Citrus Sinensis ID: 006022

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660----
MQDLGSMLKVSAIWRGKKYVVEVNSGSPLKELGHELQKLTDVKADTMRFIVPQNKGSKLLSPFSDEHSSLSLQEVSIIEGKSIRMMGVSEDEVDKVLQNEKADLRIAGFDEEEKRLRQRMLDRTNAPLKLPQGQYMFCDFRTLQIPGVELNPPASEALKIMHMLAADPGIIAIMNKHRWRVGIMTELAPVGYVGVSPKCVLGFNKNHGEEISLRLRTDDLKGFRKYESIKKTLLHELAHMVYSEHDANFYGLDKQLNQEAVALDWTKSRGHTLSGVRHTSHHEDDLFVGDSRSFSQKLGGNISDQLASARASSVAAAYRRLANASANSLGVSEVHEEPDPDDSGLIMLGESHHTVSAAKGSLDIESPSRDQWKGHEPDPDDDPGYENKLEPDPDDSQDGEPLEPENYSDPEMVQQVSPKKLAATNPYEEPDPDDSETAWKSGVVVEPESLCSQLMEVDDTVQLRRTSAEPDPDDSEAELKIKIVNDTTEDQGHLYKAQREPDPDELLANEVVQQEPDPDDNLVQLQEISSMKIDEPDPDDQELRSIQDTVTVVCSRLQKAIEMLRAEVSPLESTTVLQTLCKIIRNVIEHPDETKYKRLRKANPIIQRSVANYKAAMEILFLVGFNEDVVLDEIGKAETYLVLKRNDLALLWLAKSSLETCIAY
ccccccEEEEEEEEccEEEEEEEcccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccEEEEEcccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccccccccccccccEEEcccEEcccccccccccHHHHHHHHHHHHcccccHHHHccccEEEEEEEEccccccccccccccccccccccEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccccccEEcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccHHHHHHHHHccccccccccccccccccccHHHHHHHccccccccccccHHHHHcccccccccccccHHHHcccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccccHHccccHHHHHHcccHHHHHHHHHHccccccccccccccccEEEEEccccHHHHHHHHHHHHHHHcc
ccccccEEEEEEEEcccEEEEEccccccHHHHHHHHHHHccccHHHcEEEEccccccccccccccccccccHHHHccccccEEEEEcccHHHHHHHHHHccHHHHHcccHHHHHHHHHHHcccccccccccccccEEcccEEEEEccccccccHHHHHHHHHHHHccccHHHHHHHcccEEEEEEEEccccccccccccEEEEEcccccEEEEEEccccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccccccEccccccccHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccHcccccccccccEEEEEccccccccccccEccccccHHcccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccEEcccccccccEEccccccEEEccccccccccHHHHHHHcccccccccccccccccccccccccHHHEEccccccccccccccccEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccHHHHHHHHcHHHHHHHHHHHccccccccccccccccEEEEEcccHHHHHHHHHHHHHHHcc
MQDLGSMLKVSAIWRGKKYVVEVnsgsplkeLGHELQKLTdvkadtmrfivpqnkgskllspfsdehsslslqeVSIIEGKSIRMMGVSEDEVDKVLQNEKADLRIAGFDEEEKRLRQRMLDrtnaplklpqgqymfcdfrtlqipgvelnppaSEALKIMHMLAADPGIIAIMNKHRWRVGimtelapvgyvgvspkcvlgfnknhgeeISLRLRTDDLKGFRKYESIKKTLLHELAHMVYsehdanfygldkQLNQEAVALDwtksrghtlsgvrhtshheddlfvgdsrsfsqklggniSDQLASARASSVAAAYRRLANASAnslgvsevheepdpddsglimlgeshhtvsaakgsldiespsrdqwkghepdpdddpgyenklepdpddsqdgeplepenysdpemvqqvspkklaatnpyeepdpddsetawksgvvvepeslcsqlmevddTVQLrrtsaepdpddseAELKIKIVndttedqghlykaqrepdpdelLANEvvqqepdpddnlvQLQEIssmkidepdpddqelrsIQDTVTVVCSRLQKAIEMLRAevsplestTVLQTLCKIIRNviehpdetkyKRLRKANPIIQRSVANYKAAMEILFLVGFNEDVVLDEIGKAETYLVLKRNDLALLWLAKSSLETCIAY
mqdlgsmlkvsaiwrgKKYVVEVNSGSPLKELGHELQKLTDVKADTMRFIVPQNKGSKLLSPFSDEHSSLSLQEVSIIEGKSIRMMGVSEDEVDKVLQnekadlriagfdeeeKRLRQRMLDrtnaplklpqgqYMFCDFRTLQIPGVELNPPASEALKIMHMLAADPGIIAIMNKHRWRVGIMTELAPVGYVGVSPKCVLGfnknhgeeislrlrtddlkgFRKYESIKKTLLHELAHMVYSEHDANFYGLDKQLNQEAVALDWTKSRGHTLSGVrhtshheddlfvGDSRSFSQKLGGNISDQLASARASSVAAAYRRLANASanslgvsevHEEPDPDDSGLIMLGESHHTVSAAKGSLDIESPSRDQWKGhepdpdddpgyENKLEPDPDDSQDGEPLEPENYSDPEMVQQVSPKKLAATNPYEEPDPDDSETAWKSGVVVEPESLCSQLMEVDDTVQLRRtsaepdpddseaelkikivndttedQGHLYKAQREPDPDELLANEVVQQEPDPDDNLVQLQEISSMkidepdpddqelrsIQDTVTVVCSRLQKAIEMlraevsplesttVLQTLCKIIRnviehpdetkykrlrkanpiiQRSVANYKAAMEILFLVGFNEDVVLDEIGKAETYLVLKRNDLALLWLAkssletciay
MQDLGSMLKVSAIWRGKKYVVEVNSGSPLKELGHELQKLTDVKADTMRFIVPQNKGSKLLSPFSDEHSSLSLQEVSIIEGKSIRMMGVSEDEVDKVLQNEKADLRIAGFDEEEKRLRQRMLDRTNAPLKLPQGQYMFCDFRTLQIPGVELNPPASEALKIMHMLAADPGIIAIMNKHRWRVGIMTELAPVGYVGVSPKCVLGFNKNHGEEISLRLRTDDLKGFRKYESIKKTLLHELAHMVYSEHDANFYGLDKQLNQEAVALDWTKSRGHTLSGVRHTSHHEDDLFVGDSRSFSQKLGGNISDQLasarassvaaayrrlanasansLGVSEVHEEPDPDDSGLIMLGESHHTVSAAKGSLDIESPSRDQWKGHEPDPDDDPGYENKLEPDPDDSQDGEPLEPENYSDPEMVQQVSPKKLAATNPYEEPDPDDSETAWKSGVVVEPESLCSQLMEVDDTVQLRRTSAEPDPDDSEAELKIKIVNDTTEDQGHLYKAQREPDPDELLANEVVQQEPDPDDNLVQLQEISSMKIDEPDPDDQELRSIQDTVTVVCSRLQKAIEMLRAEVSPLESTTVLQTLCKIIRNVIEHPDETKYKRLRKANPIIQRSVANYKAAMEILFLVGFNEDVVLDEIGKAETYLVLKRNDLALLWLAKSSLETCIAY
*******LKVSAIWRGKKYVVEVNSG**L*ELGHELQKLTDVKADTMRFIV****************************************************************************LKLPQGQYMFCDFRTLQIPGVELNPPASEALKIMHMLAADPGIIAIMNKHRWRVGIMTELAPVGYVGVSPKCVLGFNKNHGEEISLRLRTDDLKGFRKYESIKKTLLHELAHMVYSEHDANFYGLDKQLNQEAVALDWTKSRGHTL********************************************************************************************************************************************************************************************************************************************************************************IQDTVTVVCSRLQKAIEMLRAEVSPLESTTVLQTLCKIIRNVIEHPDETKYKRLRKANPIIQRSVANYKAAMEILFLVGFNEDVVLDEIGKAETYLVLKRNDLALLWLAKSSLETCI**
*****SM***SAIWRGKKYVVEVNSGSPLKELGHELQKLTDVKADTMRFIV**************************IEGKSIR*************************************************QYMFCDFRTLQIPGVELNPPASEALKIMHMLAADPGIIAIMNKHRWRVGIMTELAPVGYVGVSPKCVLGFNKNHGEEISLRLRTDDLKGFRKYESIKKTLLHELAHMVYSEHDANFYGLDKQLNQEAVALDWTKSRGHTLSGVRHTSH**************************************************************************************************************************************************************************************************************************************************************PDPDDQELRSIQDTVTVVCSRLQKAIEMLRAEVSPLESTTVLQTLCKIIRNVIEHPDETKYKRLRKANPIIQRSVANYKAAMEILFLVGFNEDVVLDEIGKAETYLVLKRNDLALLWLAKSSLE*****
MQDLGSMLKVSAIWRGKKYVVEVNSGSPLKELGHELQKLTDVKADTMRFIVPQNKGSKLLSPFSDEHSSLSLQEVSIIEGKSIRMMGVSEDEVDKVLQNEKADLRIAGFDEEEKRLRQRMLDRTNAPLKLPQGQYMFCDFRTLQIPGVELNPPASEALKIMHMLAADPGIIAIMNKHRWRVGIMTELAPVGYVGVSPKCVLGFNKNHGEEISLRLRTDDLKGFRKYESIKKTLLHELAHMVYSEHDANFYGLDKQLNQEAVALDWTKSRGHTLSGVRHTSHHEDDLFVGDSRSFSQKLGGNIS***********AAAYRRLANASA**************DDSGLIMLGESHHTVSAAKGSLDIE*****************PGYENKLE*************PENYSDPEMVQQVSPKKLAAT************TAWKSGVVVEPESLCSQLMEVDDTVQLR***********EAELKIKIVNDTTEDQGHLYKAQREPDPDELLANEVVQQEPDPDDNLVQLQEISSMKIDEPDPDDQELRSIQDTVTVVCSRLQKAIEMLRAEVSPLESTTVLQTLCKIIRNVIEHPDETKYKRLRKANPIIQRSVANYKAAMEILFLVGFNEDVVLDEIGKAETYLVLKRNDLALLWLAKSSLETCIAY
****GSMLKVSAIWRGKKYVVEVNSGSPLKELGHELQKLTDVKADTMRFIVPQNKGSKLLSPFSDEHSSLSLQEVSIIEGKSIRMMGVSEDEVDKVLQNEK*****AG*DEEEKRL***************QGQYMFCDFRTLQIPGVELNPPASEALKIMHMLAADPGIIAIMNKHRWRVGIMTELAPVGYVGVSPKCVLGFNKNHGEEISLRLRTDDLKGFRKYESIKKTLLHELAHMVYSEHDANFYGLDKQLNQEAVALDWTKSRGHTLSGVRHT***************************************************************SGLIMLGE*******************************************************************************************GVVVEPESLCSQLMEVDDTVQLRRTSAEPDPDDSEAELKIKIV********************ELLANEVVQ*****DDNLVQLQEISSMKIDEPDPDDQELRSIQDTVTVVCSRLQKAIEMLRAEVSPLESTTVLQTLCKIIRNVIEHPDETKYKRLRKANPIIQRSVANYKAAMEILFLVGFNEDVVLDEIGKAETYLVLKRNDLALLWLAKSSLETCIAY
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQDLGSMLKVSAIWRGKKYVVEVNSGSPLKELGHELQKLTDVKADTMRFIVPQNKGSKLLSPFSDEHSSLSLQEVSIIEGKSIRMMGVSEDEVDKVLQNEKADLRIAGFDEEEKRLRQRMLDRTNAPLKLPQGQYMFCDFRTLQIPGVELNPPASEALKIMHMLAADPGIIAIMNKHRWRVGIMTELAPVGYVGVSPKCVLGFNKNHGEEISLRLRTDDLKGFRKYESIKKTLLHELAHMVYSEHDANFYGLDKQLNQEAVALDWTKSRGHTLSGVRHTSHHEDDLFVGDSRSFSQKLGGNISDQLASARASSVAAAYRRLANASANSLGVSEVHEEPDPDDSGLIMLGESHHTVSAAKGSLDIESPSRDQWKGHEPDPDDDPGYENKLEPDPDDSQDGEPLEPENYSDPEMVQQVSPKKLAATNPYEEPDPDDSETAWKSGVVVEPESLCSQLMEVDDTVQLRRTSAEPDPDDSEAELKIKIVNDTTEDQGHLYKAQREPDPDELLANEVVQQEPDPDDNLVQLQEISSMKIDEPDPDDQELRSIQDTVTVVCSRLQKAIEMLRAEVSPLESTTVLQTLCKIIRNVIEHPDETKYKRLRKANPIIQRSVANYKAAMEILFLVGFNEDVVLDEIGKAETYLVLKRNDLALLWLAKSSLETCIAY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query664 2.2.26 [Sep-21-2011]
O94580282 Ubiquitin and WLM domain- yes no 0.260 0.613 0.348 2e-22
P38838269 DNA damage response prote yes no 0.152 0.375 0.327 5e-06
>sp|O94580|YQ77_SCHPO Ubiquitin and WLM domain-containing protein C1442.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1442.07c PE=4 SV=1 Back     alignment and function desciption
 Score =  107 bits (268), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 68/195 (34%), Positives = 95/195 (48%), Gaps = 22/195 (11%)

Query: 131 PQGQYMFCDFRTLQIPGVELNPPASEALKIMHMLAADPGIIAIMNKHRWRVGIMTELAPV 190
           P   Y F +   L  P  +       AL+ +  L  D GI  IM+ HRW V +++E+ P 
Sbjct: 105 PASIYTFNELVVLDYPHKD------RALRYLERLRDDTGIKKIMDSHRWTVPLLSEMDPA 158

Query: 191 GYVGVSPKCVLGFNKNHGEEISLRLRTDDLKGFRKYESIKKTLLHELAHMVYSEHDANFY 250
            +     K  LG N N G  I LRLRTD   GFR Y+++K TL+HEL H V+ EHD++F+
Sbjct: 159 EHTRHDSK-TLGLNHNQGAHIELRLRTDRYDGFRDYKTVKSTLIHELTHNVHGEHDSSFW 217

Query: 251 GLDKQLNQEAVALDWTKSRGHTLSGVRHTSHHEDDLFVGDSRSFSQKLGGNISDQLASAR 310
            L +QL +EA A D     G                +V D  S++ +   +  DQ    R
Sbjct: 218 ELFRQLTKEADAADLLGKPGS---------------YVSDRASYTPQQDNDDEDQKNHRR 262

Query: 311 ASSVAAAYRRLANAS 325
              +AAA RR  + S
Sbjct: 263 DLLLAAAERRKQSGS 277

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (taxid: 284812)
>sp|P38838|WSS1_YEAST DNA damage response protein WSS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=WSS1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query664
225447189713 PREDICTED: uncharacterized protein LOC10 0.992 0.924 0.653 0.0
224129082618 predicted protein [Populus trichocarpa] 0.917 0.985 0.645 0.0
297739236606 unnamed protein product [Vitis vinifera] 0.862 0.945 0.632 0.0
255576119594 conserved hypothetical protein [Ricinus 0.879 0.983 0.592 0.0
357462523666 Ubiquitin and WLM domain-containing prot 0.924 0.921 0.560 0.0
449450882690 PREDICTED: uncharacterized protein LOC10 0.962 0.926 0.556 0.0
449518252690 PREDICTED: uncharacterized protein LOC10 0.962 0.926 0.556 0.0
357469919652 Ubiquitin and WLM domain-containing prot 0.899 0.915 0.551 0.0
115477128669 Os08g0500800 [Oryza sativa Japonica Grou 0.936 0.929 0.515 1e-179
326528705661 predicted protein [Hordeum vulgare subsp 0.899 0.903 0.512 1e-175
>gi|225447189|ref|XP_002271945.1| PREDICTED: uncharacterized protein LOC100248207 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  844 bits (2181), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/699 (65%), Positives = 526/699 (75%), Gaps = 40/699 (5%)

Query: 1   MQDLGSMLKVSAIWRGKKYVVEVNSGSPLKELGHELQKLTDVKADTMRFIVPQ--NKGSK 58
           MQ     L +S IWRGKK++VE NS + LK+ GHELQKLT VKADTMR IVPQ  NKG K
Sbjct: 20  MQQPKDTLSISTIWRGKKFIVETNSDATLKKFGHELQKLTGVKADTMRLIVPQPSNKGLK 79

Query: 59  LLSPFSDEHSSLSLQEVSIIEGKSIRMMGVSEDEVDKVLQNEKADLRIAGFDEEEKRLRQ 118
           LLSPFSDEH  LSLQE SI++GKSIRMMGVSE EVD+VL+N K DLRI GF+EEEKRLRQ
Sbjct: 80  LLSPFSDEHMHLSLQETSILQGKSIRMMGVSEHEVDEVLKNAKVDLRIPGFEEEEKRLRQ 139

Query: 119 RMLDRTNAPLKLPQGQYMFCDFRTLQIPGVELNPPASEALKIMHMLAADPGIIAIMNKHR 178
           RM DR + P KLPQG Y+FCDFRTL++PG+ LNPPASEALK MHMLAADPGI+AIMNKHR
Sbjct: 140 RMFDRPHTPQKLPQGNYIFCDFRTLELPGIVLNPPASEALKRMHMLAADPGIVAIMNKHR 199

Query: 179 WRVGIMTELAPVGYVGVSPKCVLGFNKNHGEEISLRLRTDDLKGFRKYESIKKTLLHELA 238
           WRVGIMTE+APVGYVGVSPKC+LG NKNHGEEISLRLRTDDLKGFRKYESIKKTLLHELA
Sbjct: 200 WRVGIMTEMAPVGYVGVSPKCILGVNKNHGEEISLRLRTDDLKGFRKYESIKKTLLHELA 259

Query: 239 HMVYSEHDANFYGLDKQLNQEAVALDWTKSRGHTLSGVRHTSHHEDDLFVGDSRSFSQKL 298
           HMVYSEHDANFY LDKQLNQEA +LDWTKSR HTLSG +H+ H+E + + GDS  FSQKL
Sbjct: 260 HMVYSEHDANFYALDKQLNQEAASLDWTKSRSHTLSGHQHSEHYEGEFYSGDSSIFSQKL 319

Query: 299 GGNISDQLASARASSVAAAYRRLANASANSLGVSEVHEEPDPDDSGLIMLGESHHTVSAA 358
           GG +SDQL SARASSVAAAY RLANAS N+ GV+E+HEEPDPDDS   M  E     +  
Sbjct: 320 GGKMSDQLESARASSVAAAYLRLANASTNNTGVAELHEEPDPDDSESNMHEEYD---ALY 376

Query: 359 KGSLDIESPSRDQWK-GHEPDPDDDPGYENKLEPDPDDSQDGEPLEPENYS--------- 408
           K +LDI +P+R Q K   EPDPDD    + K+EP P   + G  +E E YS         
Sbjct: 377 KKTLDINNPNRAQSKVDDEPDPDDFSDNQRKIEPCP-HYESGGFMESELYSGINESKVIF 435

Query: 409 --DPEMV--QQVSP-----KKLAATNPYEEPDPDDSETAWKSGVVVEPESLCSQLME-VD 458
             DP+ V  QQ  P     +KLA+T   EEPDPDD E + K  +VVEPE   SQL++ +D
Sbjct: 436 EPDPDDVEMQQFVPHSRTDEKLASTKTSEEPDPDDLEVSVKQHLVVEPEPENSQLLKTLD 495

Query: 459 DTVQLRRTSAEPDPDDSEAELK-------------IKIVNDTTEDQGHLYKAQREPDPDE 505
             VQ+ +T  EPDPDDSE +                 +V  T EDQ    K  +EPDPD+
Sbjct: 496 SKVQMMKTLDEPDPDDSEVKRNGLGCGNISRLDHGNSLVMKTMEDQCPQRKGYKEPDPDD 555

Query: 506 LLANEVVQQEPDPDDNLVQLQEISSMKIDEPDPDDQELRSIQDTVTVVCSRLQKAIEMLR 565
             AN V+  EPDPDDNLV   + S M  DEPDPDD+EL+ IQD VTVVC+RLQKAIEMLR
Sbjct: 556 SQANGVM-AEPDPDDNLVHPLDTSIMHTDEPDPDDEELQRIQDPVTVVCNRLQKAIEMLR 614

Query: 566 AEVSPLESTTVLQTLCKIIRNVIEHPDETKYKRLRKANPIIQRSVANYKAAMEILFLVGF 625
           +EV+  ++  VLQTL KIIRN+IEHPDE K++RLRKANP  QR++ANYKAAME+LFL+GF
Sbjct: 615 SEVNATQAAIVLQTLFKIIRNLIEHPDEIKFRRLRKANPAFQRNIANYKAAMEVLFLIGF 674

Query: 626 NEDVVLDEIGKAETYLVLKRNDLALLWLAKSSLETCIAY 664
           NEDVV  EIGK ETYLV+KRND  LLWL KSSLET +A+
Sbjct: 675 NEDVVSSEIGKVETYLVMKRNDPGLLWLVKSSLETRMAH 713

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224129082|ref|XP_002320496.1| predicted protein [Populus trichocarpa] gi|222861269|gb|EEE98811.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297739236|emb|CBI28887.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255576119|ref|XP_002528954.1| conserved hypothetical protein [Ricinus communis] gi|223531600|gb|EEF33428.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|357462523|ref|XP_003601543.1| Ubiquitin and WLM domain-containing protein [Medicago truncatula] gi|355490591|gb|AES71794.1| Ubiquitin and WLM domain-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|449450882|ref|XP_004143191.1| PREDICTED: uncharacterized protein LOC101220832 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449518252|ref|XP_004166156.1| PREDICTED: uncharacterized protein LOC101231982 [Cucumis sativus] Back     alignment and taxonomy information
>gi|357469919|ref|XP_003605244.1| Ubiquitin and WLM domain-containing protein [Medicago truncatula] gi|355506299|gb|AES87441.1| Ubiquitin and WLM domain-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|115477128|ref|NP_001062160.1| Os08g0500800 [Oryza sativa Japonica Group] gi|42407752|dbj|BAD08898.1| zinc metalloproteinase-like [Oryza sativa Japonica Group] gi|113624129|dbj|BAF24074.1| Os08g0500800 [Oryza sativa Japonica Group] gi|215715260|dbj|BAG95011.1| unnamed protein product [Oryza sativa Japonica Group] gi|218201399|gb|EEC83826.1| hypothetical protein OsI_29769 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|326528705|dbj|BAJ97374.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query664
TAIR|locus:2177286603 AT5G35690 [Arabidopsis thalian 0.701 0.772 0.508 8.8e-118
ASPGD|ASPL0000062153341 AN1049 [Emericella nidulans (t 0.393 0.765 0.294 5.2e-22
POMBASE|SPCC1442.07c282 SPCC1442.07c "ubiquitin/metall 0.299 0.705 0.320 1.8e-21
TAIR|locus:505006190404 AT1G55915 [Arabidopsis thalian 0.180 0.297 0.350 1.2e-09
ASPGD|ASPL0000062736336 AN0304 [Emericella nidulans (t 0.170 0.336 0.36 5.7e-09
UNIPROTKB|G4MYN3483 MGG_01341 "Uncharacterized pro 0.171 0.236 0.353 1.2e-06
TAIR|locus:2156489323 AT5G48690 "AT5G48690" [Arabido 0.320 0.659 0.256 2.5e-06
UNIPROTKB|E9PSQ4 989 Gabre "Gamma-aminobutyric acid 0.396 0.265 0.237 4.3e-06
SGD|S000001176269 WSS1 "Sumoylated protein local 0.158 0.390 0.316 7.2e-06
UNIPROTKB|F1LP68 914 Gabre "Gamma-aminobutyric acid 0.403 0.293 0.228 8.2e-06
TAIR|locus:2177286 AT5G35690 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1160 (413.4 bits), Expect = 8.8e-118, P = 8.8e-118
 Identities = 266/523 (50%), Positives = 338/523 (64%)

Query:     1 MQDLGSMLKVSAIWRGKKYVVEVNSGSPLKELGHELQKLTDVKADTMRFIVPQ--NKGSK 58
             M+D G  ++VS +W+G KY VE++SG+ LK+LG+EL+KLT V ++T+R IVP+   KGS 
Sbjct:     6 MEDSGKKIRVSLLWKGNKYSVEIDSGASLKDLGYELRKLTGVTSETLRLIVPRLNEKGSS 65

Query:    59 LLSPFSDEHSSLSLQEVSIIEGKSIRMMGVSEDEVDKVLQNEKADLRIAGFDEEEKRLRQ 118
             L+ PFSDEHSSLSLQE +IIE K+IRMMGVSE+EV+ VL+   +D+RI GF+EEE+RL+Q
Sbjct:    66 LMLPFSDEHSSLSLQESNIIEDKTIRMMGVSEEEVEGVLKEAVSDMRILGFEEEERRLKQ 125

Query:   119 RMLDRTNAPLKLPQGQYMFCDFRTLQIPGVELNPPASEALKIMHMLAADPGIIAIMNKHR 178
             +    ++A +KLPQG Y+F DFRTLQ+PG+ELNPP S ALK MHMLAADPGIIA+MNKHR
Sbjct:   126 KKSYVSSASIKLPQGTYIFGDFRTLQLPGIELNPPPSAALKRMHMLAADPGIIAVMNKHR 185

Query:   179 WRVGIMTELAPVGYVGVSPKCVLGFNKNHGEEISLRLRTDDLKGFRKYESIKKTLLHELA 238
             WRVGIMTELAPVGYVGVSP+C+LGFNKN GEEISLRLRTDDLKGFRKY+SIKKTLLHELA
Sbjct:   186 WRVGIMTELAPVGYVGVSPRCLLGFNKNQGEEISLRLRTDDLKGFRKYQSIKKTLLHELA 245

Query:   239 HMVYSEHDANFYGLDKQLNQEAVALDWTKSRGHTLSGVRHTSHH-EDDLFVGDSRSFSQK 297
             HMVY+EHD  FY LD QLN+EA +LDWTKSRGHTL+G +  +   E+D F  ++ + SQ+
Sbjct:   246 HMVYTEHDEKFYALDSQLNKEAESLDWTKSRGHTLNGTKFINDDDEEDYFFDENETVSQR 305

Query:   298 LGGNISDQLXXXXXXXXXXXXXXXXXXXXXXLGVSEVHEEPDPDDSGLIMLGESHHTVSA 357
             LGGN SD L                        VS++ EEPDPDD  L+ + + +  +  
Sbjct:   306 LGGNQSDNLGNARESSVAAAYRRLSHTS-----VSKLSEEPDPDD--LVDVRDENKQLVL 358

Query:   358 AKGSLDIESPSRDQWKGHEPDPDDDPG-----------YE--NKL--------EPDPDDS 396
              K     +S S  ++   EPDPDD              YE  + L        EPDPDDS
Sbjct:   359 PKA----QSDSMTKF---EPDPDDTTADDATKTESCHSYEMASDLAHPTKDDDEPDPDDS 411

Query:   397 QDGEPL-EPENYSDPEMVQQVSPKKLAATNPYEEPDPDDSETAWKSGVVV-EPESLCSQL 454
             +    + E EN         +     A       P+P+++E      +VV E E++    
Sbjct:   412 ETHTSIGEVENMKIVNDTVMLCGNLNADEATQATPEPNNAEPYPDYNLVVTERETI---- 467

Query:   455 MEVDDTVQLRRTSAEPDPDDSEAELKIKIVNDTTEDQGHLYKA 497
             MEVD          EPDPDD E +   +I +  T     L KA
Sbjct:   468 MEVD----------EPDPDDQEIQ---RIQDSVTIISNRLKKA 497
GO:0005634 "nucleus" evidence=ISM
ASPGD|ASPL0000062153 AN1049 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
POMBASE|SPCC1442.07c SPCC1442.07c "ubiquitin/metalloprotease fusion protein (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
TAIR|locus:505006190 AT1G55915 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000062736 AN0304 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|G4MYN3 MGG_01341 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
TAIR|locus:2156489 AT5G48690 "AT5G48690" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E9PSQ4 Gabre "Gamma-aminobutyric acid receptor subunit epsilon" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
SGD|S000001176 WSS1 "Sumoylated protein localizing to the nuclear periphery of mother cells" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
UNIPROTKB|F1LP68 Gabre "Gamma-aminobutyric acid receptor subunit epsilon" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query664
pfam08325183 pfam08325, WLM, WLM domain 4e-55
cd1046396 cd10463, PUB_WLM, PNGase/UBA or UBX (PUB) domain o 2e-37
cd0921296 cd09212, PUB, PNGase/UBA or UBX (PUB) domain of p9 2e-20
pfam0940985 pfam09409, PUB, PUB domain 2e-17
cd10461107 cd10461, PUB_UBA_plant, PNGase/UBA or UBX (PUB) do 5e-13
cd10460102 cd10460, PUB_UBXD1, PNGase/UBA or UBX (PUB) domain 1e-12
cd10462100 cd10462, PUB_UBA, PNGase/UBA or UBX (PUB) domain o 2e-08
smart0058057 smart00580, PUG, domain in protein kinases, N-glyc 4e-07
cd1045993 cd10459, PUB_PNGase, PNGase/UBA or UBX (PUB) domai 8e-05
pfam05887145 pfam05887, Trypan_PARP, Procyclic acidic repetitiv 0.003
>gnl|CDD|219796 pfam08325, WLM, WLM domain Back     alignment and domain information 
 Score =  185 bits (472), Expect = 4e-55
 Identities = 73/180 (40%), Positives = 91/180 (50%), Gaps = 16/180 (8%)

Query: 151 NPPASEALKIMHMLAADPGIIAIMNKHRWRVGIMTELAPVGYVGVSPKCVLGFNKNHGEE 210
            P  S AL ++  LA D  +  IM +HRWRVG++TE  P          +LG N N GE 
Sbjct: 12  KPDHSRALDLLKRLADD--VRPIMKEHRWRVGLLTEFYPRNAR------LLGLNVNKGEV 63

Query: 211 ISLRLRTD-DLKGFRKYESIKKTLLHELAHMVYSEHDANFYGLDKQLNQEAVALDWT--- 266
           I LRLRT  D  GF  +ESI  TLLHELAH V+  HD  FY L  +L +E   LD     
Sbjct: 64  IELRLRTPSDDGGFLPFESIMGTLLHELAHNVHGPHDRKFYALLDELRKEVEELDARGYD 123

Query: 267 --KSRGHTLSG-VRHTSHHEDDLFVGDSRSFSQKLGGN-ISDQLASARASSVAAAYRRLA 322
              S G  L G   + S    +L         ++LGG+ +S    SAR  + AAA RRL 
Sbjct: 124 GFLSSGRRLGGRGSYNSAEGRELGGNGLSGGGERLGGDSLSRSGESARELAAAAAERRLE 183

This is a predicted metallopeptidase domain called WLM (Wss1p-like metalloproteases). These are linked to the Ub-system by virtue of fusions with the UB-binding PUG (PUB), Ub-like, and Little Finger domains. More specifically, genetic evidence implicates the WLM family in de-SUMOylation. Length = 183
>gnl|CDD|198421 cd10463, PUB_WLM, PNGase/UBA or UBX (PUB) domain of the Wss1p-like metalloprotease (WLM) family Back     alignment and domain information
>gnl|CDD|198416 cd09212, PUB, PNGase/UBA or UBX (PUB) domain of p97 adaptor proteins Back     alignment and domain information
>gnl|CDD|220225 pfam09409, PUB, PUB domain Back     alignment and domain information
>gnl|CDD|198419 cd10461, PUB_UBA_plant, PNGase/UBA or UBX (PUB) domain of plant Ubiquitin-associated (UBA) domain containing proteins Back     alignment and domain information
>gnl|CDD|198418 cd10460, PUB_UBXD1, PNGase/UBA or UBX (PUB) domain of UBXD1 Back     alignment and domain information
>gnl|CDD|198420 cd10462, PUB_UBA, PNGase/UBA or UBX (PUB) domain of Ubiquitin-associated (UBA) domain containing proteins Back     alignment and domain information
>gnl|CDD|197798 smart00580, PUG, domain in protein kinases, N-glycanases and other nuclear proteins Back     alignment and domain information
>gnl|CDD|198417 cd10459, PUB_PNGase, PNGase/UBA or UBX (PUB) domain of the P97 adaptor protein Peptide:N-glycanase (PNGase) Back     alignment and domain information
>gnl|CDD|114603 pfam05887, Trypan_PARP, Procyclic acidic repetitive protein (PARP) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 664
PF08325186 WLM: WLM domain; InterPro: IPR013536 The WLM (WSS1 100.0
KOG4842278 consensus Protein involved in sister chromatid sep 99.96
PF0940987 PUB: PUB domain; InterPro: IPR018997 The PUB (also 99.73
cd0181374 UBP_N UBP ubiquitin processing protease. The UBP ( 99.72
KOG4842278 consensus Protein involved in sister chromatid sep 99.7
KOG1872473 consensus Ubiquitin-specific protease [Posttransla 99.38
cd0181271 BAG1_N Ubiquitin-like domain of BAG1. BAG1_N N-ter 99.33
smart0058058 PUG domain in protein kinases, N-glycanases and ot 98.92
cd0179173 Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also know 98.89
cd0180577 RAD23_N Ubiquitin-like domain of RAD23. RAD23 belo 98.86
cd0180972 Scythe_N Ubiquitin-like domain of Scythe protein. 98.83
cd0180774 GDX_N ubiquitin-like domain of GDX. GDX contains a 98.81
cd0180076 SF3a120_C Ubiquitin-like domain of Mammalian splic 98.81
PF0024069 ubiquitin: Ubiquitin family; InterPro: IPR000626 U 98.79
cd0180478 midnolin_N Ubiquitin-like domain of midnolin. midn 98.76
smart0021364 UBQ Ubiquitin homologues. Ubiquitin-mediated prote 98.66
cd0179280 ISG15_repeat1 ISG15 ubiquitin-like protein, first 98.61
cd0179671 DDI1_N DNA damage inducible protein 1 ubiquitin-li 98.58
cd0176969 UBL Ubiquitin-like domain of UBL. UBLs function by 98.55
cd0179374 Fubi Fubi ubiquitin-like protein. Fubi is a ubiqui 98.54
cd0180376 Ubiquitin Ubiquitin. Ubiquitin (includes Ubq/RPL40 98.53
cd0181074 ISG15_repeat2 ISG15 ubiquitin-like protein, second 98.51
cd0180676 Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn 98.5
cd0179470 DC_UbP_C dendritic cell derived ubiquitin-like pro 98.49
cd0179778 NIRF_N amino-terminal ubiquitin-like domain of Np9 98.43
PTZ0004476 ubiquitin; Provisional 98.42
TIGR00601378 rad23 UV excision repair protein Rad23. All protei 98.41
cd0179870 parkin_N amino-terminal ubiquitin-like of parkin p 98.4
cd0180871 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC 98.4
cd01802103 AN1_N ubiquitin-like domain of AN1. AN1 (also know 98.36
PF1456087 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2K 98.35
cd0179079 Herp_N Homocysteine-responsive endoplasmic reticul 98.31
cd01795107 USP48_C USP ubiquitin-specific protease. The USP ( 98.19
cd0179975 Hoil1_N Ubiquitin-like domain of HOIL1. HOIL1_N HO 98.13
KOG0010493 consensus Ubiquitin-like protein [Posttranslationa 98.07
PF01863205 DUF45: Protein of unknown function DUF45; InterPro 98.03
cd0178984 Alp11_N Ubiquitin-like domain of Alp11 tubulin-fol 97.98
cd0181575 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP. BMSC 97.87
KOG0011340 consensus Nucleotide excision repair factor NEF2, 97.64
COG1451223 Predicted metal-dependent hydrolase [General funct 97.42
cd0176387 Sumo Small ubiquitin-related modifier (SUMO). Smal 97.41
PLN02560308 enoyl-CoA reductase 97.01
PF1197672 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter 96.83
cd0180177 Tsc13_N Ubiquitin-like domain of Tsc13. Tsc13_N N- 96.71
cd0019669 UBQ Ubiquitin-like proteins. Ubiquitin homologs; I 96.69
KOG000570 consensus Ubiquitin-like protein [Cell cycle contr 96.69
smart00731146 SprT SprT homologues. Predicted to have roles in t 96.43
KOG0003128 consensus Ubiquitin/60s ribosomal protein L40 fusi 96.23
PF1154380 UN_NPL4: Nuclear pore localisation protein NPL4; I 96.17
cd01788119 ElonginB Ubiquitin-like domain of Elongin B. Elong 96.02
cd01814113 NTGP5 Ubiquitin-like NTGP5 and ATGP4. NTGP5 and AT 95.78
PF10263157 SprT-like: SprT-like family; InterPro: IPR006640 T 95.09
KOG0004156 consensus Ubiquitin/40S ribosomal protein S27a fus 95.07
KOG2699407 consensus Predicted ubiquitin regulatory protein [ 94.33
PF0881779 YukD: WXG100 protein secretion system (Wss), prote 93.87
KOG000175 consensus Ubiquitin and ubiquitin-like proteins [P 93.4
KOG3206234 consensus Alpha-tubulin folding cofactor B [Posttr 92.78
KOG4248 1143 consensus Ubiquitin-like protein, regulator of apo 92.32
PRK04351149 hypothetical protein; Provisional 90.74
smart0066681 PB1 PB1 domain. Phox and Bem1p domain, present in 90.43
PRK04860160 hypothetical protein; Provisional 89.84
KOG0006446 consensus E3 ubiquitin-protein ligase (Parkin prot 88.74
PF1147065 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: 88.39
PF13881111 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB 86.89
KOG2699 407 consensus Predicted ubiquitin regulatory protein [ 86.52
cd0639681 PB1_NBR1 The PB1 domain is an essential part of NB 86.19
cd0181180 OASL_repeat1 2'-5' oligoadenylate synthetase-like 85.74
PF0056484 PB1: PB1 domain; InterPro: IPR000270 The Phox and 85.37
cd0640782 PB1_NLP A PB1 domain is present in NIN like protei 84.54
COG3091156 SprT Zn-dependent metalloprotease, SprT family [Ge 83.91
cd0640680 PB1_P67 A PB1 domain is present in p67 proteins wh 82.72
KOG4495110 consensus RNA polymerase II transcription elongati 82.51
KOG349373 consensus Ubiquitin-like protein [Posttranslationa 81.03
cd0639782 PB1_UP1 Uncharacterized protein 1. The PB1 domain 80.47
smart0016680 UBX Domain present in ubiquitin-regulatory protein 80.35
>PF08325 WLM: WLM domain; InterPro: IPR013536 The WLM (WSS1-like metalloprotease) domain is a globular domain related to the zincin-like superfamily of Zn-dependent peptidase Back     alignment and domain information 
Probab=100.00  E-value=3.9e-46  Score=366.91  Aligned_cols=173  Identities=43%  Similarity=0.583  Sum_probs=151.5

Q ss_pred             eeeeeeccCCCCCCCCCHHHHHHHHHHHhcCcchHHHHhhcCeeeccccccCCCCCCCCCCCcccccccCCccEEEEEee
Q 006022          137 FCDFRTLQIPGVELNPPASEALKIMHMLAADPGIIAIMNKHRWRVGIMTELAPVGYVGVSPKCVLGFNKNHGEEISLRLR  216 (664)
Q Consensus       137 f~~i~~l~lp~~~~~p~~~~Al~~L~rlA~~~~v~piM~~~~w~V~~L~E~~P~~~~~~s~~~lLGlN~N~G~~I~LRLR  216 (664)
                      ++.|++|+     .+|++++|+++|+|||++  |+|||++|+|+|++|+||+|.+      ..+||+|+|+|++|+||||
T Consensus         3 v~~I~~L~-----~~p~~~~A~~lL~rlA~~--v~pIM~~~~~~V~~L~E~~P~~------~~llG~N~N~G~~I~lrLR   69 (186)
T PF08325_consen    3 VHFIKVLP-----NLPDEEEALELLERLAAD--VKPIMRKHGWRVGSLEEFYPNG------ERLLGLNVNKGEKICLRLR   69 (186)
T ss_pred             eeEEeeCC-----CCcCHHHHHHHHHHHHHH--HHHHHHHcCcccCeeeccCCCC------CCCcceecCCCcEEEEEeC
Confidence            67788873     359999999999999999  9999999999999999999996      4599999999999999999


Q ss_pred             cCCCCCccchHHHHHHHHHHhhhhccCCcchhHHHHHHHHHHHHHHhhhh------ccCCccccCCCCCCCccccccccC
Q 006022          217 TDDLKGFRKYESIKKTLLHELAHMVYSEHDANFYGLDKQLNQEAVALDWT------KSRGHTLSGVRHTSHHEDDLFVGD  290 (664)
Q Consensus       217 t~d~~~Flp~~~I~~tllHELaH~v~g~Hd~~F~~L~~~L~~E~~~l~~~------~~~g~~Lgg~~~~~~~~~~~~~~~  290 (664)
                      +++.++|+||++|+.|||||||||+|++||++||+||++|.+||++++|+      .+.|++|||.........+.....
T Consensus        70 ~~~~~~fl~~~~i~~t~lHELaH~~~~~H~~~F~~l~~~l~~e~~~l~~~G~~~gf~~~G~~l~~~~~~~~~~~~~~~~~  149 (186)
T PF08325_consen   70 TPDDGGFLPYETILGTMLHELAHNVHGPHDDKFWKLLDELRKECEELDAKGYTEGFWSSGRRLGGSSGQPSEERELRGNG  149 (186)
T ss_pred             CCCCCCEeeHHHHHHHHHHHHHhcccCCccHHHHHHHHHHHHHHHHHHhcCCccccCCCCcccCCCCcccchhhhhhccc
Confidence            97659999999999999999999999999999999999999999999996      789999998765432111122333


Q ss_pred             CCCCCccccCCCC-----CCCccHHHHHHHHHHHHHh
Q 006022          291 SRSFSQKLGGNIS-----DQLASARASSVAAAYRRLA  322 (664)
Q Consensus       291 ~~~~g~~LGG~~~-----~~~~~~Re~~a~AAerR~~  322 (664)
                      ..+++++|||++.     .++.++|+++|+||+||++
T Consensus       150 ~~~~~~~LgG~s~~~~~~~~~~~~Re~~a~AAerR~~  186 (186)
T PF08325_consen  150 LSGGGQRLGGGSSSRPRKAQPKSPREAAAAAAERRLR  186 (186)
T ss_pred             cCCCCeeCCCCCCCCCCcCCCcCHHHHHHHHHHhhcC
Confidence            4668999999975     4678999999999999974

Since the WLM domain contains all known active site residues of zincins, it is predicted to be a catalytically active peptidase domain. The WLM domain is a eukaryotic domain represented in plants, fungi, Plasmodium, and kinetoplastids. By contrast, it is absent in animals, Cryptosporidium, and Microsporidia, suggesting that it has been lost on multiple occasions during the evolution of eukaryotes. The WLM domain is found either in stand-alone form or in association with other domains such as the RanBP2 zinc finger , the ubiquitin domain, or the PUB/PUG domain. This domain could function as a specific de-SUMOylating domain of distinct protein complexes in the nucleus and the cytoplasm []. It has been suggested to form a segregated alpha/beta structure with eight helices and five strands. Proteins containign this domain include yeast WSS1 (a weak suppressor of the Ub-related protein SMT3), and various putative metalloproteases from plant and fungal species.
>KOG4842 consensus Protein involved in sister chromatid separation and/or segregation [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF09409 PUB: PUB domain; InterPro: IPR018997 The PUB (also known as PUG) domain is found in peptide N-glycanase where it functions as a AAA ATPase binding domain [] Back     alignment and domain information
>cd01813 UBP_N UBP ubiquitin processing protease Back     alignment and domain information
>KOG4842 consensus Protein involved in sister chromatid separation and/or segregation [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1872 consensus Ubiquitin-specific protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01812 BAG1_N Ubiquitin-like domain of BAG1 Back     alignment and domain information
>smart00580 PUG domain in protein kinases, N-glycanases and other nuclear proteins Back     alignment and domain information
>cd01791 Ubl5 UBL5 ubiquitin-like modifier Back     alignment and domain information
>cd01805 RAD23_N Ubiquitin-like domain of RAD23 Back     alignment and domain information
>cd01809 Scythe_N Ubiquitin-like domain of Scythe protein Back     alignment and domain information
>cd01807 GDX_N ubiquitin-like domain of GDX Back     alignment and domain information
>cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120 Back     alignment and domain information
>PF00240 ubiquitin: Ubiquitin family; InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade Back     alignment and domain information
>cd01804 midnolin_N Ubiquitin-like domain of midnolin Back     alignment and domain information
>smart00213 UBQ Ubiquitin homologues Back     alignment and domain information
>cd01792 ISG15_repeat1 ISG15 ubiquitin-like protein, first repeat of 2 Back     alignment and domain information
>cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain Back     alignment and domain information
>cd01769 UBL Ubiquitin-like domain of UBL Back     alignment and domain information
>cd01793 Fubi Fubi ubiquitin-like protein Back     alignment and domain information
>cd01803 Ubiquitin Ubiquitin Back     alignment and domain information
>cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2 Back     alignment and domain information
>cd01806 Nedd8 Nebb8-like ubiquitin protein Back     alignment and domain information
>cd01794 DC_UbP_C dendritic cell derived ubiquitin-like protein Back     alignment and domain information
>cd01797 NIRF_N amino-terminal ubiquitin-like domain of Np95 and NIRF Back     alignment and domain information
>PTZ00044 ubiquitin; Provisional Back     alignment and domain information
>TIGR00601 rad23 UV excision repair protein Rad23 Back     alignment and domain information
>cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein Back     alignment and domain information
>cd01808 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC2 Back     alignment and domain information
>cd01802 AN1_N ubiquitin-like domain of AN1 Back     alignment and domain information
>PF14560 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2KJ6_A 2KJR_A 1V6E_A 1T0Y_A Back     alignment and domain information
>cd01790 Herp_N Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain protein Back     alignment and domain information
>cd01795 USP48_C USP ubiquitin-specific protease Back     alignment and domain information
>cd01799 Hoil1_N Ubiquitin-like domain of HOIL1 Back     alignment and domain information
>KOG0010 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>PF01863 DUF45: Protein of unknown function DUF45; InterPro: IPR002725 Members of this family are found in some archaebacteria, as well as Helicobacter pylori Back     alignment and domain information
>cd01789 Alp11_N Ubiquitin-like domain of Alp11 tubulin-folding cofactor B Back     alignment and domain information
>cd01815 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP Back     alignment and domain information
>KOG0011 consensus Nucleotide excision repair factor NEF2, RAD23 component [Replication, recombination and repair] Back     alignment and domain information
>COG1451 Predicted metal-dependent hydrolase [General function prediction only] Back     alignment and domain information
>cd01763 Sumo Small ubiquitin-related modifier (SUMO) Back     alignment and domain information
>PLN02560 enoyl-CoA reductase Back     alignment and domain information
>PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins Back     alignment and domain information
>cd01801 Tsc13_N Ubiquitin-like domain of Tsc13 Back     alignment and domain information
>cd00196 UBQ Ubiquitin-like proteins Back     alignment and domain information
>KOG0005 consensus Ubiquitin-like protein [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00731 SprT SprT homologues Back     alignment and domain information
>KOG0003 consensus Ubiquitin/60s ribosomal protein L40 fusion [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF11543 UN_NPL4: Nuclear pore localisation protein NPL4; InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway Back     alignment and domain information
>cd01788 ElonginB Ubiquitin-like domain of Elongin B Back     alignment and domain information
>cd01814 NTGP5 Ubiquitin-like NTGP5 and ATGP4 Back     alignment and domain information
>PF10263 SprT-like: SprT-like family; InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT) Back     alignment and domain information
>KOG0004 consensus Ubiquitin/40S ribosomal protein S27a fusion [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2699 consensus Predicted ubiquitin regulatory protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08817 YukD: WXG100 protein secretion system (Wss), protein YukD; InterPro: IPR014921 YukD is a bacterial protein that adopts a ubiquitin-like fold [] Back     alignment and domain information
>KOG0001 consensus Ubiquitin and ubiquitin-like proteins [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>KOG3206 consensus Alpha-tubulin folding cofactor B [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4248 consensus Ubiquitin-like protein, regulator of apoptosis [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04351 hypothetical protein; Provisional Back     alignment and domain information
>smart00666 PB1 PB1 domain Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>KOG0006 consensus E3 ubiquitin-protein ligase (Parkin protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11470 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: IPR021569 TUG is a GLUT4 regulating protein and functions to retain membrane vesicles containing GLUT4 intracellularly Back     alignment and domain information
>PF13881 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB: 1SE9_A 1WGH_A 2GOW_A Back     alignment and domain information
>KOG2699 consensus Predicted ubiquitin regulatory protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06396 PB1_NBR1 The PB1 domain is an essential part of NBR1 protein, next to BRCA1, a scaffold protein mediating specific protein-protein interaction with both titin protein kinase and with another scaffold protein p62 Back     alignment and domain information
>cd01811 OASL_repeat1 2'-5' oligoadenylate synthetase-like protein, repeat 1 of 2 Back     alignment and domain information
>PF00564 PB1: PB1 domain; InterPro: IPR000270 The Phox and Bem1p domain, is present in many eukaryotic cytoplasmic signalling proteins Back     alignment and domain information
>cd06407 PB1_NLP A PB1 domain is present in NIN like proteins (NLP), a key enzyme in a process of establishment of symbiosis betweeen legumes and nitrogen fixing bacteria (Rhizobium) Back     alignment and domain information
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only] Back     alignment and domain information
>cd06406 PB1_P67 A PB1 domain is present in p67 proteins which forms a signaling complex with p40, a crucial step for activation of NADPH oxidase during phagocytosis Back     alignment and domain information
>KOG4495 consensus RNA polymerase II transcription elongation factor Elongin/SIII, subunit elongin B [Transcription] Back     alignment and domain information
>KOG3493 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06397 PB1_UP1 Uncharacterized protein 1 Back     alignment and domain information
>smart00166 UBX Domain present in ubiquitin-regulatory proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query664
2ccq_A99 P97, peptide N-glycanase homolog; glycoprotein; 1. 3e-17
2d5u_A124 N-glycanase 1; pngase, hydrolase; NMR {Mus musculu 2e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
1v5t_A90 8430435I17RIK protein; hypothetical protein, ubiqu 5e-07
1v86_A95 DNA segment, CHR 7, wayne state university 128, ex 9e-06
2kd0_A85 LRR repeats and ubiquitin-like domain-containing p 3e-05
3shq_A320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 4e-05
1wgg_A96 Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti 4e-04
>2ccq_A P97, peptide N-glycanase homolog; glycoprotein; 1.6A {Homo sapiens} SCOP: d.314.1.1 PDB: 2hpl_A 2hpj_A 2cm0_A Length = 99 Back     alignment and structure
 Score = 76.5 bits (188), Expect = 3e-17
 Identities = 21/105 (20%), Positives = 42/105 (40%), Gaps = 11/105 (10%)

Query: 557 LQKAIEMLRAEVSPLESTTVLQTLCKIIRNVIEHPDETKYKRLRKANPIIQRSVANYKAA 616
              A+  L  + +P       + L     N++ +P++ KY+ +R  N      +   + A
Sbjct: 3   ASPAVAELC-QNTPETFLEASKLLLTYADNILRNPNDEKYRSIRIGNTAFSTRLLPVRGA 61

Query: 617 MEILFLVGFNEDVVLDEIGKAETYLVLKRN-DLALLWLAKSSLET 660
           +E LF +GF E          ET+L+  +   +  L   +  +  
Sbjct: 62  VECLFEMGFEEG---------ETHLIFPKKASVEQLQKIRDLIAI 97
>2d5u_A N-glycanase 1; pngase, hydrolase; NMR {Mus musculus} SCOP: d.314.1.1 Length = 124 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A Length = 90 Back     alignment and structure
>1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 Length = 95 Back     alignment and structure
>2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} Length = 85 Back     alignment and structure
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Length = 320 Back     alignment and structure
>1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Length = 96 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query664
2d5u_A124 N-glycanase 1; pngase, hydrolase; NMR {Mus musculu 99.81
2ccq_A99 P97, peptide N-glycanase homolog; glycoprotein; 1. 99.81
3shq_A320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 99.6
1v5t_A90 8430435I17RIK protein; hypothetical protein, ubiqu 99.53
1wgg_A96 Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti 99.5
1v86_A95 DNA segment, CHR 7, wayne state university 128, ex 99.45
1wxv_A92 BAG-family molecular chaperone regulator-1; struct 99.36
2dzm_A100 FAS-associated factor 1; ubiquitin-like domain, HF 99.31
2kd0_A85 LRR repeats and ubiquitin-like domain-containing p 99.27
2bwf_A77 Ubiquitin-like protein DSK2; signaling protein, UB 99.19
3m63_B101 Ubiquitin domain-containing protein DSK2; armadill 99.12
2lxa_A87 Ubiquitin-like protein MDY2; ubiquitin-like domain 99.11
2hj8_A88 Interferon-induced 17 kDa protein; HR2873B, human 99.09
3phx_B79 Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu 99.09
4eew_A88 Large proline-rich protein BAG6; ubiquitin-like fo 99.07
4a20_A98 Ubiquitin-like protein MDY2; protein binding, GET- 99.05
3m62_B106 UV excision repair protein RAD23; armadillo-like r 99.05
2dzi_A81 Ubiquitin-like protein 4A; GDX, structural genomic 99.05
3v6c_B91 Ubiquitin; structural genomics, structural genomic 99.04
2kk8_A84 Uncharacterized protein AT4G05270; solution arabid 99.02
2wyq_A85 HHR23A, UV excision repair protein RAD23 homolog A 99.01
4hcn_B98 Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidas 99.0
4fbj_B88 NEDD8; effector-HOST target complex, glutamine dea 99.0
2klc_A101 Ubiquilin-1; ubiquitin-like, structural genomics, 99.0
1yqb_A100 Ubiquilin 3; structural genomics consortium, ubiqu 99.0
1wx8_A96 Riken cDNA 4931431F19; ubiquitin-like domain, ubiq 98.99
3dbh_I88 NEDD8; cell cycle, activating enzyme, apoptosis, m 98.98
3mtn_B85 UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit 98.98
1uel_A95 HHR23B, UV excision repair protein RAD23 homolog B 98.97
1ndd_A76 NEDD8, protein (ubiquitin-like protein NEDD8); pro 98.96
4dwf_A90 HLA-B-associated transcript 3; ubiquitin-like doma 98.96
2kan_A94 Uncharacterized protein AR3433A; ubiquitin fold, a 98.95
3n3k_B85 Ubiquitin; hydrolase, protease, thiol protease, DU 98.95
1v5o_A102 1700011N24RIK protein; hypothetical protein, ubiqu 98.94
1ttn_A106 DC-UBP, dendritic cell-derived ubiquitin-like prot 98.94
3a9j_A76 Ubiquitin; protein complex, cytoplasm, isopeptide 98.93
1wh3_A87 59 kDa 2'-5'-oligoadenylate synthetase like protei 98.92
2l7r_A93 Ubiquitin-like protein FUBI; structural genomics, 98.92
1j8c_A125 Ubiquitin-like protein hplic-2; ubiquitin-like dom 98.92
1wgd_A93 Homocysteine-responsive endoplasmic reticulum- res 98.89
1wx7_A106 Ubiquilin 3; ubiquitin-like domain, structural gen 98.89
3k9o_B96 Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b 98.89
3vdz_A111 Ubiquitin-40S ribosomal protein S27A; gadolinium, 98.88
1wy8_A89 NP95-like ring finger protein, isoform A; ubiquiti 98.88
1yx5_B98 Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s 98.86
2faz_A78 Ubiquitin-like containing PHD and ring finger DOM 98.84
1sif_A88 Ubiquitin; hydrophobic mutants, folding, stability 98.84
1v6e_A95 Cytoskeleton-associated protein 1; tubulin-specifi 98.83
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 98.83
1t0y_A122 Tubulin folding cofactor B; ubiquitin-like, cytosk 98.82
1we6_A111 Splicing factor, putative; structural genomics, ub 98.81
1wju_A100 NEDD8 ultimate buster-1; ubiquitin-like domain, st 98.8
2ojr_A111 Ubiquitin; lanthide-binding TAG, terbium, TB, SAD 98.8
1x1m_A107 Ubiquitin-like protein SB132; structural genomics, 98.8
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 98.78
1uh6_A100 Ubiquitin-like 5; beta-grAsp fold, structural geno 98.78
3plu_A93 Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- 98.76
3b1l_X76 E3 ubiquitin-protein ligase parkin; proteasome, AL 98.2
1we7_A115 SF3A1 protein; structural genomics, ubiquitin-like 98.71
2kjr_A95 CG11242; UBL, ubiquitin, ubiquitin-like, structura 98.71
2kj6_A97 Tubulin folding cofactor B; methods development, N 98.69
2kdi_A114 Ubiquitin, vacuolar protein sorting-associated pro 98.68
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 98.64
3q3f_A189 Ribonuclease/ubiquitin chimeric protein; domain SW 98.6
1wia_A95 Hypothetical ubiquitin-like protein (riken cDNA 20 98.59
4b6w_A86 Tubulin-specific chaperone; CAP-Gly, ubiquitin-lik 98.59
2kzr_A86 Ubiquitin thioesterase OTU1; structural genomics, 98.59
3l0w_B169 Monoubiquitinated proliferating cell nuclear antig 98.57
3u5e_m128 60S ribosomal protein L40; translation, ribosome, 98.55
1oqy_A368 HHR23A, UV excision repair protein RAD23 homolog A 98.55
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 98.54
2daf_A118 FLJ35834 protein; hypothetical protein FLJ35834, u 98.53
2uyz_B79 Small ubiquitin-related modifier 1; sumoylation, c 98.53
1v2y_A105 3300001G02RIK protein; hypothetical protein, ubiqu 98.52
2kdb_A99 Homocysteine-responsive endoplasmic reticulum- res 98.51
2fnj_B118 Transcription elongation factor B polypeptide 2; b 98.51
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 98.5
3ai5_A307 Yeast enhanced green fluorescent protein, ubiquit; 98.48
1wyw_B97 Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho 98.43
4ajy_B118 Transcription elongation factor B polypeptide 2; E 98.42
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 98.41
3u5c_f152 40S ribosomal protein S31; translation, ribosome, 98.41
1wjn_A97 Tubulin-folding protein TBCE; ubiquitin-like domai 98.35
2dzj_A88 Synaptic glycoprotein SC2; ubiquitin-like fold, st 98.31
2gow_A125 HCG-1 protein, ubiquitin-like protein 3; BC059385, 98.25
1wgh_A116 Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fo 98.25
4dbg_A105 Ranbp-type and C3HC4-type zinc finger-containing; 98.22
1wf9_A107 NPL4 family protein; beta-grAsp fold like domain, 98.13
1se9_A126 Ubiquitin family; ubiquitin-like, cell-free, wheat 97.78
2xzm_9189 RPS31E; ribosome, translation; 3.93A {Tetrahymena 97.4
2pjh_A80 Protein NPL4, nuclear protein localization protein 97.26
4efo_A94 Serine/threonine-protein kinase TBK1; ubiquitin li 97.17
3a4r_A79 Nfatc2-interacting protein; ubiquitin fold, coiled 96.9
2io1_B94 Small ubiquitin-related modifier 3 precursor; SUMO 96.84
1wm3_A72 Ubiquitin-like protein SMT3B; ubiquitin fold, half 96.73
2io0_B91 Small ubiquitin-related modifier 2 precursor; SUMO 96.63
1wz0_A104 Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-li 96.3
2k8h_A110 Small ubiquitin protein; SUMO, post-translational 96.3
2eke_C106 Ubiquitin-like protein SMT3; UBC9, SUMO binding mo 96.2
2d07_B93 Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Ho 96.06
3pge_A200 SUMO-modified proliferating cell nuclear antigen; 93.21
3kyd_D115 Small ubiquitin-related modifier 1; SUMO, thioeste 92.37
3tix_A207 Ubiquitin-like protein SMT3, RNA-induced transcri 91.88
2bps_A81 YUKD protein; ubiquitin-like protein, ubiquitin; 2 88.94
3qx1_A84 FAS-associated factor 1; UBX, protein binding, P97 87.31
1oey_A83 P67-PHOX, neutrophil cytosol factor 2; immune syst 86.71
2jxx_A97 Nfatc2-interacting protein; nuclear factor of acti 84.5
1vd2_A89 Protein kinase C, IOTA type; PB1 domain, OPCA moti 81.48
4a3p_A217 Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {H 80.86
2al3_A90 TUG long isoform; TUG UBL1 insulin, endocytosis/ex 80.84
>2d5u_A N-glycanase 1; pngase, hydrolase; NMR {Mus musculus} SCOP: d.314.1.1 Back     alignment and structure
Probab=99.81  E-value=3e-20  Score=171.48  Aligned_cols=96  Identities=22%  Similarity=0.344  Sum_probs=85.8

Q ss_pred             HHHHHHHHHHHhcCChhHHHHHHHHHHHHHHHHhcCCCccccchhcccChhHHHhhcChhhHHHHHHHcCCccccccccc
Q 006022          555 SRLQKAIEMLRAEVSPLESTTVLQTLCKIIRNVIEHPDETKYKRLRKANPIIQRSVANYKAAMEILFLVGFNEDVVLDEI  634 (664)
Q Consensus       555 ~~L~~ai~~i~~~n~~~~~~~al~tL~Kil~NIi~~P~e~KyRrIR~sN~~F~~kV~~~~Ga~e~L~a~GF~e~~~~d~~  634 (664)
                      +.|++|+..|+. |..+++.+|++||.|||.||+.||+|+|||+||++|++|+++|++++||++||.++||++..     
T Consensus        16 ~~l~~~l~~L~~-n~~~~~~~a~~tL~kil~NIl~~P~e~KyRkIRl~N~~f~~~V~~~~Ga~e~L~a~GF~~~~-----   89 (124)
T 2d5u_A           16 SSASPAVAELCQ-NTPETFLEASKLLLTYADNILRNPSDEKYRSIRIGNTAFSTRLLPVRGAVECLFEMGFEEGE-----   89 (124)
T ss_dssp             SSCCHHHHHHHT-TCHHHHHHHHHHHHHHHHHHHHSSSCGGGSEEECCCHHHHHTTSSSTTHHHHHHHHTCBCCS-----
T ss_pred             HHHHHHHHHHHh-CcHHHHHHHHHHHHHHHHHHHcCCCcccceeeecCCHHHHHHhcCCccHHHHHHHcccccCC-----
Confidence            467889999975 56789999999999999999999999999999999999999999999999999999998883     


Q ss_pred             CCcceEEEEcCC-CHHHHHHHHhhhhh
Q 006022          635 GKAETYLVLKRN-DLALLWLAKSSLET  660 (664)
Q Consensus       635 ~~~e~~LVl~~~-d~~~L~~ak~~Le~  660 (664)
                          ++||||.+ +...|..++..|-.
T Consensus        90 ----~~lvlp~~~~~~~l~~~~d~L~~  112 (124)
T 2d5u_A           90 ----THLIFPKKASVEQLQKIRDLIAI  112 (124)
T ss_dssp             ----SEEECCTTSCHHHHHHHHHHHHH
T ss_pred             ----CeeecCCCCCHHHHHHHHHHHHH
Confidence                45999987 88888888777654
>2ccq_A P97, peptide N-glycanase homolog; glycoprotein; 1.6A {Homo sapiens} SCOP: d.314.1.1 PDB: 2hpl_A 2hpj_A 2cm0_A Back     alignment and structure
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Back     alignment and structure
>1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A Back     alignment and structure
>1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1wxv_A BAG-family molecular chaperone regulator-1; structural genomics, apoptosis, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2dzm_A FAS-associated factor 1; ubiquitin-like domain, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Back     alignment and structure
>3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2lxa_A Ubiquitin-like protein MDY2; ubiquitin-like domain, protein-protein interaction, SGT2 BIN domain, GET pathway, protein binding; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} Back     alignment and structure
>3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} Back     alignment and structure
>4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} Back     alignment and structure
>4a20_A Ubiquitin-like protein MDY2; protein binding, GET-pathway, tail-anchored proteins; 1.78A {Saccharomyces cerevisiae} PDB: 2lxc_A 4goc_A Back     alignment and structure
>3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B Back     alignment and structure
>2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A Back     alignment and structure
>4hcn_B Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidase, NEDD8, protein binding; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B Back     alignment and structure
>2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I Back     alignment and structure
>3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Back     alignment and structure
>4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A Back     alignment and structure
>2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... Back     alignment and structure
>1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A Back     alignment and structure
>3vdz_A Ubiquitin-40S ribosomal protein S27A; gadolinium, MRI contrast agent, peptide-based contrast agent lanthanide binding TAG; 2.40A {Synthetic construct} PDB: 2ojr_A Back     alignment and structure
>1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B Back     alignment and structure
>2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1v6e_A Cytoskeleton-associated protein 1; tubulin-specific chaperone B, tubulin folding cofactor B, microtubule, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>1t0y_A Tubulin folding cofactor B; ubiquitin-like, cytoskeleton, microtubule, CESG, structural genomics, protein structure initiative, PSI; NMR {Caenorhabditis elegans} SCOP: d.15.1.1 Back     alignment and structure
>1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>1wju_A NEDD8 ultimate buster-1; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>1x1m_A Ubiquitin-like protein SB132; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A Back     alignment and structure
>3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A Back     alignment and structure
>1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A Back     alignment and structure
>2kjr_A CG11242; UBL, ubiquitin, ubiquitin-like, structural genomics, PSI-2, protein structure initiative; NMR {Drosophila melanogaster} Back     alignment and structure
>2kj6_A Tubulin folding cofactor B; methods development, NESG, solution PSI-2, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} Back     alignment and structure
>1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>4b6w_A Tubulin-specific chaperone; CAP-Gly, ubiquitin-like; HET: MSE; 2.35A {Trypanosoma brucei brucei strain 927} Back     alignment and structure
>2kzr_A Ubiquitin thioesterase OTU1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, hydrolase; NMR {Mus musculus} Back     alignment and structure
>3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B Back     alignment and structure
>3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4b6a_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p Back     alignment and structure
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>2daf_A FLJ35834 protein; hypothetical protein FLJ35834, ubiquitin-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B Back     alignment and structure
>1v2y_A 3300001G02RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>2fnj_B Transcription elongation factor B polypeptide 2; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.15.1.1 PDB: 1lm8_B 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>3ai5_A Yeast enhanced green fluorescent protein, ubiquit; ubiquitin, fusion protein, fluore protein, transcription; HET: CR2; 1.40A {Aequorea victoria} PDB: 3ako_B* Back     alignment and structure
>1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C Back     alignment and structure
>4ajy_B Transcription elongation factor B polypeptide 2; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A 3ztc_A* 3ztd_A* 3zun_A* 1lm8_B 4b95_A* 2fnj_B 4b9k_A* 4awj_A* Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>3u5c_f 40S ribosomal protein S31; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_f Back     alignment and structure
>1wjn_A Tubulin-folding protein TBCE; ubiquitin-like domain, progressive motor neuropathy, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2dzj_A Synaptic glycoprotein SC2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2gow_A HCG-1 protein, ubiquitin-like protein 3; BC059385, structural genomics, protein structure initiative, PSI; NMR {Homo sapiens} Back     alignment and structure
>1wgh_A Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>4dbg_A Ranbp-type and C3HC4-type zinc finger-containing; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} PDB: 2lgy_A Back     alignment and structure
>1wf9_A NPL4 family protein; beta-grAsp fold like domain, hypothetical protein, structural genomics, NPPSFA; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>1se9_A Ubiquitin family; ubiquitin-like, cell-free, wheat GERM, structural genomics, protein structure initiative, CESG; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>2xzm_9 RPS31E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_9 Back     alignment and structure
>2pjh_A Protein NPL4, nuclear protein localization protein 4 homolog; UFD1, NPL4, AAA, protein binding, transport protein; NMR {Mus musculus} Back     alignment and structure
>4efo_A Serine/threonine-protein kinase TBK1; ubiquitin like domain, transferase; 1.77A {Homo sapiens} Back     alignment and structure
>3a4r_A Nfatc2-interacting protein; ubiquitin fold, coiled coil, cytoplasm, methylation, nucleus, transcription; 1.00A {Mus musculus} PDB: 3a4s_C 3rd2_A Back     alignment and structure
>2io1_B Small ubiquitin-related modifier 3 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wm3_A Ubiquitin-like protein SMT3B; ubiquitin fold, half-open barrel, two helices, protein transport; 1.20A {Homo sapiens} SCOP: d.15.1.1 PDB: 1wm2_A 3uin_B 3uio_B 2ckh_B Back     alignment and structure
>2io0_B Small ubiquitin-related modifier 2 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.30A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wz0_A Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-like molecule, structural genomics, sentrin2, NPPFSA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2k8h_A Small ubiquitin protein; SUMO, post-translational modifier, signaling protein; NMR {Trypanosoma brucei} Back     alignment and structure
>2eke_C Ubiquitin-like protein SMT3; UBC9, SUMO binding motif, SBM, ligase/protein binding complex; 1.90A {Saccharomyces cerevisiae} SCOP: d.15.1.1 Back     alignment and structure
>2d07_B Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 2rpq_A 2awt_A 2io3_B 2iyd_B 1u4a_A 2k1f_A Back     alignment and structure
>3pge_A SUMO-modified proliferating cell nuclear antigen; DNA replication, DNA binding protein; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3kyd_D Small ubiquitin-related modifier 1; SUMO, thioester, adenylation, inhibitor, TETR intermediate, ligase, nucleus, phosphoprotein; HET: VMX; 2.61A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3tix_A Ubiquitin-like protein SMT3, RNA-induced transcri silencing complex protein TAS3; PIN, rossmann fold, SPOC, alpha-helical hairpin, heterochrom silencing, RITS, RNAI, argonaute; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2bps_A YUKD protein; ubiquitin-like protein, ubiquitin; 2.7A {Bacillus subtilis} Back     alignment and structure
>3qx1_A FAS-associated factor 1; UBX, protein binding, P97 binding; 1.60A {Homo sapiens} PDB: 3qwz_B* 3qc8_B 3qca_A 3qq8_B 3r3m_B 1h8c_A Back     alignment and structure
>1oey_A P67-PHOX, neutrophil cytosol factor 2; immune system, PB1 heterodimer/complex, NADPH oxidase, PB1 D heterodimerization; 2.0A {Homo sapiens} SCOP: d.15.2.2 Back     alignment and structure
>2jxx_A Nfatc2-interacting protein; nuclear factor of activated T-cells, cytoplasmic 2- interacting protein, ubiquitin like homologue; NMR {Homo sapiens} Back     alignment and structure
>1vd2_A Protein kinase C, IOTA type; PB1 domain, OPCA motif, APKC, ZIP/P62, MEK5, molecular recognition, transferase; NMR {Homo sapiens} SCOP: d.15.2.2 PDB: 1wmh_A Back     alignment and structure
>4a3p_A Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {Homo sapiens} PDB: 4a3o_A 3pv1_A 3ppa_A* 3t9l_A 3lmn_A Back     alignment and structure
>2al3_A TUG long isoform; TUG UBL1 insulin, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 664
d2ccqa199 d.314.1.1 (A:11-109) N-glycanase 1, N-terminal dom 2e-16
d1v86a_95 d.15.1.1 (A:) hypothetical D7wsu128e protein {Mous 4e-04
>d2ccqa1 d.314.1.1 (A:11-109) N-glycanase 1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: PUG domain-like
superfamily: PUG domain-like
family: PUG domain
domain: N-glycanase 1, N-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 73.3 bits (180), Expect = 2e-16
 Identities = 18/87 (20%), Positives = 36/87 (41%), Gaps = 10/87 (11%)

Query: 575 TVLQTLCKIIRNVIEHPDETKYKRLRKANPIIQRSVANYKAAMEILFLVGFNEDVVLDEI 634
              + L     N++ +P++ KY+ +R  N      +   + A+E LF +GF E       
Sbjct: 20  EASKLLLTYADNILRNPNDEKYRSIRIGNTAFSTRLLPVRGAVECLFEMGFEEG------ 73

Query: 635 GKAETYLVLKRN-DLALLWLAKSSLET 660
              ET+L+  +   +  L   +  +  
Sbjct: 74  ---ETHLIFPKKASVEQLQKIRDLIAI 97
>d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query664
d2ccqa199 N-glycanase 1, N-terminal domain {Human (Homo sapi 99.77
d1v5ta_90 8430435i17rik protein {Mouse (Mus musculus) [TaxId 99.59
d1v86a_95 hypothetical D7wsu128e protein {Mouse (Mus musculu 99.52
d1wgga_96 Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (M 99.51
d1wxva181 Bag-family molecular chaperone regulator-1 {Human 99.48
d2bwfa173 DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.33
d1wx8a183 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] 99.25
d1yqba184 Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} 99.16
d1j8ca_103 Ubiquitin-like N-terminal domain of PLIC-2 {Human 99.15
d1z2ma176 Interferon-induced 15 kDa protein {Human (Homo sap 99.13
d1m94a_73 Ubiquitin-like modifier protein hub1 {Baker's yeas 99.07
d1z2ma276 Interferon-induced 15 kDa protein {Human (Homo sap 98.99
d1oqya477 Ubiquitin-like domain of Rad23 homolog A (Hhr23a) 98.97
d1ogwa_76 Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} 98.96
d1bt0a_73 Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxI 98.93
d1uh6a_100 Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu 98.91
d1wh3a_87 2'-5'-oligoadenylate synthetase-like protein, OASL 98.91
d1ttna180 Dendritic cell-derived ubiquitin-like protein {Hum 98.91
d2zeqa178 Ubiquitin-like domain of parkin {Mouse (Mus muscul 98.87
d1wx9a173 Large proline-rich protein BAT3 {Human (Homo sapie 98.83
d1zkha186 Splicing factor 3 subunit 1, C-terminal domain {Hu 98.82
d1t0ya_90 Ubiquitin-like domain of tubulin folding cofactor 98.81
d1v5oa_102 1700011n24rik protein {Mouse (Mus musculus) [TaxId 98.79
d1uela_95 Ubiquitin-like domain of Rad23 homolog B (Hhr23B) 98.77
d1wjua_100 NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens 98.74
d1we6a_111 Splicing factor 3 subunit 1, C-terminal domain {Th 98.71
d1v2ya_105 Ubiquitin-like protein 3300001g02rik {Mouse (Mus m 98.69
d1wiaa_95 Ubiquitin-like protein bab25500 (2010008E23Rik) {M 98.63
d1wy8a176 Ubiquitin-like PHD and RING finger domain-containi 98.62
d2faza176 Ubiquitin-like PHD and RING finger domain-containi 98.59
d1v6ea_95 Ubiquitin-like domain of tubulin folding cofactor 98.57
d1wjna_97 Tubulin-folding protein TbcE {Mouse (Mus musculus) 98.46
d1wgha_116 Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculu 98.41
d2c9wb1103 Elongin B {Human (Homo sapiens) [TaxId: 9606]} 98.34
d1wgda_93 Homocysteine-responsive endoplasmic reticulum-resi 98.15
d1se9a_101 Hypothetical protein At3g01050 {Thale cress (Arabi 98.03
d1euvb_79 SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomy 97.98
d1x1ma194 Ubiquitin-like protein 7 {Mouse (Mus musculus) [Ta 97.25
d2uyzb177 SUMO-1 (smt3 homologue) {Human (Homo sapiens) [Tax 96.91
d1wf9a194 NPL4-like protein 1 {Thale cress (Arabidopsis thal 96.14
d1wm3a_72 SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} 92.5
d2bkfa185 Next to BRCA1 gene 1 protein, NBR1 (KIAA0049) {Hum 84.89
d1ip9a_85 Bud emergence mediator Bemp1 {Baker's yeast (Sacch 80.55
>d2ccqa1 d.314.1.1 (A:11-109) N-glycanase 1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: PUG domain-like
superfamily: PUG domain-like
family: PUG domain
domain: N-glycanase 1, N-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.77  E-value=2.3e-19  Score=157.60  Aligned_cols=84  Identities=23%  Similarity=0.409  Sum_probs=76.1

Q ss_pred             cCChhHHHHHHHHHHHHHHHHhcCCCccccchhcccChhHHHhhcChhhHHHHHHHcCCcccccccccCCcceEEEEcCC
Q 006022          567 EVSPLESTTVLQTLCKIIRNVIEHPDETKYKRLRKANPIIQRSVANYKAAMEILFLVGFNEDVVLDEIGKAETYLVLKRN  646 (664)
Q Consensus       567 ~n~~~~~~~al~tL~Kil~NIi~~P~e~KyRrIR~sN~~F~~kV~~~~Ga~e~L~a~GF~e~~~~d~~~~~e~~LVl~~~  646 (664)
                      .|+++...+|++||.||+.||+.||+|+|||+||++|++|+++|++++||++||.++||++.         ++||+||.+
T Consensus        12 ~n~~~~~~~~l~~L~ki~~NIl~~P~e~KyR~Ir~sN~~f~~~v~~~~ga~e~L~~~GF~e~---------~~~lvlp~~   82 (99)
T d2ccqa1          12 QNTPETFLEASKLLLTYADNILRNPNDEKYRSIRIGNTAFSTRLLPVRGAVECLFEMGFEEG---------ETHLIFPKK   82 (99)
T ss_dssp             SSCHHHHHHHHHHHHHHHHHHHHCTTCGGGGEEETTCHHHHHHTTTSTTHHHHHHHHTCEEC---------SSEEECCTT
T ss_pred             hCCHHHHHHHHHHHHHHHHHHHcCCCCcceeeeecCCHHHHHHHcccccHHHHHHHcCceeC---------CceEEecCC
Confidence            56788999999999999999999999999999999999999999999999999999999865         579999987


Q ss_pred             -CHHHHHHHHhhhh
Q 006022          647 -DLALLWLAKSSLE  659 (664)
Q Consensus       647 -d~~~L~~ak~~Le  659 (664)
                       +.+.+...+..|.
T Consensus        83 ~~~~~l~~~rd~L~   96 (99)
T d2ccqa1          83 ASVEQLQKIRDLIA   96 (99)
T ss_dssp             SCHHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHH
Confidence             7777777776654
>d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we6a_ d.15.1.1 (A:) Splicing factor 3 subunit 1, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} Back     information, alignment and structure
>d1x1ma1 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf9a1 d.15.1.1 (A:8-101) NPL4-like protein 1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wm3a_ d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bkfa1 d.15.2.2 (A:1-85) Next to BRCA1 gene 1 protein, NBR1 (KIAA0049) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ip9a_ d.15.2.2 (A:) Bud emergence mediator Bemp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure