5e-06
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 6e-05
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 2e-04
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 8e-04
2b9c_A147 Striated-muscle alpha tropomyosin; alpha-helix, co 2e-04
2oto_A155 M protein; helical coiled coil, fibrinogen-binding 3e-04
1u2m_A143 Histone-like protein HLP-1; coiled coil, chaperone 3e-04
2eqb_B97 RAB guanine nucleotide exchange factor SEC2; coile 4e-04
3ghg_C 411 Fibrinogen gamma chain; triple-stranded coiled coi 4e-04
2xs1_A 704 Programmed cell death 6-interacting protein; prote 4e-04
3na7_A 256 HP0958; flagellar biogenesis, flagellum export, C4 6e-04
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
 Score = 59.1 bits (143), Expect = 4e-09
 Identities = 25/105 (23%), Positives = 48/105 (45%), Gaps = 3/105 (2%)

Query: 558  SLGANLGQLKQENHELKKRLEKKEGELQEERERCRSLEAQLKVMQQTIEELNKEQESLID 617
             L   + +L+ +  ELK +L KKE ELQ    R     +Q     + I EL      L +
Sbjct: 1071 DLHEQIAELQAQIAELKAQLAKKEEELQAALARLEDETSQKNNALKKIRELESHISDLQE 1130

Query: 618  IFAEERDRR---EREEENLRKKIKDASDTIQDLLDKIKLLEKMKT 659
                E+  R   E+++ +L ++++     ++D LD     ++++ 
Sbjct: 1131 DLESEKAARNKAEKQKRDLSEELEALKTELEDTLDTTATQQELRG 1175


>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Length = 155 Back     alignment and structure
>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Length = 155 Back     alignment and structure
>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Length = 155 Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Length = 129 Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Length = 129 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Length = 284 Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Length = 189 Back     alignment and structure
>2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Length = 154 Back     alignment and structure
>2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Length = 135 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Length = 168 Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Length = 168 Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Length = 168 Back     alignment and structure
>2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 Length = 147 Back     alignment and structure
>2oto_A M protein; helical coiled coil, fibrinogen-binding, virulence factor, S active protein, toxin; 3.04A {Streptococcus pyogenes serotype M1} PDB: 2xny_M Length = 155 Back     alignment and structure
>1u2m_A Histone-like protein HLP-1; coiled coil, chaperone; 2.30A {Escherichia coli} SCOP: f.48.1.1 PDB: 1sg2_A Length = 143 Back     alignment and structure
>2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Length = 97 Back     alignment and structure
>3ghg_C Fibrinogen gamma chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 1deq_C Length = 411 Back     alignment and structure
>2xs1_A Programmed cell death 6-interacting protein; protein transport-viral protein complex, cell cycle; 2.30A {Homo sapiens} PDB: 2xs8_A 2oev_A 2r05_A 2r02_A 2r03_A 2oex_A 2ojq_A Length = 704 Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Length = 256 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query666
1y4s_A559 Chaperone protein HTPG; HSP90, molecular chaperone 98.88
2o1u_A666 Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, 98.8
2ioq_A624 Chaperone protein HTPG; heat shock protein, HSP90; 98.71
2ior_A235 Chaperone protein HTPG; heat shock protein, HSP90; 98.52
1yc1_A264 HSP 86, heat shock protein HSP 90-alpha; cell-cycl 98.48
3peh_A281 Endoplasmin homolog; structural genomics, structur 98.45
2wer_A220 ATP-dependent molecular chaperone HSP82; ATPase, A 98.44
3nmq_A239 Heat shock protein HSP 90-beta; ATPase, chaperone- 98.4
3ied_A272 Heat shock protein; HSP90, chaperone, structural g 98.37
3o0i_A256 HSP90AA1 protein; HSP90 heat-shock proteins, chape 98.36
3t0h_A228 Heat shock protein HSP 90-alpha; chaperone, ATPase 98.35
2gqp_A236 Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, 98.35
1qy5_A269 Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N 98.34
2cg9_A677 ATP-dependent molecular chaperone HSP82; chaperone 98.25
1b63_A333 MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A 97.26
3na3_A348 DNA mismatch repair protein MLH1; MUTL protein hom 96.57
1h7s_A365 PMS1 protein homolog 2; DNA repair, GHL ATPase, mi 96.14
3h4l_A367 DNA mismatch repair protein PMS1; ATP binding, DNA 96.11
1kij_A390 DNA gyrase subunit B; topoisomerase, gyrase B-coum 95.89
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 93.96
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 92.52
3fv5_A201 DNA topoisomerase 4 subunit B; topoisomerase IV B 91.65
2dfs_A 1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 90.16
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 90.16
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 89.69
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 89.45
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 89.1
2dfs_A 1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 88.83
3u59_A101 Tropomyosin beta chain; muscle contraction, actin, 88.13
1ei1_A391 DNA gyrase B, GYRB; ATPase domain, dimer, isomeras 88.11
1l8d_A112 DNA double-strand break repair RAD50 ATPase; zinc 87.88
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 87.33
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 87.23
1mu5_A471 Type II DNA topoisomerase VI subunit B; GHKL ATPas 87.19
2btz_A394 Pyruvate dehydrogenase kinase isoenzyme 2; GHKL mo 87.06
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 86.71
2ocy_A154 RAB guanine nucleotide exchange factor SEC2; RAB, 86.61
2e0a_A394 Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP 86.27
1ses_A 421 Seryl-tRNA synthetase; ligase; HET: AHX AMP; 2.50A 86.16
2q8g_A407 [pyruvate dehydrogenase [lipoamide]] kinase isozy; 86.03
3d36_A244 Sporulation kinase B; GHKL ATPase, four helix bund 85.9
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 85.83
2c2a_A258 Sensor histidine kinase; phosphotransfer, PHOQ, se 85.68
1s16_A390 Topoisomerase IV subunit B; two-domain protein com 85.64
1c1g_A 284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 85.42
3sl2_A177 Sensor histidine kinase YYCG; ATP binding, intact 85.12
2eqb_B97 RAB guanine nucleotide exchange factor SEC2; coile 84.96
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 84.75
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 84.67
2zbk_B530 Type 2 DNA topoisomerase 6 subunit B; DNA binding 84.51
2v4h_A110 NF-kappa-B essential modulator; transcription, met 84.31
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 83.59
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 83.56
1y8o_A419 [pyruvate dehydrogenase [lipoamide]] kinase isozy; 83.36
3a0y_A152 Sensor protein; ATP-LID, kinase, phosphoprotein, t 83.11
3tnu_A131 Keratin, type I cytoskeletal 14; coiled-coil, stru 82.74
1id0_A152 PHOQ histidine kinase; PHOQ/PHOP, signal transduct 82.73
3tnu_B129 Keratin, type II cytoskeletal 5; coiled-coil, stru 82.22
2oto_A155 M protein; helical coiled coil, fibrinogen-binding 81.64
1i58_A189 Chemotaxis protein CHEA; beta-alpha sandwich, sign 80.87
2dq0_A 455 Seryl-tRNA synthetase; coiled-coil, homodimer, str 80.08
>1y4s_A Chaperone protein HTPG; HSP90, molecular chaperone, ATPase; HET: ADP; 2.90A {Escherichia coli} PDB: 1y4u_A Back     alignment and structure
Probab=98.88  E-value=1.5e-08  Score=113.13  Aligned_cols=62  Identities=27%  Similarity=0.474  Sum_probs=50.4

Q ss_pred             CcceEEEEECCCCCCHHHHHHHH-hcCCCCCC-----------CccccccccCCcccccccccCCeEEEEeeecC
Q 005993           26 SFHCICFADNGGGMNPDKMRHCM-SLGYSAKS-----------KAANTIGQYGNGFKTSTMRLGADVIVFSCCCG   88 (666)
Q Consensus        26 G~~~L~I~DDG~GMd~~el~~~m-sfG~s~k~-----------~~~~~IGrYGnGfKTgSMRLGkdviVfSK~~g   88 (666)
                      +...|.|.|||.||+.+++..++ ++|.|.+.           .....||+||.||.| ++.+|..|.|.||+.+
T Consensus        72 ~~~~I~I~DnGiGMt~edl~~~l~tiA~Sg~~~f~e~l~~~~~~~~~~iG~fGvGfyS-~f~VadkV~V~Sr~~~  145 (559)
T 1y4s_A           72 DKRTLTISDNGVGMTRDEVIDHLGTIAKSGTKSFLESLGSDQAKDSQLIGQFGVGFYS-AFIVADKVTVRTRAAG  145 (559)
T ss_dssp             TTTEEEEEECSSCCCHHHHHHHHSCCSCCCCCCTTCC--------CCCCSSCCCSGGG-HHHHEEEEEEEEECSS
T ss_pred             CCcEEEEEECCCCCCHHHHHHHHhhhcccccHHHHHHhhccccccccccCCCCcchhh-hhhccCeEEEEEcCCC
Confidence            34699999999999999998887 67777532           123579999999997 5668999999999864



>2o1u_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, AMP-PNP, GP96; HET: ANP; 2.40A {Canis lupus familiaris} PDB: 2o1v_A* 2o1w_A 2o1t_A Back     alignment and structure
>2ioq_A Chaperone protein HTPG; heat shock protein, HSP90; 3.50A {Escherichia coli} PDB: 2iop_A Back     alignment and structure
>2ior_A Chaperone protein HTPG; heat shock protein, HSP90; HET: ADP; 1.65A {Escherichia coli} Back     alignment and structure
>1yc1_A HSP 86, heat shock protein HSP 90-alpha; cell-cycle, cancer, drug design, cell cycle; HET: 4BC; 1.70A {Homo sapiens} SCOP: d.122.1.1 PDB: 1yc3_A* 1yc4_A* Back     alignment and structure
>3peh_A Endoplasmin homolog; structural genomics, structural genomics consortium, SGC, HE protein, chaperone, ATP binding; HET: IBD; 2.75A {Plasmodium falciparum 3D7} PDB: 3pej_A* Back     alignment and structure
>2wer_A ATP-dependent molecular chaperone HSP82; ATPase, ATP-binding, phosphoprotein, stress respo nucleotide-binding; HET: RDC; 1.60A {Saccharomyces cerevisiae} PDB: 2weq_A* 2wep_A* 1zwh_A* 1zw9_A* 2fxs_A* 3c11_A* 3c0e_A* 2yge_A* 2ygf_A* 2akp_A Back     alignment and structure
>3nmq_A Heat shock protein HSP 90-beta; ATPase, chaperone-chaperone inhibitor complex; HET: 7PP; 2.20A {Homo sapiens} SCOP: d.122.1.1 Back     alignment and structure
>3ied_A Heat shock protein; HSP90, chaperone, structural genomics, structura genomics consortium, SGC, stress response; HET: AN2; 2.01A {Plasmodium falciparum} Back     alignment and structure
>3o0i_A HSP90AA1 protein; HSP90 heat-shock proteins, chaperone-inhibitor complex; HET: P54; 1.47A {Homo sapiens} PDB: 2fwz_A* 2fwy_A* 2h55_A* Back     alignment and structure
>3t0h_A Heat shock protein HSP 90-alpha; chaperone, ATPase; 1.20A {Homo sapiens} SCOP: d.122.1.1 PDB: 3r4m_A 3t0z_A* 3t10_A* 3t1k_A* 3t2s_A* 1uyl_A 1uy7_A* 1uy8_A* 1uy9_A* 1uyc_A* 1uyd_A* 1uye_A* 1uyf_A* 1uyg_A* 1uyh_A* 1uyk_A* 1uy6_A 2cdd_A* 2uwd_A* 2vci_A* ... Back     alignment and structure
>2gqp_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, ligand, NECA, NPCA, adenosine; HET: PA7 PG4 1PE; 1.50A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1tc0_A* 1tbw_A* 1u0z_A* 1u2o_A* 1ysz_A* 1yt0_A* 1yt1_A* 2exl_A* 2fyp_A* 2gfd_A* 1tc6_A* 2h8m_A* 2hch_A* 2hg1_A* 3o2f_A* 2esa_A* Back     alignment and structure
>1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* Back     alignment and structure
>2cg9_A ATP-dependent molecular chaperone HSP82; chaperone complex, HSP90, heat shock protein, ATP-binding, heat shock, nucleotide-binding, acetylation; HET: ATP; 3.1A {Saccharomyces cerevisiae} Back     alignment and structure
>1b63_A MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A {Escherichia coli K12} SCOP: d.14.1.3 d.122.1.2 PDB: 1nhh_A* 1nhi_A* 1bkn_A 1nhj_A* 1b62_A* Back     alignment and structure
>3na3_A DNA mismatch repair protein MLH1; MUTL protein homolog 1, DNA damag repair, structural genomics consortium, SGC, protein bindin; HET: DNA ATP; 2.50A {Homo sapiens} Back     alignment and structure
>1h7s_A PMS1 protein homolog 2; DNA repair, GHL ATPase, mismatch repair, HNPCC; 1.95A {Homo sapiens} SCOP: d.14.1.3 d.122.1.2 PDB: 1h7u_A* 1ea6_A* Back     alignment and structure
>3h4l_A DNA mismatch repair protein PMS1; ATP binding, DNA repair, DNA damage, nucleus, phosphop DNA binding protein, protein binding; HET: DNA ANP; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1kij_A DNA gyrase subunit B; topoisomerase, gyrase B-coumarin complex, isomerase; HET: DNA NOV; 2.30A {Thermus thermophilus} SCOP: d.14.1.3 d.122.1.2 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>3fv5_A DNA topoisomerase 4 subunit B; topoisomerase IV B subunit complex, antibiotic resistance, ATP-binding, nucleotide-binding; HET: DNA 1EU; 1.80A {Escherichia coli} PDB: 1s14_A* Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} Back     alignment and structure
>1ei1_A DNA gyrase B, GYRB; ATPase domain, dimer, isomerase; HET: DNA ANP; 2.30A {Escherichia coli} SCOP: d.14.1.3 d.122.1.2 Back     alignment and structure
>1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>1mu5_A Type II DNA topoisomerase VI subunit B; GHKL ATPase, helix two-turns helix; 2.00A {Sulfolobus shibatae} SCOP: a.156.1.3 d.14.1.3 d.122.1.2 PDB: 1mx0_A* 1z5b_A* 1z5a_A* 1z59_A* 1z5c_A* 2hkj_A* Back     alignment and structure
>2btz_A Pyruvate dehydrogenase kinase isoenzyme 2; GHKL motif regulation, transferase; 2.2A {Homo sapiens} PDB: 2bu2_A* 2bu5_A* 2bu6_A* 2bu7_A* 2bu8_A* 3crk_A* 1jm6_A* 3crl_A* Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>2e0a_A Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP-binding, structural genomics, NPPSFA, NATI project on protein structural and functional analyses; HET: ANP; 1.86A {Homo sapiens} PDB: 2zdx_A* 2zdy_A* 2zkj_A* 3d2r_A* Back     alignment and structure
>1ses_A Seryl-tRNA synthetase; ligase; HET: AHX AMP; 2.50A {Thermus thermophilus} SCOP: a.2.7.1 d.104.1.1 PDB: 1ser_A* 1set_A* 1sry_A Back     alignment and structure
>2q8g_A [pyruvate dehydrogenase [lipoamide]] kinase isozy; GHKL ATPase/kinase family, pyruvate dehydrogenase complex, mitochondrial kinase; HET: AZX; 1.90A {Homo sapiens} PDB: 2q8f_A* 2q8h_A Back     alignment and structure
>3d36_A Sporulation kinase B; GHKL ATPase, four helix bundle, class I two-component histidine kinase, phosphoprotein; HET: ADP; 2.03A {Geobacillus stearothermophilus} Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>2c2a_A Sensor histidine kinase; phosphotransfer, PHOQ, selenomethionyl MAD, two-component systems, transferase; HET: ADP; 1.9A {Thermotoga maritima} SCOP: a.30.2.1 d.122.1.3 PDB: 3dge_A* Back     alignment and structure
>1s16_A Topoisomerase IV subunit B; two-domain protein complexed with ADPNP; HET: ANP; 2.10A {Escherichia coli} SCOP: d.14.1.3 d.122.1.2 Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Back     alignment and structure
>3sl2_A Sensor histidine kinase YYCG; ATP binding, intact ATP, bergerat fold, TR; HET: ATP; 1.61A {Bacillus subtilis} Back     alignment and structure
>2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2zbk_B Type 2 DNA topoisomerase 6 subunit B; DNA binding protein, decatenation, ATPase, drug design, DNA-binding, magnesium, metal-binding; HET: RDC; 3.56A {Sulfolobus shibatae} Back     alignment and structure
>2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1y8o_A [pyruvate dehydrogenase [lipoamide]] kinase isozy; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: a.29.5.1 d.122.1.4 PDB: 1y8n_A* 1y8p_A* 2pnr_A* 2q8i_A* Back     alignment and structure
>3a0y_A Sensor protein; ATP-LID, kinase, phosphoprotein, transferase, two-component regulatory system; 1.57A {Thermotoga maritima} PDB: 3a0t_A* 3a0x_A 3a0w_A 3a0z_A Back     alignment and structure
>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>1id0_A PHOQ histidine kinase; PHOQ/PHOP, signal transduction, transferase; HET: ANP; 1.60A {Escherichia coli} SCOP: d.122.1.3 PDB: 3cgz_A 3cgy_A Back     alignment and structure
>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>2oto_A M protein; helical coiled coil, fibrinogen-binding, virulence factor, S active protein, toxin; 3.04A {Streptococcus pyogenes serotype M1} PDB: 2xny_M Back     alignment and structure
>1i58_A Chemotaxis protein CHEA; beta-alpha sandwich, signaling protein, transferase; HET: ACP ADP; 1.60A {Thermotoga maritima} SCOP: d.122.1.3 PDB: 1i59_A* 1i5a_A* 1i5b_A* 1i5c_A* 1i5d_A* Back     alignment and structure
>2dq0_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: SSA; 2.60A {Pyrococcus horikoshii} PDB: 2dq1_A* 2dq2_A 2zr2_A* 2zr3_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 666
d1f5na1300 a.114.1.1 (A:284-583) Interferon-induced guanylate 3e-04
d1t7sa_129 a.7.7.1 (A:) BAG-family molecular chaperon regulat 0.002
>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 Back     information, alignment and structure

class: All alpha proteins
fold: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain
superfamily: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain
family: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain
domain: Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 41.3 bits (96), Expect = 3e-04
 Identities = 14/75 (18%), Positives = 39/75 (52%), Gaps = 5/75 (6%)

Query: 565 QLKQENHELKKRLEKKEGELQE--ERERCRSLEAQLKVMQQTIEELNKEQESLIDIFAEE 622
           + +Q   + ++  ++   +L E  E +R + L+ Q + +   ++E   +++ L + F +E
Sbjct: 229 KNEQMMEQKERSYQEHLKQLTEKMENDRVQLLKEQERTLALKLQE---QEQLLKEGFQKE 285

Query: 623 RDRREREEENLRKKI 637
               + E ++L+ K+
Sbjct: 286 SRIMKNEIQDLQTKM 300


>d1t7sa_ a.7.7.1 (A:) BAG-family molecular chaperon regulator-1, BAG1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 129 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query666
d2iwxa1213 HSP90 {Baker's yeast (Saccharomyces cerevisiae) [T 98.21
d1uyla_208 HSP90 {Human (Homo sapiens) [TaxId: 9606]} 98.2
d2gqpa1227 HSP90 {Dog (Canis familiaris) [TaxId: 9615]} 98.15
d2hkja3219 Topoisomerase VI-B subunit {Archaeon Sulfolobus sh 97.12
d1h7sa2203 DNA mismatch repair protein PMS2 {Human (Homo sapi 97.11
d1b63a2218 DNA mismatch repair protein MutL {Escherichia coli 96.16
d1ixma_179 Sporulation response regulatory protein Spo0B {Bac 90.9
d2c2aa2161 Sensor histidine kinase TM0853 {Thermotoga maritim 88.85
d1gkza2193 Branched-chain alpha-ketoacid dehydrogenase kinase 87.08
d1seta1110 Seryl-tRNA synthetase (SerRS) {Thermus thermophilu 86.39
d1jm6a2190 Pyruvate dehydrogenase kinase {Rat (Rattus norvegi 86.32
d1bxda_161 Histidine kinase domain of the osmosensor EnvZ {Es 84.11
d1ysra1148 Sensor-type histidine kinase PrrB {Mycobacterium t 83.62
d1id0a_146 Histidine kinase PhoQ domain {Escherichia coli [Ta 82.96
>d2iwxa1 d.122.1.1 (A:2-214) HSP90 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase
superfamily: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase
family: Heat shock protein 90, HSP90, N-terminal domain
domain: HSP90
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=98.21  E-value=3.4e-07  Score=88.76  Aligned_cols=62  Identities=23%  Similarity=0.347  Sum_probs=52.0

Q ss_pred             CcceEEEEECCCCCCHHHHHHHH-hcCCCCCCC---------ccccccccCCcccccccccCCeEEEEeeecC
Q 005993           26 SFHCICFADNGGGMNPDKMRHCM-SLGYSAKSK---------AANTIGQYGNGFKTSTMRLGADVIVFSCCCG   88 (666)
Q Consensus        26 G~~~L~I~DDG~GMd~~el~~~m-sfG~s~k~~---------~~~~IGrYGnGfKTgSMRLGkdviVfSK~~g   88 (666)
                      +...|.|.|||.||+.+++.+-| .+|.|.+..         ..+.|||||.||=|+ |-+|..|.|.||+.+
T Consensus        70 ~~~~l~i~DnGiGMt~~~~~~~l~~ia~S~~~~~~~~~~~~~~~~~IGqFGIGfyS~-Fmvad~v~V~trs~~  141 (213)
T d2iwxa1          70 EQKVLEIRDSGIGMTKAELINNLGTIAKSGTKAFMEALSAGADVSMIGQFGVGFYSL-FLVADRVQVISKSND  141 (213)
T ss_dssp             GGTEEEEEECSSCCCHHHHHHHHTTCCCSTHHHHHHHHHHTCCGGGGGGGTCGGGGG-GGTEEEEEEEEECTT
T ss_pred             ccceeEEecCCccccHHHHHHHHhhhhcccchHHHhhhhhhhhhhhhcccccchhhh-hhhccceeEEeecCC
Confidence            56789999999999999999888 788876531         235799999999766 569999999999764



>d1uyla_ d.122.1.1 (A:) HSP90 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gqpa1 d.122.1.1 (A:74-337) HSP90 {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d2hkja3 d.122.1.2 (A:10-228) Topoisomerase VI-B subunit {Archaeon Sulfolobus shibatae [TaxId: 2286]} Back     information, alignment and structure
>d1h7sa2 d.122.1.2 (A:29-231) DNA mismatch repair protein PMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixma_ d.123.1.1 (A:) Sporulation response regulatory protein Spo0B {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2c2aa2 d.122.1.3 (A:321-481) Sensor histidine kinase TM0853 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gkza2 d.122.1.4 (A:186-378) Branched-chain alpha-ketoacid dehydrogenase kinase (BCK) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1seta1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} Back     information, alignment and structure
>d1jm6a2 d.122.1.4 (A:1177-1366) Pyruvate dehydrogenase kinase {Rat (Rattus norvegicus), isozyme 2 [TaxId: 10116]} Back     information, alignment and structure
>d1bxda_ d.122.1.3 (A:) Histidine kinase domain of the osmosensor EnvZ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ysra1 d.122.1.3 (A:299-446) Sensor-type histidine kinase PrrB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1id0a_ d.122.1.3 (A:) Histidine kinase PhoQ domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure