Citrus Sinensis ID: 006054

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660---
MSSSLSGSDNQNAETRRAGRLSVREKNFELMDSLYKAAVEGHTDQFRAHATMLDQILTPNENTILHIHITARPNQTMKSNNKLKSSLWRMMSTFKKQSSSSEHFGRDILEMCPGLLLKTNTKGETLLHIAARHGHADVVKDLIAECKKPHQNDPEKGVEAVRLMQGMTNEAKDTALHEAARYNQIDVVKMLTKEDPSLPYDANNAGETPLYVAAERGYKDVTQDILLTCKSPADHGPMGRTALHAAAFRNDTEMTKVLLDSSIGTQTSKADQQGWLPLHLAAHLGYYNVVKELLKADKSAAYKADNEGKIPLHLAAGKGRLNTVQELIMSCPSSCELVDDRGWNVFHFALQSGSRRTIELLLKSPSLGNLVNEKNDDGNTPLLEHAGSGSLIPSFVCHPKVDRLAFNQNNCSAEDIIRSDKLLFRPNEKNFMWCLNRLNRFRCRRHIVFGNGERKEQFSNTSIEDKKNNYRKEKSSSIHEELTQYVNKGKESQLVVAALIATVTFTAGITMPGGYINEIGPDQGAAVLTKSSSFQAFVIFNSVAMILSTIAVFIHLKLSLLGDKVFEFNLWKISRGMTKLALFFMVFAFLTGTYSVLPSAKILAVIVSIITGGSILYIYAYDYAALFSLIKAVMRFHVNRLQEIRKEFQLIYFLYLNDFVRAC
cccccccccHHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHcccccEEEEEcccccHHHHHcccccccccHHHHHHHHHHHHcHHHHHccccccccHHHHHHHHccHHHHHHHHHcccccccccccccHHHHHHHHHccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHcccHHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHccccccccccccccccccHHHHHHHcccHHHHHHHcccccccccccccccHHHHHHHcccccccccHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHcccEEEEHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcc
cHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccHHHHHHccccHHHHHHHccccccccccccccHHHHHHHHcHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccccHHHHHHHcccHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccHccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccEccccccHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
mssslsgsdnqnaetrragrlsVREKNFELMDSLYKAAVEGHTDQFRAHATMLDqiltpnentILHIHItarpnqtmksnNKLKSSLWRMMSTfkkqssssehfGRDILEMcpglllktntkgeTLLHIAARHGHADVVKDLIAEckkphqndpekGVEAVRLMQGMTNEAKDTALHEAARYNQIDVVKMLtkedpslpydannagetpLYVAAERGYKDVTQDILLtckspadhgpmgrtALHAAAFRNDTEMTKVLLDssigtqtskadqqgwlplHLAAHLGYYNVVKELLKADKSaaykadnegkiplhlaagkgrLNTVQELIMScpsscelvddrgwNVFHFALQSGSRRTIELLLkspslgnlvneknddgntpllehagsgslipsfvchpkvdrlafnqnncsaediirsdkllfrpneknFMWCLNRLnrfrcrrhivfgngerkeqfsntsiedkknnyrkeksSSIHEELTQYVNKGKESQLVVAALIATVTFtagitmpggyineigpdqgaaVLTKSSSFQAFVIFNSVAMILSTIAVFIHLKLSLLGDKVFEFNLWKISRGMTKLALFFMVFAFLTgtysvlpsAKILAVIVSIITGGSILYIYAYDYAALFSLIKAVMRFHVNRLQEIRKEFQLIYFLYLNDFVRAC
mssslsgsdnqnaetrragrlsvreKNFELMDSLYKAAVEGHTDQFRAHATMLDQILTPNENTILHIHitarpnqtmksNNKLKSSLWRMMSTFKKQSSSSEHFGRDILEMCPGLLLKTNTKGETLLHIAARHGHADVVKDLIAECKkphqndpekGVEAVRLMQGMTNEAKDTALHEAARYNQIDVVKMLTKEDPSLPYDANNAGETPLYVAAERGYKDVTQDILLTCkspadhgpmGRTALHAAAFRNDTEMTKVLLDSSIGTQTSKADQQGWLPLHLAAHLGYYNVVKELLKADKSAAYKADNEGKIPLHLAAGKGRLNTVQELIMSCPSSCELVDDRGWNVFHFALQSGSRRTIELLLKSPSLGNLVNEKNDDGNTPLLEHAGSGSLIPSFVCHPKVDRLAFNqnncsaediirsdkllfrpNEKNFMWCLNRLNRFRCRRHIvfgngerkeqfsntsiedkknnyrkeksssiHEELTQYVNKGKESQLVVAALIATVTFTAGITMPGGYINEIGPDQGAAVLTKSSSFQAFVIFNSVAMILSTIAVFIHLKLSLLGDKVFEFNLWKISRGMTKLALFFMVFAFLTGTYSVLPSAKILAVIVSIITGGSILYIYAYDYAALFSLIKAVMRFHVNRLQEIRKEFQLIYFLYLNDFVRAC
MSSSLSGSDNQNAETRRAGRLSVREKNFELMDSLYKAAVEGHTDQFRAHATMLDQILTPNENTILHIHITARPNQTMKSNNKLKSSLWRMMSTFKKQSSSSEHFGRDILEMCPGLLLKTNTKGETLLHIAARHGHADVVKDLIAECKKPHQNDPEKGVEAVRLMQGMTNEAKDTALHEAARYNQIDVVKMLTKEDPSLPYDANNAGETPLYVAAERGYKDVTQDILLTCKSPADHGPMGRTALHAAAFRNDTEMTKVLLDSSIGTQTSKADQQGWLPLHLAAHLGYYNVVKELLKADKSAAYKADNEGKIPLHLAAGKGRLNTVQELIMSCPSSCELVDDRGWNVFHFALQSGSRRTIELLLKSPSLGNLVNEKNDDGNTPLLEHAGSGSLIPSFVCHPKVDRLAFNQNNCSAEDIIRSDKLLFRPNEKNFMWclnrlnrfrcrrHIVFGNGERKEQFSNTSIEDKKNNYRKEKSSSIHEELTQYVNKGKESQLVVAALIATVTFTAGITMPGGYINEIGPDQGAAVLTKSSSFQAFVIFNSVAMILSTIAVFIHLKLSLLGDKVFEFNLWKISRGMTKLALFFMVFAFLTGTYSVLPSAKILAVIVSIITGGSilyiyaydyaalFSLIKAVMRFHVNRLQEIRKEFQLIYFLYLNDFVRAC
***************************FELMDSLYKAAVEGHTDQFRAHATMLDQILTPNENTILHIHITA********************************FGRDILEMCPGLLLKTNTKGETLLHIAARHGHADVVKDLIAEC******************************HEAARYNQIDVVKMLT***********NAGETPLYVAAERGYKDVTQDILLTCKSP*******RTALHAAAFRNDTEMTKVLLDS*I*******DQQGWLPLHLAAHLGYYNVVKELLKADKSAAYKADNEGKIPLHLAAGKGRLNTVQELIMSCPSSCELVDDRGWNVFHFALQSGSRRTIELLLK************************SGSLIPSFVCHPKVDRLAFNQNNCSAEDIIRSDKLLFRPNEKNFMWCLNRLNRFRCRRHIVFGN*********************************YVNKGKESQLVVAALIATVTFTAGITMPGGYINEIGPDQGAAVLTKSSSFQAFVIFNSVAMILSTIAVFIHLKLSLLGDKVFEFNLWKISRGMTKLALFFMVFAFLTGTYSVLPSAKILAVIVSIITGGSILYIYAYDYAALFSLIKAVMRFHVNRLQEIRKEFQLIYFLYLNDFVR**
*SSS*****NQ****RRA****VREKNFELMDSLYKAAVEGHTDQFRAHATMLDQILTPNENTILHIHITARPNQTMKSNNKLKSSLWRMMSTFKKQSSSSEHFGRDILEMCPGLLLKTNTKGETLLHIAARHGHADVVKDLIAECKKPHQNDPEKGVEAVRLMQGMTNEAKDTALHEAARYNQIDVVKMLTKEDPSLPYDANNAGETPLYVAAERGYKDVTQDILLTCKSPADHGPMGRTALHAAAFRNDTEMTKVLLDSSIGTQTSKADQQGWLPLHLAAHLGYYNVVKELLKADKSAAYKADNEGKIPLHLAAGKGRLNTVQELIMSCPSSCELVDDRGWNVFHFALQSGSRRTIELLLKSPSLGNLVNEKNDDGNTPLLEHAGSGSLIPSFVCHPKVDRLAFNQNNCSAEDIIRSDKLLFRPNEKNFMWCLNRLNRFRCRRHI****************************************KGKESQLVVAALIATVTFTAGITMPGGYINEIGPDQGAAVLTKSSSFQAFVIFNSVAMILSTIAVFIHLKLSLLGDKVFEFNLWKISRGMTKLALFFMVFAFLTGTYSVLPSAKILAVIVSIITGGSILYIYAYDYAALFSLIKAVMRFHVNRLQEIRKEFQLIYFLYLNDFVRAC
******************GRLSVREKNFELMDSLYKAAVEGHTDQFRAHATMLDQILTPNENTILHIHITARPNQTMKSNNKLKSSLWRMMST*********HFGRDILEMCPGLLLKTNTKGETLLHIAARHGHADVVKDLIAECKKPHQNDPEKGVEAVRLMQGMTNEAKDTALHEAARYNQIDVVKMLTKEDPSLPYDANNAGETPLYVAAERGYKDVTQDILLTCKSPADHGPMGRTALHAAAFRNDTEMTKVLLDSSIGTQTSKADQQGWLPLHLAAHLGYYNVVKELLKADKSAAYKADNEGKIPLHLAAGKGRLNTVQELIMSCPSSCELVDDRGWNVFHFALQSGSRRTIELLLKSPSLGNLVNEKNDDGNTPLLEHAGSGSLIPSFVCHPKVDRLAFNQNNCSAEDIIRSDKLLFRPNEKNFMWCLNRLNRFRCRRHIVFGNGERKEQFSNTSIEDKKN**********HEELTQYVNKGKESQLVVAALIATVTFTAGITMPGGYINEIGPDQGAAVLTKSSSFQAFVIFNSVAMILSTIAVFIHLKLSLLGDKVFEFNLWKISRGMTKLALFFMVFAFLTGTYSVLPSAKILAVIVSIITGGSILYIYAYDYAALFSLIKAVMRFHVNRLQEIRKEFQLIYFLYLNDFVRAC
MSSSLSGSDNQNAETRRAGRLSVREKNFELMDSLYKAAVEGHTDQFRAHATMLDQILTPNENTILHIHITARPNQTMKSNNKLKSSLWRMMSTFKKQSSSSEHFGRDILEMCPGLLLKTNTKGETLLHIAARHGHADVVKDLIAECKKPHQNDPEKGVEAVRLMQGMTNEAKDTALHEAARYNQIDVVKMLTKEDPSLPYDANNAGETPLYVAAERGYKDVTQDILLTCKSPADHGPMGRTALHAAAFRNDTEMTKVLLDSSIGTQTSKADQQGWLPLHLAAHLGYYNVVKELLKADKSAAYKADNEGKIPLHLAAGKGRLNTVQELIMSCPSSCELVDDRGWNVFHFALQSGSRRTIELLLKSPSLGNLVNEKNDDGNTPLLEHAGSGSLIPSFVCHPKVDRLAFNQNNCSAEDIIRSDKLLFRPNEKNFMWCLNRLNRFRCRRHIVFGNGERKEQFSNTSIEDKKNNY****SSSIHEELTQYVNKGKESQLVVAALIATVTFTAGITMPGGYINEIGPDQGAAVLTKSSSFQAFVIFNSVAMILSTIAVFIHLKLSLLGDKVFEFNLWKISRGMTKLALFFMVFAFLTGTYSVLPSAKILAVIVSIITGGSILYIYAYDYAALFSLIKAVMRFHVNRLQEIRKEFQLIYFLYLNDFVRAC
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHoooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSSLSGSDNQNAETRRAGRLSVREKNFELMDSLYKAAVEGHTDQFRAHATMLDQILTPNENTILHIHITARPNQTMKSNNKLKSSLWRMMSTFKKQSSSSEHFGRDILEMCPGLLLKTNTKGETLLHIAARHGHADVVKDLIAECKKPHQNDPEKGVEAVRLMQGMTNEAKDTALHEAARYNQIDVVKMLTKEDPSLPYDANNAGETPLYVAAERGYKDVTQDILLTCKSPADHGPMGRTALHAAAFRNDTEMTKVLLDSSIGTQTSKADQQGWLPLHLAAHLGYYNVVKELLKADKSAAYKADNEGKIPLHLAAGKGRLNTVQELIMSCPSSCELVDDRGWNVFHFALQSGSRRTIELLLKSPSLGNLVNEKNDDGNTPLLEHAGSGSLIPSFVCHPKVDRLAFNQNNCSAEDIIRSDKLLFRPNEKNFMWCLNRLNRFRCRRHIVFGNGERKEQFSNTSIEDKKNNYRKEKSSSIHEELTQYVNKGKESQLVVAALIATVTFTAGITMPGGYINEIGPDQGAAVLTKSSSFQAFVIFNSVAMILSTIAVFIHLKLSLLGDKVFEFNLWKISRGMTKLALFFMVFAFLTGTYSVLPSAKILAVIVSIITGGSILYIYAYDYAALFSLIKAVMRFHVNRLQEIRKEFQLIYFLYLNDFVRAC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query663 2.2.26 [Sep-21-2011]
Q9C7A2590 Ankyrin repeat-containing no no 0.659 0.740 0.251 3e-24
Q6AWW5524 Ankyrin repeat-containing no no 0.567 0.717 0.262 1e-21
G5E8K5 1961 Ankyrin-3 OS=Mus musculus no no 0.387 0.131 0.319 8e-19
P57078832 Receptor-interacting seri yes no 0.361 0.288 0.292 2e-18
Q9ERK0786 Receptor-interacting seri no no 0.368 0.310 0.291 4e-18
P16157 1881 Ankyrin-1 OS=Homo sapiens no no 0.351 0.123 0.324 1e-17
Q12955 4377 Ankyrin-3 OS=Homo sapiens no no 0.387 0.058 0.312 3e-17
Q02357 1862 Ankyrin-1 OS=Mus musculus no no 0.371 0.132 0.318 1e-16
Q80YE7 1442 Death-associated protein no no 0.279 0.128 0.340 1e-16
P53355 1430 Death-associated protein no no 0.285 0.132 0.328 3e-16
>sp|Q9C7A2|Y3236_ARATH Ankyrin repeat-containing protein At3g12360 OS=Arabidopsis thaliana GN=At3g12360 PE=2 SV=1 Back     alignment and function desciption
 Score =  114 bits (284), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 124/494 (25%), Positives = 211/494 (42%), Gaps = 57/494 (11%)

Query: 162 RLMQGMTNEAKDTALHEAARYNQIDVVKMLTKE---------------------DPSLPY 200
           + ++ +T    DT LH AA+   +  V+ + K+                       S+  
Sbjct: 64  KYVKQVTGRHNDTELHLAAQRGDLAAVQQILKDINSQMEGILSGEEFDAEVAEIRASIVN 123

Query: 201 DANNAGETPLYVAAERGYKDVTQDILL--TCKSPADHGPMGRTALHAAAFRNDTEMTKVL 258
           + N  GET L+ AA++G+ DV +++L   + +S A     G   LH AA +    + +VL
Sbjct: 124 EVNELGETALFTAADKGHLDVVKELLKYSSRESIAKKNRSGYDPLHIAAIQGHHAIVEVL 183

Query: 259 LDSSIGTQTSKADQQGWLPLHLAAHLGYYNVVKELLKADKSAAYKADNEGKIPLHLAAGK 318
           LD    T +         PL  AA  G+  VV +LL    +    + +  K  LHLAA +
Sbjct: 184 LDHD-ATLSQTFGPSNATPLVSAAMRGHTEVVNQLLSKAGNLLEISRSNNKNALHLAARQ 242

Query: 319 GRLNTVQELIMSCPSSCELVDDRGWNVFHFALQSGSRRTIELLLKS-PSLGNLVNEKNDD 377
           G +  ++ L+   P     +D +G    H A++  S   ++LLL + P+   +V + +  
Sbjct: 243 GHVEVIKALLSKDPQLARRIDKKGQTALHMAVKGQSSEVVKLLLDADPA---IVMQPDKS 299

Query: 378 GNTPLLEHAGS----GSLIPSFVCHPKVDRLAFNQNNCSAEDIIRSDKLLFRPNEKNFMW 433
            NT L  H  +      ++   +  P  +     +++ +A DI  ++ L           
Sbjct: 300 CNTAL--HVATRKKRAEIVELLLSLPDTNANTLTRDHKTALDI--AEGLPLSEESSYIKE 355

Query: 434 CLNRLNRFRCRRHIVFGNGERKEQFSNTS-------IEDKKNNYRKEKSSSIHEELTQY- 485
           CL R    R        N  R E  S  +       I+ ++     +   +I +EL +  
Sbjct: 356 CLARSGALRANEL----NQPRDELRSTVTQIKNDVHIQLEQTKRTNKNVHNISKELRKLH 411

Query: 486 ---VNKGKESQLVVAALIATVTFTAGITMPGGYINEIGPDQGAAVLTKSSSFQAFVIFNS 542
              +N    S  VVA L ATV F A  T+PGG  N+     G+AV+   +SF+ F IFN+
Sbjct: 412 REGINNATNSVTVVAVLFATVAFAAIFTVPGGDNND-----GSAVVVGRASFKIFFIFNA 466

Query: 543 VAMILSTIAVFIHLKLSLLGDKVFEFNLWKISRGMTKLALFFMVFAFLTGTYSVLPSAKI 602
           +A+  S   V + + L + G+   E  + ++   +  LA      AFL  +Y V+     
Sbjct: 467 LALFTSLAVVVVQITL-VRGETKAEKRVVEVINKLMWLASMCTSVAFLASSYIVVGRKNE 525

Query: 603 LAVIVSIITGGSIL 616
            A  +  + GG I+
Sbjct: 526 WAAELVTVVGGVIM 539

Arabidopsis thaliana (taxid: 3702)
>sp|Q6AWW5|Y5262_ARATH Ankyrin repeat-containing protein At5g02620 OS=Arabidopsis thaliana GN=At5g02620 PE=1 SV=1 Back     alignment and function description
>sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 Back     alignment and function description
>sp|P57078|RIPK4_HUMAN Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 Back     alignment and function description
>sp|Q9ERK0|RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 Back     alignment and function description
>sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 Back     alignment and function description
>sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 Back     alignment and function description
>sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 Back     alignment and function description
>sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 Back     alignment and function description
>sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query663
255585399575 ankyrin repeat-containing protein, putat 0.785 0.906 0.388 7e-99
147772498708 hypothetical protein VITISV_032148 [Viti 0.743 0.696 0.393 4e-94
356510752629 PREDICTED: ankyrin-2-like [Glycine max] 0.840 0.885 0.360 2e-91
225432914596 PREDICTED: ankyrin repeat-containing pro 0.730 0.812 0.395 4e-91
296085927611 unnamed protein product [Vitis vinifera] 0.820 0.890 0.377 2e-86
359477901622 PREDICTED: ankyrin repeat-containing pro 0.853 0.909 0.371 1e-85
224127106575 predicted protein [Populus trichocarpa] 0.793 0.914 0.365 1e-85
359478095720 PREDICTED: ankyrin repeat-containing pro 0.784 0.722 0.370 3e-81
359478091637 PREDICTED: ankyrin-1-like [Vitis vinifer 0.802 0.835 0.356 9e-79
147833690582 hypothetical protein VITISV_028446 [Viti 0.778 0.886 0.373 4e-78
>gi|255585399|ref|XP_002533395.1| ankyrin repeat-containing protein, putative [Ricinus communis] gi|223526769|gb|EEF28995.1| ankyrin repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  367 bits (943), Expect = 7e-99,   Method: Compositional matrix adjust.
 Identities = 231/594 (38%), Positives = 334/594 (56%), Gaps = 73/594 (12%)

Query: 34  LYKAAVEGHTDQFRAHATMLDQILTPNENTILHIHITARPNQTMKSNNKLKSSLWRMMST 93
           LYKAA +G  D F+  A  LD ++TP ++TILH+++ A P                    
Sbjct: 31  LYKAAEDGKIDPFKNFAGPLDLLVTPIKDTILHLNL-ASP-------------------- 69

Query: 94  FKKQSSSSEHFGRDILEMCPGLLLKTNTKGETLLHIAARHGHADVVKDLIAECKKPHQND 153
               S  S  F ++ L+MCP +LL+ N  G+TLLHIAAR+GH D+VK LI   +  HQ D
Sbjct: 70  ----SERSTSFVKEALDMCPQILLQINADGDTLLHIAARYGHLDIVKLLIEHTRAQHQ-D 124

Query: 154 PEKGVEAVRLMQGMTNEAKDTALHEAARYNQIDVVKMLTKEDPSLPYDANNAGETPLYVA 213
            E   EAVR M  MTN++K+TALHEAAR +  D+V++L ++DP   + +N+ GETPLY+A
Sbjct: 125 LESAGEAVRQMLRMTNKSKETALHEAARNDHPDLVELLIEQDPDFVHSSNDFGETPLYLA 184

Query: 214 AERGYKDVTQDILLTCKSPADHGPMGRTALHAAAFRNDTEMTKVLLDSSIGTQTSKADQQ 273
           +ERG+ +V   +L  C S A  GP G+TALHAAA      +   +LD    +  +KAD+ 
Sbjct: 185 SERGHLEVVVIMLKACTSLAYGGPNGKTALHAAAMHRHGGIVHAILDKKT-SLVNKADEM 243

Query: 274 GWLPLHLAAHLGYYNVVKELLKADKSAAYKADN-EGKIPLHLAAGKGRLNTVQELIMSCP 332
           GW PLH AA++G   VVK+LL  DK  AY AD    +  LHLAA +  + +++E+I  CP
Sbjct: 244 GWTPLHYAAYIGASRVVKQLLGYDKYVAYAADKARRRTALHLAACQANIKSMREIIFKCP 303

Query: 333 SSCELVDDRGWNVFHFALQSGSRRTIELLLKSPSLGNLVNEKNDDGNTPLLEHAGSGSLI 392
             C+LVD+RGWNV H+A+ S S   +++LL +PS   LVNEK+  GNTPL   A   S  
Sbjct: 304 DCCKLVDNRGWNVAHYAVISKSDDALKILLANPSCIYLVNEKDAQGNTPLHLLAALQSHP 363

Query: 393 PSFVCHPKVDRLAFNQNNCSAEDIIRSDKLLFRPNEKNFMWCLNRLNRFRCRRHIV---- 448
            S + H K  R A                 ++R   +NF+     L+R  CR+  +    
Sbjct: 364 RSLMHHAKGHRFA-----------------VYR---QNFLCIKELLSRSPCRKKEIQEWM 403

Query: 449 --FGNGERKEQFSNTSIEDKKNNYRKEKSSSIHEELTQYVNKGKESQLVVAALIATVTFT 506
              G G   +      I  KK+++                 + ++S +VVAAL+ATVTF 
Sbjct: 404 RDLGGGPLGQ------IVIKKDDF------------ILTFERARDSHIVVAALVATVTFA 445

Query: 507 AGITMPGGY-INEIGPDQGAAVLTKSSSFQAFVIFNSVAMILSTIAVFIHLKLSLLGDKV 565
           A  T+PGGY  N+   DQG A+L K+S+F+AF+I +++AM+LST ++FIH  L+L G + 
Sbjct: 446 AAFTLPGGYRSNDDEKDQGVAILGKNSAFKAFLITDAIAMVLSTSSLFIHFTLALHGYRQ 505

Query: 566 FEFNLWKISRGMTKLALFFMVFAFLTGTYSVLPSAKILAVIVSIITGGSILYIY 619
               L   +      A+  MV AF+TGTY+VL  ++ LA+    I     ++++
Sbjct: 506 RFMWLMVYAFRCIVFAIEAMVVAFVTGTYAVLSPSQGLAISTCAIGLSFFIFVF 559

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147772498|emb|CAN60780.1| hypothetical protein VITISV_032148 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356510752|ref|XP_003524098.1| PREDICTED: ankyrin-2-like [Glycine max] Back     alignment and taxonomy information
>gi|225432914|ref|XP_002280197.1| PREDICTED: ankyrin repeat-containing protein At2g01680-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296085927|emb|CBI31368.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359477901|ref|XP_003632040.1| PREDICTED: ankyrin repeat-containing protein At3g12360-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224127106|ref|XP_002329398.1| predicted protein [Populus trichocarpa] gi|222870448|gb|EEF07579.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359478095|ref|XP_002274107.2| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359478091|ref|XP_002270351.2| PREDICTED: ankyrin-1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147833690|emb|CAN77721.1| hypothetical protein VITISV_028446 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query663
TAIR|locus:2128781677 AT4G03460 "AT4G03460" [Arabido 0.450 0.441 0.302 8.8e-43
TAIR|locus:2020833616 AT1G03670 "AT1G03670" [Arabido 0.463 0.498 0.294 5.1e-41
TAIR|locus:2128771641 AT4G03450 "AT4G03450" [Arabido 0.408 0.422 0.321 6.5e-37
TAIR|locus:2129685694 AT4G14390 "AT4G14390" [Arabido 0.411 0.393 0.307 2.6e-35
TAIR|locus:2129690670 ACD6 "AT4G14400" [Arabidopsis 0.414 0.410 0.273 4.9e-34
TAIR|locus:2138391572 AT4G05040 "AT4G05040" [Arabido 0.414 0.480 0.290 2.1e-33
TAIR|locus:2026489543 AT1G07710 "AT1G07710" [Arabido 0.665 0.812 0.272 1.9e-27
TAIR|locus:2045233662 AT2G31820 [Arabidopsis thalian 0.704 0.705 0.261 4.5e-27
TAIR|locus:2128791683 AT4G03470 [Arabidopsis thalian 0.461 0.448 0.313 9.4e-26
TAIR|locus:2075009607 AT3G09550 [Arabidopsis thalian 0.598 0.654 0.277 2.7e-25
TAIR|locus:2128781 AT4G03460 "AT4G03460" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 327 (120.2 bits), Expect = 8.8e-43, Sum P(2) = 8.8e-43
 Identities = 98/324 (30%), Positives = 157/324 (48%)

Query:   108 ILEMCPGLLLKTNTKGETLLHIAARHGHADVVKDLIAECKKPHQNDPEKGVEAVRLMQGM 167
             IL   PGLL+K+N+ GE  LH+AA  GH  VV+ L++  K    N P  GV   + +   
Sbjct:   150 ILNAYPGLLMKSNSMGEVALHVAAGAGHLAVVEALVSFIKDISCNKP--GV--AKKIYFA 205

Query:   168 TNEAKDTALHEAARYNQIDVVKMLTKEDPSLPYDANNAGETPLYVAAERGYKDVTQDILL 227
              +  +D ALH + +   + V   L   + SL + ANN G +PLY+A E G  D+ + +  
Sbjct:   206 KDRHQDNALHVSLKRKHLKVASCLVCAEQSLSFVANNDGVSPLYLAVEAGQADLAKTMWQ 265

Query:   228 TCKSPADHGPM------GRTALHAA--AFRNDTEMTKVLLDSSIGTQTSKADQQGWLPLH 279
                + +           GR+ +H A  A R D  +  +  D+S+    +  D+ G   L 
Sbjct:   266 HSNNGSSSTSTLASKIGGRSIVHGAMKARRKDILVAILSEDASL---INFRDE-GRTCLS 321

Query:   280 LAAHLGYYNVVKELLKADKSAAYKADNEGKIPLHLAAGKGRLNTVQELIMSCPSSCELVD 339
               A LGYY     LL     + Y +D++G  P+H+A   G +  ++ ++  CP + EL+D
Sbjct:   322 FGASLGYYEGFCYLLDKALDSVYVSDDDGSFPIHMAVKYGYVKILKAILKRCPDALELLD 381

Query:   340 DRGWNVFHFALQSGSRRTIELLL---KSPSLGNLVNEKNDDGNTPLLEHAGSGSLIPSFV 396
                 NV H A ++G    ++ +L   K  +   L+NE++ +GNTPL  H  + +  P  V
Sbjct:   382 RENQNVLHVAAKNGKIEVLKFILRCCKDKNKEKLINEEDANGNTPL--HLATKNWHPKVV 439

Query:   397 C----HPKVDRLAFNQNNCSAEDI 416
                    +VD    N +  +A DI
Sbjct:   440 SMLTWDNRVDLKTLNHDGVTALDI 463
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2020833 AT1G03670 "AT1G03670" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2128771 AT4G03450 "AT4G03450" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129685 AT4G14390 "AT4G14390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129690 ACD6 "AT4G14400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2138391 AT4G05040 "AT4G05040" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026489 AT1G07710 "AT1G07710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2045233 AT2G31820 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2128791 AT4G03470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075009 AT3G09550 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query663
pfam13962114 pfam13962, PGG, Domain of unknown function 3e-23
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-22
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-21
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-21
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-21
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 7e-21
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-12
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 7e-12
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 8e-12
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-11
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-11
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 7e-10
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-08
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-07
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 2e-07
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-06
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 1e-05
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 1e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 1e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 3e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 3e-05
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 5e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 9e-05
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 1e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 2e-04
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 3e-04
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 4e-04
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 6e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 0.001
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 0.002
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 0.002
pfam0002333 pfam00023, Ank, Ankyrin repeat 0.003
>gnl|CDD|222475 pfam13962, PGG, Domain of unknown function Back     alignment and domain information 
 Score = 94.9 bits (237), Expect = 3e-23
 Identities = 38/103 (36%), Positives = 54/103 (52%), Gaps = 4/103 (3%)

Query: 494 LVVAALIATVTFTAGITMPGGYI-NEIGPDQGAAVL-TKSSSFQAFVIFNSVAMILSTIA 551
           LVVA LIATVTF AG T PGGY  ++ G   G  +L  K   F+AF + N++A + S +A
Sbjct: 12  LVVATLIATVTFAAGFTPPGGYWQDDGGHHAGTPILAGKPRRFKAFFVSNTIAFVASLVA 71

Query: 552 VFIHLKLSLLGDKVFEFNLWKISRGMTKLALFFMVFAFLTGTY 594
           V + L   +         L      +  L+L  ++ AF  G+Y
Sbjct: 72  VILLL-YIVPSFSRRLPRLL-ALLTLLWLSLLSLMVAFAAGSY 112

The PGG domain is named for the highly conserved sequence motif found at the startt of the domain. The function is not known. Length = 114
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 663
PHA02876682 ankyrin repeat protein; Provisional 100.0
KOG0510 929 consensus Ankyrin repeat protein [General function 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02876682 ankyrin repeat protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
KOG0510 929 consensus Ankyrin repeat protein [General function 100.0
PHA02730672 ankyrin-like protein; Provisional 100.0
PHA02716764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA02917661 ankyrin-like protein; Provisional 100.0
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 100.0
PHA02716764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
PHA02730672 ankyrin-like protein; Provisional 100.0
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 100.0
PHA02878477 ankyrin repeat protein; Provisional 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
PHA02878477 ankyrin repeat protein; Provisional 100.0
PHA02917661 ankyrin-like protein; Provisional 100.0
KOG0508615 consensus Ankyrin repeat protein [General function 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02989494 ankyrin repeat protein; Provisional 100.0
PHA02989494 ankyrin repeat protein; Provisional 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
PHA02798489 ankyrin-like protein; Provisional 99.97
PHA02798489 ankyrin-like protein; Provisional 99.97
PHA02792631 ankyrin-like protein; Provisional 99.97
KOG0508615 consensus Ankyrin repeat protein [General function 99.96
PHA02792631 ankyrin-like protein; Provisional 99.96
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.96
KOG0509600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.96
PF13962113 PGG: Domain of unknown function 99.95
PHA02859209 ankyrin repeat protein; Provisional 99.92
PHA02859209 ankyrin repeat protein; Provisional 99.92
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.92
PHA02795437 ankyrin-like protein; Provisional 99.91
PHA02795437 ankyrin-like protein; Provisional 99.9
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.9
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.89
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.89
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.89
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.87
PLN03192823 Voltage-dependent potassium channel; Provisional 99.87
PLN03192823 Voltage-dependent potassium channel; Provisional 99.87
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.87
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.86
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.82
KOG0514452 consensus Ankyrin repeat protein [General function 99.8
PHA02743166 Viral ankyrin protein; Provisional 99.78
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.78
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.77
PHA02743166 Viral ankyrin protein; Provisional 99.76
PHA02741169 hypothetical protein; Provisional 99.74
KOG0514452 consensus Ankyrin repeat protein [General function 99.74
PHA02741169 hypothetical protein; Provisional 99.74
PHA02884300 ankyrin repeat protein; Provisional 99.73
PHA02884300 ankyrin repeat protein; Provisional 99.72
PHA02736154 Viral ankyrin protein; Provisional 99.72
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.71
PHA02736154 Viral ankyrin protein; Provisional 99.69
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.64
KOG3676782 consensus Ca2+-permeable cation channel OSM-9 and 99.62
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.59
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.57
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.54
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.53
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.51
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.5
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.29
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.27
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.26
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.25
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.23
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.12
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.1
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.03
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.03
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.02
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.02
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.0
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 98.98
PTZ00322664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 98.98
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.38
PF1360630 Ank_3: Ankyrin repeat 98.38
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.33
KOG0818669 consensus GTPase-activating proteins of the GIT fa 98.3
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.3
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.22
PF1360630 Ank_3: Ankyrin repeat 98.21
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.18
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.18
KOG0818669 consensus GTPase-activating proteins of the GIT fa 98.16
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.15
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.08
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 97.95
KOG0522560 consensus Ankyrin repeat protein [General function 97.94
KOG0522560 consensus Ankyrin repeat protein [General function 97.93
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 97.7
KOG0705749 consensus GTPase-activating protein Centaurin gamm 97.69
KOG0705749 consensus GTPase-activating protein Centaurin gamm 97.6
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.53
KOG0520975 consensus Uncharacterized conserved protein, conta 97.32
KOG2384223 consensus Major histocompatibility complex protein 97.3
KOG0520975 consensus Uncharacterized conserved protein, conta 97.29
KOG0511516 consensus Ankyrin repeat protein [General function 97.28
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.24
KOG0511516 consensus Ankyrin repeat protein [General function 96.96
KOG2384223 consensus Major histocompatibility complex protein 96.93
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 95.65
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 94.85
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 94.49
KOG2505591 consensus Ankyrin repeat protein [General function 92.35
KOG2505591 consensus Ankyrin repeat protein [General function 91.81
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 89.79
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 88.88
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 88.15
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 86.25
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information 
Probab=100.00  E-value=3.1e-44  Score=408.72  Aligned_cols=375  Identities=20%  Similarity=0.159  Sum_probs=293.9

Q ss_pred             CCCccccchhhchHHHHHHHHcCChhHHHhhhhccccc---cccCCCcceeeecccCCCCcccccccc------------
Q 006054           19 GRLSVREKNFELMDSLYKAAVEGHTDQFRAHATMLDQI---LTPNENTILHIHITARPNQTMKSNNKL------------   83 (663)
Q Consensus        19 ~~~~~~~~~~~~~~~L~~Aa~~g~~~~v~~Ll~~~~~~---~~~~g~t~Lh~A~~a~~g~~~~~~~~~------------   83 (663)
                      ++.+....+..++||||+|+..|+.|+|+.|++.+++.   .+..|+||||+|  +..++....-...            
T Consensus        30 ~~~~~~~~~~~~~t~LH~A~~~g~~e~V~~ll~~~~~~~~~~~~~~~tpLh~a--~~~~~~~~~~~~l~~~~~~~~~~~~  107 (682)
T PHA02876         30 HGANQCENESIPFTAIHQALQLRQIDIVEEIIQQNPELIYITDHKCHSTLHTI--CIIPNVMDIVISLTLDCDIILDIKY  107 (682)
T ss_pred             hhhhhcccccccchHHHHHHHHHhhhHHHHHHHhCcccchhhchhhccccccc--cCCCCccccccccccchhhcccccH
Confidence            34445555667899999999999999999999987663   777899999999  8665520000000            


Q ss_pred             -----------c-hhhhhhhc--ccccc----CCC-------------cchhhhhhhhcChhhhhccCCCCCcHHHHHHH
Q 006054           84 -----------K-SSLWRMMS--TFKKQ----SSS-------------SEHFGRDILEMCPGLLLKTNTKGETLLHIAAR  132 (663)
Q Consensus        84 -----------~-iv~~Ll~~--~~~~~----~~~-------------~~~~g~~~~~~~~~ll~~~~~~g~T~Lh~A~~  132 (663)
                                 + +++.+-+.  +.+..    ...             .+..-...+-..+..++..|..|.||||+|+.
T Consensus       108 ~~~~~~~~~~~~~~~~il~~~~~~~~~~~~~~~~~~~~~~~l~~~i~~~~~~i~k~Ll~~Gadvn~~d~~G~TpLh~Aa~  187 (682)
T PHA02876        108 ASIILNKHKLDEACIHILKEAISGNDIHYDKINESIEYMKLIKERIQQDELLIAEMLLEGGADVNAKDIYCITPIHYAAE  187 (682)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhcCCcccHHhhccchhhhHHHHHHHHCCcHHHHHHHHhCCCCCCCCCCCCCCHHHHHHH
Confidence                       0 00000000  00000    000             00000112223344466788899999999999


Q ss_pred             hccHHHHHHHHHhcCCCCCCCCcchhHHHHHHhhCCCcCCChHHHHHHHcCCHHHHHHHHH-------------------
Q 006054          133 HGHADVVKDLIAECKKPHQNDPEKGVEAVRLMQGMTNEAKDTALHEAARYNQIDVVKMLTK-------------------  193 (663)
Q Consensus       133 ~g~~~iv~~Ll~~~~~~~~~~~~~~~~~~~~~l~~~~~~g~t~L~~A~~~g~~~iv~~Ll~-------------------  193 (663)
                      .|+.++|++|+++|++++.                .+..|.||||.|+..|+.++++.|++                   
T Consensus       188 ~G~~~iv~~LL~~Gad~n~----------------~~~~g~t~L~~A~~~~~~~ivk~Ll~~~~~~~~~~~~L~~ai~~~  251 (682)
T PHA02876        188 RGNAKMVNLLLSYGADVNI----------------IALDDLSVLECAVDSKNIDTIKAIIDNRSNINKNDLSLLKAIRNE  251 (682)
T ss_pred             CCCHHHHHHHHHCCCCcCc----------------cCCCCCCHHHHHHHcCCHHHHHHHHhcCCCCCCCcHHHHHHHHcC
Confidence            9999999999999998775                44455666666666666666655554                   


Q ss_pred             ----------cCCCCCCCCCCCCCcHHHHHHHcCCH-HHHHHHHHhCCCCCCCCCCCCCHHHHHHhcC-CHHHHHHHHhc
Q 006054          194 ----------EDPSLPYDANNAGETPLYVAAERGYK-DVTQDILLTCKSPADHGPMGRTALHAAAFRN-DTEMTKVLLDS  261 (663)
Q Consensus       194 ----------~~~~~~~~~~~~g~tpL~~A~~~g~~-eiv~~Ll~~~~~~~~~~~~g~t~L~~A~~~~-~~~~v~~Ll~~  261 (663)
                                .+.+.. ..+..|.||||+|+..++. ++++.|++.|++++..+.+|.||||.|+..| +.++++.|+..
T Consensus       252 ~~~~~~~Ll~~g~~vn-~~d~~g~TpLh~Aa~~~~~~~iv~lLl~~gadin~~d~~g~TpLh~Aa~~g~~~~~v~~Ll~~  330 (682)
T PHA02876        252 DLETSLLLYDAGFSVN-SIDDCKNTPLHHASQAPSLSRLVPKLLERGADVNAKNIKGETPLYLMAKNGYDTENIRTLIML  330 (682)
T ss_pred             CHHHHHHHHHCCCCCC-CCCCCCCCHHHHHHhCCCHHHHHHHHHHCCCCCCCcCCCCCCHHHHHHHhCCCHHHHHHHHHc
Confidence                      444433 4567899999999999986 6999999999999999999999999999998 59999999998


Q ss_pred             ccCCCCCcCCCCCChHHHHHHHcC-CHHHHHHHHhcCccccccCCCCCChHHHHHHhcCCHHHHHHHHHcCCCCcccccC
Q 006054          262 SIGTQTSKADQQGWLPLHLAAHLG-YYNVVKELLKADKSAAYKADNEGKIPLHLAAGKGRLNTVQELIMSCPSSCELVDD  340 (663)
Q Consensus       262 ~~g~~~~~~d~~g~tpLh~A~~~g-~~~iv~~Ll~~~~~~~~~~~~~g~tpLh~Aa~~g~~~~v~~Ll~~~~~~~~~~d~  340 (663)
                        |++++..|..|.||||+|+..+ +.++++.|++.+.+. +.+|..|.||||+|+..|+.++++.|++.+++. +..+.
T Consensus       331 --gadin~~d~~g~TpLh~A~~~~~~~~iv~lLl~~gadi-n~~d~~G~TpLh~Aa~~~~~~iv~~Ll~~gad~-~~~~~  406 (682)
T PHA02876        331 --GADVNAADRLYITPLHQASTLDRNKDIVITLLELGANV-NARDYCDKTPIHYAAVRNNVVIINTLLDYGADI-EALSQ  406 (682)
T ss_pred             --CCCCCCcccCCCcHHHHHHHhCCcHHHHHHHHHcCCCC-ccCCCCCCCHHHHHHHcCCHHHHHHHHHCCCCc-cccCC
Confidence              8899999999999999999864 688999999999887 778999999999999999999999999998775 67889


Q ss_pred             CCCcHHHHHHHcCC-HHHHHHHHhCCCCCCCCCCCCCCCCcHHHHHHhCC-Cc-ccccccccCcCccccccCCCChHHHH
Q 006054          341 RGWNVFHFALQSGS-RRTIELLLKSPSLGNLVNEKNDDGNTPLLEHAGSG-SL-IPSFVCHPKVDRLAFNQNNCSAEDII  417 (663)
Q Consensus       341 ~g~t~Lh~Av~~~~-~~iv~~Ll~~~~~~~~in~~d~~G~TpLhlA~~~~-~~-~~~lL~~~~ad~~~~n~~g~t~l~ia  417 (663)
                      .|.||||+|+..++ ..++++|++.   |+++|.+|.+|+||||+|+..+ +. ++++|++.|+|++.+|..|.||+++|
T Consensus       407 ~g~T~Lh~A~~~~~~~~~vk~Ll~~---gadin~~d~~G~TpLh~Aa~~~~~~~iv~lLl~~Gad~n~~d~~g~tpl~~a  483 (682)
T PHA02876        407 KIGTALHFALCGTNPYMSVKTLIDR---GANVNSKNKDLSTPLHYACKKNCKLDVIEMLLDNGADVNAINIQNQYPLLIA  483 (682)
T ss_pred             CCCchHHHHHHcCCHHHHHHHHHhC---CCCCCcCCCCCChHHHHHHHhCCcHHHHHHHHHCCCCCCCCCCCCCCHHHHH
Confidence            99999999998766 5678999988   8999999999999999999876 43 45999999999999999999999999


Q ss_pred             hh
Q 006054          418 RS  419 (663)
Q Consensus       418 ~~  419 (663)
                      ..
T Consensus       484 ~~  485 (682)
T PHA02876        484 LE  485 (682)
T ss_pred             HH
Confidence            75

>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PF13962 PGG: Domain of unknown function Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query663
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 1e-17
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 6e-13
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 3e-06
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 7e-13
2xeh_A157 Structural Determinants For Improved Thermal Stabil 7e-13
2xee_A157 Structural Determinants For Improved Thermal Stabil 1e-12
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 5e-12
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 9e-12
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 1e-11
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 1e-11
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 3e-11
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 5e-11
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 1e-10
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 1e-09
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 1e-10
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 1e-04
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 1e-10
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 2e-04
1uoh_A226 Human Gankyrin Length = 226 4e-10
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 4e-10
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 3e-07
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 1e-04
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 4e-10
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 6e-10
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 8e-10
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 9e-10
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 9e-10
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 1e-09
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 2e-09
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 2e-08
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 2e-09
2dzn_A228 Crystal Structure Analysis Of Yeast Nas6p Complexed 2e-09
2dzn_A228 Crystal Structure Analysis Of Yeast Nas6p Complexed 5e-04
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 2e-09
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 2e-09
1ixv_A231 Crystal Structure Analysis Of Homolog Of Oncoprotei 2e-09
1ixv_A231 Crystal Structure Analysis Of Homolog Of Oncoprotei 5e-04
1wg0_A243 Structural Comparison Of Nas6p Protein Structures I 3e-09
1wg0_A243 Structural Comparison Of Nas6p Protein Structures I 6e-04
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 5e-09
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 3e-05
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 7e-09
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 9e-09
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 1e-08
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 4e-08
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 7e-08
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 2e-07
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 5e-07
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 1e-06
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 1e-06
1s70_B299 Complex Between Protein Ser/thr Phosphatase-1 (delt 2e-06
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 2e-06
1ihb_A162 Crystal Structure Of P18-Ink4c(Ink6) Length = 162 3e-06
1mx6_A168 Structure Of P18ink4c (F92n) Length = 168 4e-06
1bu9_A168 Solution Structure Of P18-Ink4c, 21 Structures Leng 6e-06
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 7e-06
4hbd_A276 Crystal Structure Of Kank2 Ankyrin Repeats Length = 1e-05
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 2e-05
1mx2_A168 Structure Of F71n Mutant Of P18ink4c Length = 168 3e-05
1mx4_A168 Structure Of P18ink4c (F82q) Length = 168 3e-05
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 5e-05
4a63_B239 Crystal Structure Of The P73-Aspp2 Complex At 2.6a 8e-05
1ycs_B239 P53-53bp2 Complex Length = 239 9e-05
1ot8_A239 Structure Of The Ankyrin Domain Of The Drosophila N 9e-05
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 9e-05
1wdy_A285 Crystal Structure Of Ribonuclease Length = 285 1e-04
1ap7_A168 P19-Ink4d From Mouse, Nmr, 20 Structures Length = 1 1e-04
1blx_B166 P19ink4dCDK6 COMPLEX Length = 166 1e-04
4g8k_A337 Intact Sensor Domain Of Human Rnase L In The Inacti 1e-04
1bi8_B166 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 2e-04
1bd8_A156 Structure Of Cdk Inhibitor P19ink4d Length = 156 2e-04
2qc9_A210 Mouse Notch 1 Ankyrin Repeat Intracellular Domain L 3e-04
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 3e-04
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 4e-04
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 5e-04
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 6e-04
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 6e-04
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure 
Iteration: 1

 Score = 88.6 bits (218), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 94/309 (30%), Positives = 131/309 (42%), Gaps = 66/309 (21%)
Query: 115 LLLKTN-------TKGETLLHIAARHGHADVVKDLIAECKKPHQNDPEKGVEAVRLMQGM 167
           LLL+ N       T G T LHIAAR GH + V  L+ +          +  +A    +G 
Sbjct: 98  LLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEK----------EASQACMTKKGF 147
Query: 168 TNEAKDTALHEAARYNQIDVVKMLTKEDPSLPYDANNAGETPLYVAAERGYKDVTQDILL 227
           T       LH AA+Y ++ V ++L + D + P  A   G TPL+VA      D+ + +L 
Sbjct: 148 T------PLHVAAKYGKVRVAELLLERD-AHPNAAGKNGLTPLHVAVHHNNLDIVKLLLP 200
Query: 228 TCKSPADHGPM--GRTALHAAAFRNDTEMTKVLLDSSIGTQTSKADQQGWLPLHLAAHLG 285
              SP  H P   G T LH AA +N  E+ + LL    G   +    QG  PLHLAA  G
Sbjct: 201 RGGSP--HSPAWNGYTPLHIAAKQNQVEVARSLLQ--YGGSANAESVQGVTPLHLAAQEG 256
Query: 286 YYNVVKELLKADKSAAYKADNEGKIPLHLAAGKGRLNTVQELI----------------- 328
           +  +V  LL + ++     +  G  PLHL A +G +     LI                 
Sbjct: 257 HAEMVA-LLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPL 315
Query: 329 --MSCPSSCELVD-------------DRGWNVFHFALQSGSRRTIELLLKSPSLGNLVNE 373
              S   + +LV                G++  H A Q G    + LLLK+   G   NE
Sbjct: 316 HVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKN---GASPNE 372
Query: 374 KNDDGNTPL 382
            + DG TPL
Sbjct: 373 VSSDGTTPL 381
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 Back     alignment and structure
>pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 Back     alignment and structure
>pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 Back     alignment and structure
>pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 Back     alignment and structure
>pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|1IHB|A Chain A, Crystal Structure Of P18-Ink4c(Ink6) Length = 162 Back     alignment and structure
>pdb|1MX6|A Chain A, Structure Of P18ink4c (F92n) Length = 168 Back     alignment and structure
>pdb|1BU9|A Chain A, Solution Structure Of P18-Ink4c, 21 Structures Length = 168 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|4HBD|A Chain A, Crystal Structure Of Kank2 Ankyrin Repeats Length = 276 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|1MX2|A Chain A, Structure Of F71n Mutant Of P18ink4c Length = 168 Back     alignment and structure
>pdb|1MX4|A Chain A, Structure Of P18ink4c (F82q) Length = 168 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|4A63|B Chain B, Crystal Structure Of The P73-Aspp2 Complex At 2.6a Resolution Length = 239 Back     alignment and structure
>pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 Back     alignment and structure
>pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|1WDY|A Chain A, Crystal Structure Of Ribonuclease Length = 285 Back     alignment and structure
>pdb|1AP7|A Chain A, P19-Ink4d From Mouse, Nmr, 20 Structures Length = 168 Back     alignment and structure
>pdb|1BLX|B Chain B, P19ink4dCDK6 COMPLEX Length = 166 Back     alignment and structure
>pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 Back     alignment and structure
>pdb|1BI8|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 166 Back     alignment and structure
>pdb|1BD8|A Chain A, Structure Of Cdk Inhibitor P19ink4d Length = 156 Back     alignment and structure
>pdb|2QC9|A Chain A, Mouse Notch 1 Ankyrin Repeat Intracellular Domain Length = 210 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query663
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-48
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 9e-48
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-46
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-18
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-45
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-41
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-31
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-44
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-39
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-30
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-25
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 5e-19
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 6e-44
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-40
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-39
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-31
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-27
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-08
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 6e-04
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-43
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 4e-40
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-37
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-35
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-29
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-14
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-42
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-36
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-34
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-15
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-15
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 4e-42
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-38
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 6e-33
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-32
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-27
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-27
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 4e-42
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 5e-10
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-41
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 5e-40
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-32
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-29
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-12
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-41
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-37
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-29
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-22
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-17
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-11
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 4e-41
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-40
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 7e-26
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-25
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 4e-15
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-40
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 7e-39
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 9e-20
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-39
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-38
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 9e-23
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-39
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-37
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-36
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-20
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-37
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-34
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-30
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-22
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 4e-17
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 9e-12
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-36
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 8e-33
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-21
3hra_A201 Ankyrin repeat family protein; structural protein; 6e-36
3hra_A201 Ankyrin repeat family protein; structural protein; 5e-30
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-29
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-28
3hra_A201 Ankyrin repeat family protein; structural protein; 5e-26
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-10
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-35
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 5e-35
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 5e-32
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 6e-16
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 6e-10
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-34
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-33
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-32
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-25
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-16
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-10
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 4e-34
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-14
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-13
3v30_A172 DNA-binding protein rfxank; structural genomics co 6e-34
3v30_A172 DNA-binding protein rfxank; structural genomics co 4e-33
3v30_A172 DNA-binding protein rfxank; structural genomics co 8e-33
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-27
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-23
3v30_A172 DNA-binding protein rfxank; structural genomics co 5e-19
2rfa_A232 Transient receptor potential cation channel subfa 2e-33
2rfa_A232 Transient receptor potential cation channel subfa 8e-32
2rfa_A232 Transient receptor potential cation channel subfa 1e-23
2rfa_A232 Transient receptor potential cation channel subfa 2e-18
2rfa_A232 Transient receptor potential cation channel subfa 1e-12
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 5e-33
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-25
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-32
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 6e-32
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-29
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-28
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-16
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 7e-13
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-09
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-32
3v31_A167 Ankyrin repeat family A protein 2; structural geno 6e-30
3v31_A167 Ankyrin repeat family A protein 2; structural geno 8e-29
3v31_A167 Ankyrin repeat family A protein 2; structural geno 9e-22
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-18
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-32
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-29
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-29
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-27
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 9e-15
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 5e-31
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-26
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-20
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-29
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-24
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-21
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 4e-17
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 8e-14
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-05
2etb_A256 Transient receptor potential cation channel subfam 2e-29
2etb_A256 Transient receptor potential cation channel subfam 2e-25
2etb_A256 Transient receptor potential cation channel subfam 4e-21
2etb_A256 Transient receptor potential cation channel subfam 2e-18
2etb_A256 Transient receptor potential cation channel subfam 2e-14
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-28
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-27
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 8e-27
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 6e-21
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-17
2pnn_A273 Transient receptor potential cation channel subfa 2e-28
2pnn_A273 Transient receptor potential cation channel subfa 2e-25
2pnn_A273 Transient receptor potential cation channel subfa 4e-20
2pnn_A273 Transient receptor potential cation channel subfa 2e-07
2pnn_A273 Transient receptor potential cation channel subfa 3e-06
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-28
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 7e-26
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 8e-17
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-12
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 5e-05
3deo_A183 Signal recognition particle 43 kDa protein; chloro 6e-28
3deo_A183 Signal recognition particle 43 kDa protein; chloro 4e-27
3deo_A183 Signal recognition particle 43 kDa protein; chloro 4e-27
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-21
3deo_A183 Signal recognition particle 43 kDa protein; chloro 5e-21
3deo_A183 Signal recognition particle 43 kDa protein; chloro 5e-15
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-09
1awc_B153 Protein (GA binding protein beta 1); complex (tran 7e-28
1awc_B153 Protein (GA binding protein beta 1); complex (tran 6e-26
1awc_B153 Protein (GA binding protein beta 1); complex (tran 3e-25
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-20
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-07
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-27
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-24
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-22
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-19
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-10
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-27
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-26
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 5e-26
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 6e-20
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-05
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-25
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-23
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-22
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-22
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-18
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-16
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 8e-25
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 3e-23
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-18
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-16
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-12
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 4e-08
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-24
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-22
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-21
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 6e-20
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 8e-16
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-08
3jxi_A260 Vanilloid receptor-related osmotically activated p 6e-23
3jxi_A260 Vanilloid receptor-related osmotically activated p 6e-21
3jxi_A260 Vanilloid receptor-related osmotically activated p 3e-20
3jxi_A260 Vanilloid receptor-related osmotically activated p 7e-18
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-22
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 3e-22
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-21
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 7e-14
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-21
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-18
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-18
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-15
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-21
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 4e-21
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 7e-21
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-18
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 3e-21
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 6e-21
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 9e-17
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-12
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 5e-11
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-21
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-16
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 6e-16
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 3e-14
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 8e-10
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 4e-21
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-20
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-19
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 9e-17
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 7e-14
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 5e-07
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-20
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-18
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-18
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-16
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 9e-13
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 8e-10
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 7e-17
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-15
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-15
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 9e-15
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 6e-10
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-05
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-08
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 9e-07
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-06
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 2e-05
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 8e-05
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-04
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 2e-04
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 4e-05
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 5e-04
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 3e-04
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 4e-04
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 8e-04
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
 Score =  174 bits (444), Expect = 3e-48
 Identities = 80/283 (28%), Positives = 113/283 (39%), Gaps = 60/283 (21%)

Query: 118 KTNTKGETLLHIAARHGHADVVKDLIAECKKPHQNDPEKGVEAVRLMQGMTNEAKD---- 173
            +N K ET LH+AAR GH +V K L+           +   +           AK     
Sbjct: 42  VSNVKVETPLHMAARAGHTEVAKYLL-----------QNKAKV---------NAKAKDDQ 81

Query: 174 TALHEAARYNQIDVVKMLTKEDPSLPYDAN-----NAGETPLYVAAERGYKDVTQDILLT 228
           T LH AAR    ++VK+L      L  +AN      AG TPL++AA  G+ +     LL 
Sbjct: 82  TPLHCAARIGHTNMVKLL------LENNANPNLATTAGHTPLHIAAREGHVETVL-ALL- 133

Query: 229 CKSPADHGP-------MGRTALHAAAFRNDTEMTKVLLDSSIGTQTSKADQQGWLPLHLA 281
                +           G T LH AA      + ++LL+       + A + G  PLH+A
Sbjct: 134 -----EKEASQACMTKKGFTPLHVAAKYGKVRVAELLLER--DAHPNAAGKNGLTPLHVA 186

Query: 282 AHLGYYNVVKELLK--ADKSAAYKADNEGKIPLHLAAGKGRLNTVQELIMSCPSSCELVD 339
            H    ++VK LL       +       G  PLH+AA + ++   + L+     S     
Sbjct: 187 VHHNNLDIVKLLLPRGGSPHS---PAWNGYTPLHIAAKQNQVEVARSLL-QYGGSANAES 242

Query: 340 DRGWNVFHFALQSGSRRTIELLLKSPSLGNLVNEKNDDGNTPL 382
            +G    H A Q G    + LLL   S     N  N  G TPL
Sbjct: 243 VQGVTPLHLAAQEGHAEMVALLL---SKQANGNLGNKSGLTPL 282
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query663
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.98
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.97
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.97
2rfa_A232 Transient receptor potential cation channel subfa 99.97
2rfa_A232 Transient receptor potential cation channel subfa 99.97
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.97
3hra_A201 Ankyrin repeat family protein; structural protein; 99.97
3hra_A201 Ankyrin repeat family protein; structural protein; 99.96
2pnn_A273 Transient receptor potential cation channel subfa 99.96
2etb_A256 Transient receptor potential cation channel subfam 99.96
2pnn_A273 Transient receptor potential cation channel subfa 99.96
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.95
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.95
2etb_A256 Transient receptor potential cation channel subfam 99.95
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.95
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.94
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.94
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.94
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.93
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.93
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.93
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.93
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.93
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.93
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.93
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.93
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.93
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.92
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.92
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.92
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.92
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.92
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.92
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.92
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.92
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.92
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.91
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.91
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.91
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.91
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.91
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.89
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.86
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.86
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.85
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.85
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.85
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.84
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.84
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.83
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.83
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.83
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.83
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.83
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.82
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.81
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.81
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.8
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.8
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.79
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.78
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.78
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.78
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.77
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.76
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.73
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.73
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.7
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.7
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.7
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.7
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.68
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.68
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.67
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.53
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.53
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
Probab=100.00  E-value=4.6e-52  Score=449.69  Aligned_cols=366  Identities=25%  Similarity=0.297  Sum_probs=301.3

Q ss_pred             CCCccccchhhchHHHHHHHHcCChhHHHhhhhccccc--cccCCCcceeeecccCCCCccccccccchhhhhhhccccc
Q 006054           19 GRLSVREKNFELMDSLYKAAVEGHTDQFRAHATMLDQI--LTPNENTILHIHITARPNQTMKSNNKLKSSLWRMMSTFKK   96 (663)
Q Consensus        19 ~~~~~~~~~~~~~~~L~~Aa~~g~~~~v~~Ll~~~~~~--~~~~g~t~Lh~A~~a~~g~~~~~~~~~~iv~~Ll~~~~~~   96 (663)
                      .|++++..+..|.||||.||..|+.+++++|++.+.++  .+..|.||||+|  +..|+       .+++++|++.|++ 
T Consensus         3 ~g~~~~~~~~~g~t~L~~Aa~~g~~~~v~~Ll~~g~~~~~~~~~~~t~L~~A--~~~g~-------~~~v~~Ll~~g~~-   72 (437)
T 1n11_A            3 PGISGGGGGESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMA--ARAGH-------TEVAKYLLQNKAK-   72 (437)
T ss_dssp             ------------CCHHHHHHHHTCHHHHHHHHHTTCCSCCSSSCCCCHHHHH--HHHTC-------HHHHHHHHHHTCC-
T ss_pred             CCCCccccCCCCCCHHHHHHHCCCHHHHHHHHHcCCCCCCCCCCCCCHHHHH--HHcCC-------HHHHHHHHhCCCC-
Confidence            45677777888888888888888888888888875544  677788888888  88888       8888888733222 


Q ss_pred             cCCCcchhhhhhhhcChhhhhccCCCCCcHHHHHHHhccHHHHHHHHHhcCCCCCCCCcch-----------hHHHHHHh
Q 006054           97 QSSSSEHFGRDILEMCPGLLLKTNTKGETLLHIAARHGHADVVKDLIAECKKPHQNDPEKG-----------VEAVRLMQ  165 (663)
Q Consensus        97 ~~~~~~~~g~~~~~~~~~ll~~~~~~g~T~Lh~A~~~g~~~iv~~Ll~~~~~~~~~~~~~~-----------~~~~~~~l  165 (663)
                                         ++..+.+|.||||+|+..|+.++|++|+++|++++..+....           .+.+..++
T Consensus        73 -------------------~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~ga~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll  133 (437)
T 1n11_A           73 -------------------VNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALL  133 (437)
T ss_dssp             -------------------SSCCCTTSCCHHHHHHHHTCHHHHHHHHHHTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHH
T ss_pred             -------------------CCCCCCCCCCHHHHHHHCCCHHHHHHHHhCCCCCCCCCCCCCcHHHHHHHcCCHHHHHHHH
Confidence                               345666777777777777777777777777777665443221           11222222


Q ss_pred             ------hCCCcCCChHHHHHHHcCCHHHHHHHHHcCCCCCCCCCCCCCcHHHHHHHcCCHHHHHHHHHhCCCCCCCCCCC
Q 006054          166 ------GMTNEAKDTALHEAARYNQIDVVKMLTKEDPSLPYDANNAGETPLYVAAERGYKDVTQDILLTCKSPADHGPMG  239 (663)
Q Consensus       166 ------~~~~~~g~t~L~~A~~~g~~~iv~~Ll~~~~~~~~~~~~~g~tpL~~A~~~g~~eiv~~Ll~~~~~~~~~~~~g  239 (663)
                            ...+..|.||||+|+..|+.+++++|++.+.+.. ..+..|.||||+|+..|+.+++++|+++|.+++..+..|
T Consensus       134 ~~~~~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~g~~~~-~~~~~g~t~L~~A~~~~~~~~v~~Ll~~g~~~~~~~~~g  212 (437)
T 1n11_A          134 EKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPN-AAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNG  212 (437)
T ss_dssp             HTTCCSCCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTT-CCCSSCCCHHHHHHHTTCHHHHHHHGGGTCCSCCCCTTC
T ss_pred             hCCCCCcCCCCCCCCHHHHHHHcCCHHHHHHHHhCCCCCC-CCCCCCCCHHHHHHHcCCHHHHHHHHhCCCCCCCcCCCC
Confidence                  2346778999999999999999999999988765 577889999999999999999999999999999999999


Q ss_pred             CCHHHHHHhcCCHHHHHHHHhcccCCCCCcCCCCCChHHHHHHHcCCHHHHHHHHhcCccccccCCCCCChHHHHHHhcC
Q 006054          240 RTALHAAAFRNDTEMTKVLLDSSIGTQTSKADQQGWLPLHLAAHLGYYNVVKELLKADKSAAYKADNEGKIPLHLAAGKG  319 (663)
Q Consensus       240 ~t~L~~A~~~~~~~~v~~Ll~~~~g~~~~~~d~~g~tpLh~A~~~g~~~iv~~Ll~~~~~~~~~~~~~g~tpLh~Aa~~g  319 (663)
                      .||||.|+..++.+++++|++.  |.+++..+..|.||||+|+..|+.+++++|++++.+. +..+..|.||||+|+..|
T Consensus       213 ~t~L~~A~~~~~~~~~~~Ll~~--g~~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~~~~~-~~~~~~g~t~L~~A~~~~  289 (437)
T 1n11_A          213 YTPLHIAAKQNQVEVARSLLQY--GGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANG-NLGNKSGLTPLHLVAQEG  289 (437)
T ss_dssp             CCHHHHHHHTTCHHHHHHHHHT--TCCTTCCCTTCCCHHHHHHHTTCHHHHHHHHTTTCCT-TCCCTTCCCHHHHHHHHT
T ss_pred             CCHHHHHHHcCCHHHHHHHHHc--CCCCCCCCCCCCCHHHHHHHCCCHHHHHHHHhcCCCC-CCCCCCCCCHHHHHHHcC
Confidence            9999999999999999999998  7888999999999999999999999999999998877 677889999999999999


Q ss_pred             CHHHHHHHHHcCCCCcccccCCCCcHHHHHHHcCCHHHHHHHHhCCCCCCCCCCCCCCCCcHHHHHHhCCCccc-ccccc
Q 006054          320 RLNTVQELIMSCPSSCELVDDRGWNVFHFALQSGSRRTIELLLKSPSLGNLVNEKNDDGNTPLLEHAGSGSLIP-SFVCH  398 (663)
Q Consensus       320 ~~~~v~~Ll~~~~~~~~~~d~~g~t~Lh~Av~~~~~~iv~~Ll~~~~~~~~in~~d~~G~TpLhlA~~~~~~~~-~lL~~  398 (663)
                      +.+++++|++.+.+. +..|..|+||||+|+.+|+.+++++|+++   |+++|.+|..|+||||+|+..++... ++|++
T Consensus       290 ~~~~~~~Ll~~g~~~-~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~---gad~n~~~~~g~t~L~~A~~~g~~~iv~~Ll~  365 (437)
T 1n11_A          290 HVPVADVLIKHGVMV-DATTRMGYTPLHVASHYGNIKLVKFLLQH---QADVNAKTKLGYSPLHQAAQQGHTDIVTLLLK  365 (437)
T ss_dssp             CHHHHHHHHHHTCCT-TCCCSSCCCHHHHHHHSSCSHHHHHHHHT---TCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHH
T ss_pred             CHHHHHHHHhCCccC-CCCCCCCCCHHHHHHHcCcHHHHHHHHhc---CCCCCCCCCCCCCHHHHHHHCChHHHHHHHHH
Confidence            999999999997765 77899999999999999999999999999   89999999999999999999997755 99999


Q ss_pred             cCcCccccccCCCChHHHHhhcc
Q 006054          399 PKVDRLAFNQNNCSAEDIIRSDK  421 (663)
Q Consensus       399 ~~ad~~~~n~~g~t~l~ia~~~~  421 (663)
                      +|++++.+|.+|.||+++|...+
T Consensus       366 ~ga~~~~~~~~g~t~l~~A~~~g  388 (437)
T 1n11_A          366 NGASPNEVSSDGTTPLAIAKRLG  388 (437)
T ss_dssp             TTCCSCCCCSSSCCHHHHHHHTT
T ss_pred             CcCCCCCCCCCCCCHHHHHHHcC
Confidence            99999999999999999998654
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 663
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-26
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-26
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 7e-25
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-24
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-23
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 9e-26
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-22
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-13
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-22
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-15
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-10
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 5e-21
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-19
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 6e-13
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-18
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-14
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-12
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-18
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-09
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-08
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 9e-07
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-17
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 7e-10
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-06
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-16
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-09
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 7e-04
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 3e-16
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 8e-09
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9e-06
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 0.003
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 0.003
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 4e-13
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 4e-09
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-07
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 8e-04
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 9e-13
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 3e-09
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 7e-09
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 6e-12
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 1e-10
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 5e-06
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 0.003
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 7e-11
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 5e-05
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 3e-04
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 7e-09
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 5e-05
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 1e-08
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-06
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-06
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 1e-06
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 2e-05
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 9e-04
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 4e-06
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 1e-05
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 4e-05
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 1e-04
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 0.001
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 2e-04
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 4e-04
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 0.002
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  110 bits (276), Expect = 1e-26
 Identities = 90/371 (24%), Positives = 140/371 (37%), Gaps = 38/371 (10%)

Query: 22  SVREKNFELMDSLYKAAVEGHTD------QFRAHATMLDQILTPNENTILHIHI----TA 71
           S    N ++   L+ AA  GHT+      Q +A      +    ++ T LH       T 
Sbjct: 25  SPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAK----DDQTPLHCAARIGHTN 80

Query: 72  RPNQTMKSNNKLKSSLWRMMSTFKKQSSSSEHFGRDILEMCPGLLLKTNTKGETLLHIAA 131
                +++N     +     +     +          L            KG T LH+AA
Sbjct: 81  MVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAA 140

Query: 132 RHGHADVVKDLIAECKKPHQNDPEKGVEAVRLMQGMTNEAKDTALHEAARYNQIDVVKML 191
           ++G   V + L+     P+                       T LH A  +N +D+VK+L
Sbjct: 141 KYGKVRVAELLLERDAHPNAAGKNG----------------LTPLHVAVHHNNLDIVKLL 184

Query: 192 TKEDPSLPYDANNAGETPLYVAAERGYKDVTQDILLTCKSPADHGPMGRTALHAAAFRND 251
                S P+     G TPL++AA++   +V + +L    S       G T LH AA    
Sbjct: 185 LPRGGS-PHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGH 243

Query: 252 TEMTKVLLDSSIGTQTSKADQQGWLPLHLAAHLGYYNVVKELLKADKSAAYKADNEGKIP 311
            EM  +    S     +  ++ G  PLHL A  G+  V   L+K            G  P
Sbjct: 244 AEMVAL--LLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMV-DATTRMGYTP 300

Query: 312 LHLAAGKGRLNTVQELIMSCPSSCELVDDRGWNVFHFALQSGSRRTIELLLKSPSLGNLV 371
           LH+A+  G +  V + ++   +        G++  H A Q G    + LLLK+   G   
Sbjct: 301 LHVASHYGNIKLV-KFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKN---GASP 356

Query: 372 NEKNDDGNTPL 382
           NE + DG TPL
Sbjct: 357 NEVSSDGTTPL 367
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query663
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.98
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.98
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.97
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.97
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.97
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.96
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.96
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.96
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.95
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.95
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.94
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.94
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.93
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.93
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.9
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.9
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.9
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.89
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.89
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.88
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.88
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.88
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.87
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.86
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.83
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.81
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.81
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.79
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.77
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.75
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.74
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.72
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=7e-44  Score=378.93  Aligned_cols=355  Identities=25%  Similarity=0.306  Sum_probs=314.0

Q ss_pred             hHHHHHHHHcCChhHHHhhhhccccc--cccCCCcceeeecccCCCCccccccccchhhhhhhccccccCCCcchhhhhh
Q 006054           31 MDSLYKAAVEGHTDQFRAHATMLDQI--LTPNENTILHIHITARPNQTMKSNNKLKSSLWRMMSTFKKQSSSSEHFGRDI  108 (663)
Q Consensus        31 ~~~L~~Aa~~g~~~~v~~Ll~~~~~~--~~~~g~t~Lh~A~~a~~g~~~~~~~~~~iv~~Ll~~~~~~~~~~~~~~g~~~  108 (663)
                      +||||.||..|+.++|++|++.|.++  .|..|+||||+|  |..|+       .+++++|++.|++             
T Consensus         1 ~TpL~~Aa~~g~~~~v~~Ll~~g~~in~~d~~g~TpL~~A--~~~g~-------~~iv~~Ll~~gad-------------   58 (408)
T d1n11a_           1 LTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMA--ARAGH-------TEVAKYLLQNKAK-------------   58 (408)
T ss_dssp             CCHHHHHHHHTCHHHHHHHHHTTCCSCCSSSCCCCHHHHH--HHHTC-------HHHHHHHHHHTCC-------------
T ss_pred             CChHHHHHHCcCHHHHHHHHHCCCCCCCCCCCCCCHHHHH--HHcCC-------HHHHHHHHHCcCC-------------
Confidence            48999999999999999999997655  899999999999  99999       9999999943332             


Q ss_pred             hhcChhhhhccCCCCCcHHHHHHHhccHHHHHHHHHhcCCCCCCCCcchhHH-----------------HHHHhhCCCcC
Q 006054          109 LEMCPGLLLKTNTKGETLLHIAARHGHADVVKDLIAECKKPHQNDPEKGVEA-----------------VRLMQGMTNEA  171 (663)
Q Consensus       109 ~~~~~~ll~~~~~~g~T~Lh~A~~~g~~~iv~~Ll~~~~~~~~~~~~~~~~~-----------------~~~~l~~~~~~  171 (663)
                             ++..+.+|.||||+|+..|+.+++++|++.+.+............                 ........+..
T Consensus        59 -------i~~~~~~g~t~L~~A~~~g~~~~~~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  131 (408)
T d1n11a_          59 -------VNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKK  131 (408)
T ss_dssp             -------SSCCCTTSCCHHHHHHHHTCHHHHHHHHHHTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHTTCCSCCCCTT
T ss_pred             -------CCCCCCCCCCHHHHHHHcCCHHHHHHHHHhhhccccccccccchhhhhhhhcccccccccccccccccccccc
Confidence                   467788999999999999999999999998877654333221110                 00122445678


Q ss_pred             CChHHHHHHHcCCHHHHHHHHHcCCCCCCCCCCCCCcHHHHHHHcCCHHHHHHHHHhCCCCCCCCCCCCCHHHHHHhcCC
Q 006054          172 KDTALHEAARYNQIDVVKMLTKEDPSLPYDANNAGETPLYVAAERGYKDVTQDILLTCKSPADHGPMGRTALHAAAFRND  251 (663)
Q Consensus       172 g~t~L~~A~~~g~~~iv~~Ll~~~~~~~~~~~~~g~tpL~~A~~~g~~eiv~~Ll~~~~~~~~~~~~g~t~L~~A~~~~~  251 (663)
                      +.++++.|+..++.++++.|++.+.+.. ..+..|.+||++|+..|+.+++++|+.+|++++..+..|.||+|.++....
T Consensus       132 ~~~~l~~a~~~~~~~~v~~ll~~~~~~~-~~~~~~~~~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~~~~t~l~~~~~~~~  210 (408)
T d1n11a_         132 GFTPLHVAAKYGKVRVAELLLERDAHPN-AAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQ  210 (408)
T ss_dssp             SCCHHHHHHHTTCHHHHHHHHHTTCCTT-CCCSSCCCHHHHHHHTTCHHHHHHHGGGTCCSCCCCTTCCCHHHHHHHTTC
T ss_pred             cchHHHHHHHcCCHHHHHHHHHcCCCCC-cCCCcCchHHHHHHHcCCHHHHHHHHhcCCcccccCCCCCCcchhhhccch
Confidence            8999999999999999999999988765 577889999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhcccCCCCCcCCCCCChHHHHHHHcCCHHHHHHHHhcCccccccCCCCCChHHHHHHhcCCHHHHHHHHHcC
Q 006054          252 TEMTKVLLDSSIGTQTSKADQQGWLPLHLAAHLGYYNVVKELLKADKSAAYKADNEGKIPLHLAAGKGRLNTVQELIMSC  331 (663)
Q Consensus       252 ~~~v~~Ll~~~~g~~~~~~d~~g~tpLh~A~~~g~~~iv~~Ll~~~~~~~~~~~~~g~tpLh~Aa~~g~~~~v~~Ll~~~  331 (663)
                      .++...++..  +......+.++.||||.|+..++.++++.+.+..... +..+..|.+|++.|+..++.+++++|++.+
T Consensus       211 ~~~~~~l~~~--~~~~~~~~~~~~t~l~~a~~~~~~~~~~~~~~~~~~~-~~~~~~g~~~l~~a~~~~~~~i~~~Ll~~g  287 (408)
T d1n11a_         211 VEVARSLLQY--GGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANG-NLGNKSGLTPLHLVAQEGHVPVADVLIKHG  287 (408)
T ss_dssp             HHHHHHHHHT--TCCTTCCCTTCCCHHHHHHHTTCHHHHHHHHTTTCCT-TCCCTTCCCHHHHHHHHTCHHHHHHHHHHT
T ss_pred             hhhhhhhhhc--cccccccCCCCCCHHHHHHHhCcHhHhhhhhcccccc-ccccCCCCChhhhhhhcCcHHHHHHHHHCC
Confidence            9999999987  5677778889999999999999999999999987766 667889999999999999999999999988


Q ss_pred             CCCcccccCCCCcHHHHHHHcCCHHHHHHHHhCCCCCCCCCCCCCCCCcHHHHHHhCCCccc-ccccccCcCccccccCC
Q 006054          332 PSSCELVDDRGWNVFHFALQSGSRRTIELLLKSPSLGNLVNEKNDDGNTPLLEHAGSGSLIP-SFVCHPKVDRLAFNQNN  410 (663)
Q Consensus       332 ~~~~~~~d~~g~t~Lh~Av~~~~~~iv~~Ll~~~~~~~~in~~d~~G~TpLhlA~~~~~~~~-~lL~~~~ad~~~~n~~g  410 (663)
                      .+. +..+..+.||||.|+..++.++++++++.   |+++|.+|.+|+||||+|++.|+... ++|+++|+|++.+|++|
T Consensus       288 ~~~-~~~~~~~~t~L~~~~~~~~~~~~~~ll~~---g~~in~~d~~G~T~Lh~A~~~g~~~iv~~Ll~~GAd~n~~d~~G  363 (408)
T d1n11a_         288 VMV-DATTRMGYTPLHVASHYGNIKLVKFLLQH---QADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDG  363 (408)
T ss_dssp             CCT-TCCCSSCCCHHHHHHHSSCSHHHHHHHHT---TCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCSCCCCSSS
T ss_pred             Ccc-ccccccccccchhhcccCcceeeeeeccc---cccccccCCCCCCHHHHHHHcCCHHHHHHHHHCCCCCCCCCCCC
Confidence            765 67788999999999999999999999998   89999999999999999999997755 99999999999999999


Q ss_pred             CChHHHHhhccc
Q 006054          411 CSAEDIIRSDKL  422 (663)
Q Consensus       411 ~t~l~ia~~~~~  422 (663)
                      .||+|+|...+.
T Consensus       364 ~t~L~~A~~~~~  375 (408)
T d1n11a_         364 TTPLAIAKRLGY  375 (408)
T ss_dssp             CCHHHHHHHTTC
T ss_pred             CCHHHHHHHcCC
Confidence            999999987543
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure