Citrus Sinensis ID: 006094

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-
MAQDTSSGADSPRRRPGLLRDQVQLVKKKDSDRYEIVPIEDTLSFEKGFFIVIRACQLLAQKNHGIILVGVAGPSGAGKTVFTEKVLNFMPSIAVITMDNYNDSSRIIDGNFDDPRLTDYDTLLENIRGLKEGKAVQVPIYDFKSSSRIGYRTLEVPSSRIVIIEGIYALSEKLRPLIDLRVSVTGGVHFDLVKRVFRDIQRVGQEPEEIIHQISETVYPMYKAFIEPDLQTAHIKIINKFNPFTGFQNPTYILKSTRPVTVDEIKAVMSKEHTETTEETYDIYLLPPGEDPDACQSYLRMRNRDGKYNLMFEEWVTDSPFIISPRITFEVSVRLLGGLMALGYTIATILKRSSHIFYDDRVCVKTDWLEQLNRKYVQVQGRDRLYVKYVGEQLGLDGSYVPRTYIEQIQLEKLVNDVMALPDDLKTKLSIDDDLVSSPKEALSRASADRRTKYLSRSISNSFSNQREKNLTKLARVAVNNRRFDGRTPESPASLANQGVINQLSEQISTLNERMDEFTSRIEEMNTKFAIRKVSASQQNLALQAEACNGSGPTSLFMTGLANGSLTGSVLPNSSSSSQLARESPLMEEVLLVARGQRQIMHQLDSISNLLHEYWGERTRQERTDRPSRVIDVDSIGVPLILTLAVGGLGLFLFKGLTFHK
cccccccccccccccccccHHHHHHEEccccccEEEEEccccccccccEEHHHHHHHHHHHccccEEEEEEEccccccHHHHHHHHHHHcccEEEEcccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccEEEEcccEEEEEEEEEEccccHHcccccEEEEEcccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccHHHHcccccccccEEEcccccccccccHHHHHHHccccccHHHHHHHHHccccccccccccEEEccccccccccccEEEEEccccEEEEEEEcccccccEEEccccEEEEEHHHHHcHHHcccHHHHHHHHccccEEccEEEEEEccccccccccEEEEcccHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccHHHHHHHHHcHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHEEcccEEEEEEccccccc
cccccccccccccccccccHHHHHHEccccccEEEEEEcccccccHHHHHHHHHHHHHHHHcccccEEEEEEcccHHHHHHHHHHHHHHcccEEEEEccccccHHHHHcccccccccccHHHHHHHHHHHHcccccEEEEEEEEEccccccEEEEEccccEEEEEEHHHHHHHHHHHccEEEEEEcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccEEEEEEEcccccccccccHEEEEEEEEEEcHHHHHHHHHHHHHHHHcccccEEEEccccccccccHHEEEcccccccEEEEccccccccEEEEccEEEEEEHHHHHHHHHHccEEEEEEEEEEEEEEccEEEEEEccHHcccccEEEEEcccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcccHHHHHcccccHHccccccHHHcHccHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHccccccccccccccccccEEEEEccccccccccccccccccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccEcHHHHHHHHHHHHHHHHHHHHHHHcccccc
maqdtssgadsprrrpgllrdQVQLvkkkdsdryeivpiedtlsfEKGFFIVIRACQLLAQKNHGIILvgvagpsgagktvFTEKVLNFMPSIAVITmdnyndssriidgnfddprltdyDTLLENIRglkegkavqvpiydfksssrigyrtlevpssrIVIIEGIYALSEKLRPLIDLRVSVTGGVHFDLVKRVFRDIQRVGQEPEEIIHQISETVYPmykafiepdlQTAHIKIInkfnpftgfqnptyilkstrpvTVDEIKAVMskehtetteetydiyllppgedpdacQSYLRMRNRDGKYNLMFEewvtdspfiispriTFEVSVRLLGGLMALGYTIATILKRsshifyddrvcvkTDWLEQLNRKYVQVQGRDRLYVKYVGEqlgldgsyvprtyIEQIQLEKLVNDVmalpddlktklsidddlvsspkeaLSRASADRRTKYLSRSISNSFSNQREKNLTKLARVAVNnrrfdgrtpespaslanQGVINQLSEQISTLNERMDEFTSRIEEMNTKFAIRKVSASQQNLALQAeacngsgptslfmtglangsltgsvlpnsssssqlarespLMEEVLLVARGQRQIMHQLDSISNLLHEYwgertrqertdrpsrvidvdsigVPLILTLAVGGLGLFLFKGLTFHK
maqdtssgadsprrrpgllrdqvqlvkkkdsdryeivPIEDTLSFEKGFFIVIRACQLLAQKNHGIILVGVAGPSGAGKTVFTEKVLNFMPSIAVITMDNYNDSSRIIDGNFDDPRLTDYDTLLENirglkegkavqvpiydfksssrigyrtlevpssrivIIEGIYALSEKLRPLIDLRVSVTGGVHFDLVKRVFRdiqrvgqepeEIIHQISETVYPMYKAFIEPDLQTAHIKIINKFNPFTGFQNPTYILKSTRPVTVDEIKAVmskehtetteetydiyllppgeDPDACQSYLRMRNRDGKYNLMFEEWVTDSPFIISPRITFEVSVRLLGGLMALGYTIATILKRSSHIFYDDRVCVKTDWLEQLNRkyvqvqgrdrLYVKYVGEqlgldgsyvPRTYIEQIQLEKLVNDVMALPDDLKTklsidddlvsspkealsrasadrrtkylsrsisnsfsnqreknltklARVAVNnrrfdgrtpespaslanqgvINQLSEQISTLNERMDEFTSRIEEMNTKFAIRKVSASQQNLALQAEACNGSGPTSLFMTGLANGSLTGSVLPNSSSSSQLARESPLMEEVLLVARGQRQIMHQLDSISNLLHEYWGErtrqertdrpsrvidvDSIGVPLILTLAVGGLGLFLFKGLTFHK
MAQDTSSGADSPRRRPGLLRDQVQLVKKKDSDRYEIVPIEDTLSFEKGFFIVIRACQLLAQKNHGIILVGVAGPSGAGKTVFTEKVLNFMPSIAVITMDNYNDSSRIIDGNFDDPRLTDYDTLLENIRGLKEGKAVQVPIYDFKSSSRIGYRTLEVPSSRIVIIEGIYALSEKLRPLIDLRVSVTGGVHFDLVKRVFRDIQRVGQEPEEIIHQISETVYPMYKAFIEPDLQTAHIKIINKFNPFTGFQNPTYILKSTRPVTVDEIKAVMSKEHTETTEETYDIYLLPPGEDPDACQSYLRMRNRDGKYNLMFEEWVTDSPFIISPRITFEVSVRLLGGLMALGYTIATILKRSSHIFYDDRVCVKTDWLEQLNRKYVQVQGRDRLYVKYVGEQLGLDGSYVPRTYIEQIQLEKLVNDVMALPDDLKTKLSIDDDLVSSPKEALSRASADRRTKYLSRSISNSFSNQREKNLTKLARVAVNNRRFDGRTPESPASLANQGVINQLSEQISTLNERMDEFTSRIEEMNTKFAIRKVSASQQNLALQAEACNGSGPTSLFMTGLANGSLTGSVLPNsssssQLARESPLMEEVLLVARGQRQIMHQLDSISNLLHEYWGERTRQERTDRPSRVIDVDSIGVPLIltlavgglglflfkgltfHK
*******************************DRYEIVPIEDTLSFEKGFFIVIRACQLLAQKNHGIILVGVAGPSGAGKTVFTEKVLNFMPSIAVITMDNYNDSSRIIDGNFDDPRLTDYDTLLENIRGLKEGKAVQVPIYDFKSSSRIGYRTLEVPSSRIVIIEGIYALSEKLRPLIDLRVSVTGGVHFDLVKRVFRDIQRVGQEPEEIIHQISETVYPMYKAFIEPDLQTAHIKIINKFNPFTGFQNPTYILKSTRPVTVDEIKAVMS*****TTEETYDIYLLPPGEDPDACQSYLRMRNRDGKYNLMFEEWVTDSPFIISPRITFEVSVRLLGGLMALGYTIATILKRSSHIFYDDRVCVKTDWLEQLNRKYVQVQGRDRLYVKYVGEQLGLDGSYVPRTYIEQIQLEKLVNDVMALPDDLK*******************************************************************************************************************************************************************VLLVARGQRQIMHQLDSISNLLHEYWGER**********RVIDVDSIGVPLILTLAVGGLGLFLFKGLTF**
*****************************************TLSFEKGFFIVIRACQLLAQKNHGIILVGVAGPSGAGKTVFTEKVLNFMPSIAVITMDNYNDSSRIIDGNFDDPRLTDYDTLLENIRGLKEGKAVQVPIYDFKSSSRIGYRTLEVPSSRIVIIEGIYALSEKLRPLIDLRVSVTGGVHFDLVKRVFRDIQRVGQEPEEIIHQISETVYPMYKAFIEPDLQTAHIKIINKFNPFTGFQNPTYILKSTRPVTVDE**************ETYDIYLLPPGEDPDACQSYLRMRNRDGKYNLMFEEWVTDSPFIISPRITFEVSVRLLGGLMALGYTIATILKRSSHIFYDDRVCVKTDWLEQLNRKYVQVQGRDRLYVKYVGEQLGLDGSYVPRTYIEQIQLEKLVNDVMA*******************************************************************************************NERMDEFTSRIEEMN************************SGPTSLFMTGLANGS************************VLLVARGQRQIMHQLDSISNLLHE*********************SIGVPLILTLAVGGLGLFLFKGLT***
**************RPGLLRDQVQLVKKKDSDRYEIVPIEDTLSFEKGFFIVIRACQLLAQKNHGIILVGVAGPSGAGKTVFTEKVLNFMPSIAVITMDNYNDSSRIIDGNFDDPRLTDYDTLLENIRGLKEGKAVQVPIYDFKSSSRIGYRTLEVPSSRIVIIEGIYALSEKLRPLIDLRVSVTGGVHFDLVKRVFRDIQRVGQEPEEIIHQISETVYPMYKAFIEPDLQTAHIKIINKFNPFTGFQNPTYILKSTRPVTVDEIKAVMSKEHTETTEETYDIYLLPPGEDPDACQSYLRMRNRDGKYNLMFEEWVTDSPFIISPRITFEVSVRLLGGLMALGYTIATILKRSSHIFYDDRVCVKTDWLEQLNRKYVQVQGRDRLYVKYVGEQLGLDGSYVPRTYIEQIQLEKLVNDVMALPDDLKTKLSIDDDL******************YLSRSISNSFSNQREKNLTKLARVAVNNRRFDGRTPESPASLANQGVINQLSEQISTLNERMDEFTSRIEEMNTKFAIRKVSASQQNLALQAEACNGSGPTSLFMTGLANGSLTGS***************PLMEEVLLVARGQRQIMHQLDSISNLLHEYWGE*********PSRVIDVDSIGVPLILTLAVGGLGLFLFKGLTFHK
****************GLLRDQVQLVKKKDSDRYEIVPIEDTLSFEKGFFIVIRACQLLAQKNHGIILVGVAGPSGAGKTVFTEKVLNFMPSIAVITMDNYNDSSRIIDGNFDDPRLTDYDTLLENIRGLKEGKAVQVPIYDFKSSSRIGYRTLEVPSSRIVIIEGIYALSEKLRPLIDLRVSVTGGVHFDLVKRVFRDIQRVGQEPEEIIHQISETVYPMYKAFIEPDLQTAHIKIINKFNPFTGFQNPTYILKSTRPVTVDEIKAVMSKEHTETTEETYDIYLLPPGEDPDACQSYLRMRNRDGKYNLMFEEWVTDSPFIISPRITFEVSVRLLGGLMALGYTIATILKRSSHIFYDDRVCVKTDWLEQLNRKYVQVQGRDRLYVKYVGEQLGLDGSYVPRTYIEQIQLEKLVNDVMALPDDLKTKLSIDDDLVSSP************************************************TPESPASLANQGVINQLSEQISTLNERMDEFTSRIEEMNTKFAI**VS***QNLALQA*ACNGSGPTSLFMTGLAN*SLTG***********LARESPLMEEVLLVARGQRQIMHQLDSISNLLHEYWG***********SRVIDVDSIGVPLILTLAVGGLGLFLFKGLT***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAQDTSSGADSPRRRPGLLRDQVQLVKKKDSDRYEIVPIEDTLSFEKGFFIVIRACQLLAQKNHGIILVGVAGPSGAGKTVFTEKVLNFMPSIAVITMDNYNDSSRIIDGNFDDPRLTDYDTLLENIRGLKEGKAVQVPIYDFKSSSRIGYRTLEVPSSRIVIIEGIYALSEKLRPLIDLRVSVTGGVHFDLVKRVFRDIQRVGQEPEEIIHQISETVYPMYKAFIEPDLQTAHIKIINKFNPFTGFQNPTYILKSTRPVTVDEIKAVMSKEHTETTEETYDIYLLPPGEDPDACQSYLRMRNRDGKYNLMFEEWVTDSPFIISPRITFEVSVRLLGGLMALGYTIATILKRSSHIFYDDRVCVKTDWLEQLNRKYVQVQGRDRLYVKYVGEQLGLDGSYVPRTYIEQIQLEKLVNDVMALPDDLKTKLSIDDDLVSSPKEALSRASADRRTKYLSRSISNSFSNQREKNLTKLARVAVNNRRFDGRTPESPASLANQGVxxxxxxxxxxxxxxxxxxxxxxxxxxxxFAIRKVSASQQNLALQAEACNGSGPTSLFMTGLANGSLTGSVLPNSSSSSQLARESPLMEEVLLVARGQRQIMHQLDSISNLLHEYWGERTRQERTDRPSRVIDVDSIGVPLILTLAVGGLGLFLFKGLTFHK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query661 2.2.26 [Sep-21-2011]
Q54R62449 Uridine-cytidine kinase C yes no 0.586 0.864 0.496 1e-113
Q9GNF0492 Uridine-cytidine kinase D no no 0.603 0.810 0.330 1e-65
Q9RXZ5210 Uridine kinase OS=Deinoco yes no 0.281 0.885 0.333 4e-21
A7MVE7213 Uridine kinase OS=Vibrio yes no 0.260 0.807 0.338 1e-20
B5ZBE2207 Uridine kinase OS=Ureapla yes no 0.258 0.826 0.302 4e-20
C1CXN1207 Uridine kinase OS=Deinoco yes no 0.281 0.898 0.323 6e-20
Q9PQF9207 Uridine kinase OS=Ureapla yes no 0.258 0.826 0.291 1e-19
B1AIX1207 Uridine kinase OS=Ureapla yes no 0.258 0.826 0.291 1e-19
Q9KDD8211 Uridine kinase OS=Bacillu yes no 0.296 0.928 0.338 2e-19
Q9KT67213 Uridine kinase OS=Vibrio yes no 0.261 0.812 0.336 3e-19
>sp|Q54R62|UCKC_DICDI Uridine-cytidine kinase C OS=Dictyostelium discoideum GN=udkC PE=3 SV=1 Back     alignment and function desciption
 Score =  408 bits (1049), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 197/397 (49%), Positives = 287/397 (72%), Gaps = 9/397 (2%)

Query: 22  QVQLVKKKDSD-RYEIVPIEDTLSFEKGFFIVIRACQLLAQKNHG-IILVGVAGPSGAGK 79
           +++++ + D D RY I P++DTLSF+KGFF+ +RA Q + +K+ G +I+VG+AGPSGAGK
Sbjct: 5   EIEVIPRPDKDDRYTIKPLKDTLSFDKGFFLAVRAIQSIRKKSQGSVIVVGIAGPSGAGK 64

Query: 80  TVFTEKVLNFMPSIAVITMDNYNDSSR-IIDGNFDDPRLTDYDTLLENIRGLKEGKAVQV 138
           T   +K+++ +P   +I++DNY DSSR II+ N+DD RL D++ L +NI  L   K   +
Sbjct: 65  TSIAQKIVSVLPKSILISLDNYLDSSRQIIEENYDDYRLVDFELLKKNISDLISNKPTDL 124

Query: 139 PIYDFKSSSRIGYRTLEVPSSRIVIIEGIYALSEKLRPLIDLRVSVTGGVHFDLVKRVFR 198
           P+YDF  S R  Y+ ++ P S++++IEGIYAL E++R L+DLRVS++GGVHFDL+KR+FR
Sbjct: 125 PLYDFTKSGRYAYKRVQPPESKVLLIEGIYALHEEIRHLLDLRVSISGGVHFDLIKRIFR 184

Query: 199 DIQRVGQEPEEIIHQISETVYPMYKAFIEPDLQTAHIKIINKFNPFTGFQNPTYILKSTR 258
           D+ R GQ+P E + QI++TVYPMYKAFIEPDLQ A I+++NKFNPF G  NP YILKS +
Sbjct: 185 DVHRTGQQPHESLQQITDTVYPMYKAFIEPDLQLAEIQVVNKFNPFGGLLNPIYILKSVK 244

Query: 259 P-VTVDEIKAVMSKEHT-ETTEETYDIYLLPPG---EDPDACQSYLRMRNRDGKYNLMFE 313
             VTVD I +V++K    E T   YDIYL+PP     +  +C  ++R+RN DG+Y++MF 
Sbjct: 245 QGVTVDMIHSVLNKSTIQENTARYYDIYLIPPNTTFANSSSC-DWIRVRNADGQYSIMFS 303

Query: 314 EWVTDSPFIISPRITFEVSVRLLGGLMALGYTIATILKRSSHIFYDDRVCVKTDWLEQLN 373
           E + + PFIISPR+ F V V +LGGLM+LGY +  I+ R S IF D ++ +  D LE+L 
Sbjct: 304 EEIKEGPFIISPRVDFVVGVNMLGGLMSLGYQMVAIIHRKSTIFKDGKIIISYDELEELG 363

Query: 374 RKYVQVQGRDRLYVKYVGEQLGLDGSYVPRTYIEQIQ 410
           + +VQ++G D   V+  G++LGL+ +Y+ ++YIE  Q
Sbjct: 364 QTFVQIKGFDATSVQEAGKKLGLENNYLQKSYIELYQ 400
Catalyzes the conversion of uridine into uridine monophosphate and cytidine into cytidine monophosphate in the pyrimidine salvage pathway.
Dictyostelium discoideum (taxid: 44689)
EC: 2EC: .EC: 7EC: .EC: 1EC: .EC: 4EC: 8
>sp|Q9GNF0|UCKD_DICDI Uridine-cytidine kinase D OS=Dictyostelium discoideum GN=udkD PE=2 SV=1 Back     alignment and function description
>sp|Q9RXZ5|URK_DEIRA Uridine kinase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=udk PE=3 SV=1 Back     alignment and function description
>sp|A7MVE7|URK_VIBHB Uridine kinase OS=Vibrio harveyi (strain ATCC BAA-1116 / BB120) GN=udk PE=3 SV=1 Back     alignment and function description
>sp|B5ZBE2|URK_UREU1 Uridine kinase OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=udk PE=3 SV=1 Back     alignment and function description
>sp|C1CXN1|URK_DEIDV Uridine kinase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=udk PE=3 SV=1 Back     alignment and function description
>sp|Q9PQF9|URK_UREPA Uridine kinase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=udk PE=3 SV=1 Back     alignment and function description
>sp|B1AIX1|URK_UREP2 Uridine kinase OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=udk PE=3 SV=1 Back     alignment and function description
>sp|Q9KDD8|URK_BACHD Uridine kinase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=udk PE=3 SV=1 Back     alignment and function description
>sp|Q9KT67|URK_VIBCH Uridine kinase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=udk PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query661
317106657661 JHL10I11.7 [Jatropha curcas] 1.0 1.0 0.874 0.0
255541904657 uridine cytidine kinase I, putative [Ric 0.993 1.0 0.857 0.0
225455758661 PREDICTED: uridine-cytidine kinase C [Vi 1.0 1.0 0.854 0.0
356511573660 PREDICTED: uridine-cytidine kinase C-lik 0.996 0.998 0.847 0.0
356562664661 PREDICTED: uridine-cytidine kinase C-lik 0.996 0.996 0.837 0.0
224130198658 predicted protein [Populus trichocarpa] 0.993 0.998 0.864 0.0
357477775688 Uridine-cytidine kinase C [Medicago trun 1.0 0.960 0.795 0.0
449440868664 PREDICTED: uridine-cytidine kinase C-lik 1.0 0.995 0.802 0.0
255546967657 uridine cytidine kinase I, putative [Ric 0.983 0.989 0.755 0.0
225425041663 PREDICTED: uridine-cytidine kinase C [Vi 0.990 0.987 0.762 0.0
>gi|317106657|dbj|BAJ53161.1| JHL10I11.7 [Jatropha curcas] Back     alignment and taxonomy information
 Score = 1213 bits (3138), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 578/661 (87%), Positives = 627/661 (94%)

Query: 1   MAQDTSSGADSPRRRPGLLRDQVQLVKKKDSDRYEIVPIEDTLSFEKGFFIVIRACQLLA 60
           MAQDT+ G +SPRRR GLLRDQVQLVKKKDSDRYEI PIEDTL+FEKGFF+VIRACQLLA
Sbjct: 1   MAQDTNHGIESPRRRSGLLRDQVQLVKKKDSDRYEIAPIEDTLAFEKGFFVVIRACQLLA 60

Query: 61  QKNHGIILVGVAGPSGAGKTVFTEKVLNFMPSIAVITMDNYNDSSRIIDGNFDDPRLTDY 120
           QKN GIILVGVAGPSGAGKTVFTEKVLNFMPSIAVITMDNYND+SRIIDGNFDDPRLTDY
Sbjct: 61  QKNDGIILVGVAGPSGAGKTVFTEKVLNFMPSIAVITMDNYNDASRIIDGNFDDPRLTDY 120

Query: 121 DTLLENIRGLKEGKAVQVPIYDFKSSSRIGYRTLEVPSSRIVIIEGIYALSEKLRPLIDL 180
           DTLL+NI GLK GKAVQVPIYDFK+SSR+GYRT+EVPSSRIVIIEGIYALSE+LRPL+DL
Sbjct: 121 DTLLDNIHGLKAGKAVQVPIYDFKTSSRVGYRTVEVPSSRIVIIEGIYALSERLRPLLDL 180

Query: 181 RVSVTGGVHFDLVKRVFRDIQRVGQEPEEIIHQISETVYPMYKAFIEPDLQTAHIKIINK 240
           RVS+TGGVHFDLVKRV RDIQR GQEPEEIIHQISETVYPMYKAFIEPDLQTAHIKIINK
Sbjct: 181 RVSITGGVHFDLVKRVLRDIQRAGQEPEEIIHQISETVYPMYKAFIEPDLQTAHIKIINK 240

Query: 241 FNPFTGFQNPTYILKSTRPVTVDEIKAVMSKEHTETTEETYDIYLLPPGEDPDACQSYLR 300
           FNPFTGFQ+PTYILKS R VT+++IKAVMS+E+TE  EETYDIYLLPPGEDP+ACQSYLR
Sbjct: 241 FNPFTGFQSPTYILKSARSVTLEQIKAVMSEEYTERNEETYDIYLLPPGEDPEACQSYLR 300

Query: 301 MRNRDGKYNLMFEEWVTDSPFIISPRITFEVSVRLLGGLMALGYTIATILKRSSHIFYDD 360
           MRNRDG+YNLMFEEWVTDSPFIISPRITFEVSVRLLGGLMALGYTIA ILKRSSH+F+D+
Sbjct: 301 MRNRDGQYNLMFEEWVTDSPFIISPRITFEVSVRLLGGLMALGYTIAAILKRSSHVFFDN 360

Query: 361 RVCVKTDWLEQLNRKYVQVQGRDRLYVKYVGEQLGLDGSYVPRTYIEQIQLEKLVNDVMA 420
           RVCVKTDWLEQLNR+YVQVQGRDRLYVKYV EQLGLDGSYVPRTYIEQIQLEKLVNDVMA
Sbjct: 361 RVCVKTDWLEQLNRQYVQVQGRDRLYVKYVAEQLGLDGSYVPRTYIEQIQLEKLVNDVMA 420

Query: 421 LPDDLKTKLSIDDDLVSSPKEALSRASADRRTKYLSRSISNSFSNQREKNLTKLARVAVN 480
           LPDDLKTKLSIDDDLVSSPKEALSRASADRR KYLSRS+S S++NQREKNL+KL R+AVN
Sbjct: 421 LPDDLKTKLSIDDDLVSSPKEALSRASADRRNKYLSRSVSLSYANQREKNLSKLTRLAVN 480

Query: 481 NRRFDGRTPESPASLANQGVINQLSEQISTLNERMDEFTSRIEEMNTKFAIRKVSASQQN 540
           NRRFDGRTPESPA+LANQGV+ QLSEQI+TLNERMDEFTSRIEE+N+KF +RKVSASQQN
Sbjct: 481 NRRFDGRTPESPATLANQGVVTQLSEQIATLNERMDEFTSRIEELNSKFTVRKVSASQQN 540

Query: 541 LALQAEACNGSGPTSLFMTGLANGSLTGSVLPNSSSSSQLARESPLMEEVLLVARGQRQI 600
           LA+QAEACNGSGPTS F+ GLANGSLTGS+LP SSSSSQLARESPLMEE++L+ARGQRQI
Sbjct: 541 LAMQAEACNGSGPTSAFVNGLANGSLTGSLLPTSSSSSQLARESPLMEEIVLIARGQRQI 600

Query: 601 MHQLDSISNLLHEYWGERTRQERTDRPSRVIDVDSIGVPLILTLAVGGLGLFLFKGLTFH 660
           MHQLD++SN LHE+WG R RQERTDR +R IDVDSI +PLI+TLA+GGLG FLF+G    
Sbjct: 601 MHQLDNLSNFLHEHWGGRARQERTDRINRAIDVDSIALPLIVTLAIGGLGAFLFRGFASQ 660

Query: 661 K 661
           K
Sbjct: 661 K 661

Source: Jatropha curcas

Species: Jatropha curcas

Genus: Jatropha

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255541904|ref|XP_002512016.1| uridine cytidine kinase I, putative [Ricinus communis] gi|223549196|gb|EEF50685.1| uridine cytidine kinase I, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225455758|ref|XP_002269501.1| PREDICTED: uridine-cytidine kinase C [Vitis vinifera] gi|297734126|emb|CBI15373.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356511573|ref|XP_003524499.1| PREDICTED: uridine-cytidine kinase C-like [Glycine max] Back     alignment and taxonomy information
>gi|356562664|ref|XP_003549589.1| PREDICTED: uridine-cytidine kinase C-like [Glycine max] Back     alignment and taxonomy information
>gi|224130198|ref|XP_002328678.1| predicted protein [Populus trichocarpa] gi|222838854|gb|EEE77205.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357477775|ref|XP_003609173.1| Uridine-cytidine kinase C [Medicago truncatula] gi|355510228|gb|AES91370.1| Uridine-cytidine kinase C [Medicago truncatula] Back     alignment and taxonomy information
>gi|449440868|ref|XP_004138206.1| PREDICTED: uridine-cytidine kinase C-like [Cucumis sativus] gi|449525411|ref|XP_004169711.1| PREDICTED: uridine-cytidine kinase C-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255546967|ref|XP_002514541.1| uridine cytidine kinase I, putative [Ricinus communis] gi|223546145|gb|EEF47647.1| uridine cytidine kinase I, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225425041|ref|XP_002270620.1| PREDICTED: uridine-cytidine kinase C [Vitis vinifera] gi|297738236|emb|CBI27437.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query661
TAIR|locus:2028809674 AT1G26190 [Arabidopsis thalian 0.937 0.919 0.739 5.7e-249
TAIR|locus:2031541643 AT1G73980 [Arabidopsis thalian 0.915 0.940 0.747 1.6e-235
DICTYBASE|DDB_G0283371449 udkC "adenylate cyclase domain 0.605 0.890 0.487 6.5e-106
DICTYBASE|DDB_G0271146492 udkD "adenylate cyclase domain 0.636 0.855 0.322 1.2e-63
UNIPROTKB|Q9KT67213 udk "Uridine kinase" [Vibrio c 0.261 0.812 0.336 6.1e-21
TIGR_CMR|VC_1038213 VC_1038 "uridine kinase" [Vibr 0.261 0.812 0.336 6.1e-21
UNIPROTKB|P0A8F4213 udk "uridine kinase / cytidine 0.266 0.826 0.289 4.2e-19
TIGR_CMR|CBU_0872215 CBU_0872 "uridine kinase" [Cox 0.260 0.8 0.322 8.8e-19
TIGR_CMR|SO_2617212 SO_2617 "uridine kinase" [Shew 0.254 0.792 0.307 3.9e-18
UNIPROTKB|F1NB19511 UCKL1 "Uridine kinase" [Gallus 0.254 0.328 0.313 1.7e-17
TAIR|locus:2028809 AT1G26190 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2398 (849.2 bits), Expect = 5.7e-249, P = 5.7e-249
 Identities = 465/629 (73%), Positives = 546/629 (86%)

Query:     1 MAQDTSSGADSPRRRPGLLRDQVQLVKKKDSDRYEIVPIEDTLSFEKGFFIVIRACQLLA 60
             M QD S+G +  ++R GLL+DQVQLVK++DS RYEIV I+D LSFEKGFF VIRACQLL+
Sbjct:     1 MGQD-SNGIEFHQKRHGLLKDQVQLVKRRDSIRYEIVSIQDRLSFEKGFFAVIRACQLLS 59

Query:    61 QKNHGIILVGVAGPSGAGKTVFTEKVLNFMPSIAVITMDNYNDSSRIIDGNFDDPRLTDY 120
             QKN GIILVGVAGPSGAGKTVFTEK+LNF+PS+AVI+MDNYNDSSRI+DGNFDDPRLTDY
Sbjct:    60 QKNDGIILVGVAGPSGAGKTVFTEKILNFLPSVAVISMDNYNDSSRIVDGNFDDPRLTDY 119

Query:   121 DTLLENIRGLKEGKAVQVPIYDFKSSSRIGYRTLEVPSSRIVIIEGIYALSEKLRPLIDL 180
             DTLL+N+  LKEGK V+VPIYDFKSSSR+GYRTL+VP SRIVIIEGIYALSEKLRPL+DL
Sbjct:   120 DTLLKNLEDLKEGKQVEVPIYDFKSSSRVGYRTLDVPPSRIVIIEGIYALSEKLRPLLDL 179

Query:   181 RVSVTGGVHFDLVKRVFRDIQRVGQEPEEIIHQISETVYPMYKAFIEPDLQTAHIKIINK 240
             RVSVTGGVHFDLVKRV RDIQR GQ+PEEIIHQISETVYPMYKAFIEPDLQTA IKIINK
Sbjct:   180 RVSVTGGVHFDLVKRVLRDIQRAGQQPEEIIHQISETVYPMYKAFIEPDLQTAQIKIINK 239

Query:   241 FNPFTGFQNPTYILKSTRPVTVDEIKAVMSKEHTETTEETYDIYLLPPGEDPDACQSYLR 300
             FNPFTGFQ+PTYILKS + V+VD+IKAV+S  HTET EETYDIYLLPPGEDP++CQSYLR
Sbjct:   240 FNPFTGFQSPTYILKSRKEVSVDQIKAVLSDGHTETKEETYDIYLLPPGEDPESCQSYLR 299

Query:   301 MRNRDGKYNLMFEEWVTDSPFIISPRITFEVSVRLLGGLMALGYTIATILKRSSHIFYDD 360
             MRN+DGKY+LMFEEWVTD+PF+ISPRITFEVSVRLLGGLMALGYTIATILKR+SH+F  D
Sbjct:   300 MRNKDGKYSLMFEEWVTDTPFVISPRITFEVSVRLLGGLMALGYTIATILKRNSHVFATD 359

Query:   361 RVCVKTDWLEQLNRKYVQVQGRDRLYVKYVGEQLGLDGSYVPRTYIEQIQLEKLVNDVMA 420
             +V VK DWLEQLNR Y+QVQG+DR  V+   EQLGL+GS++PRTYIEQIQLEKL+N+VMA
Sbjct:   360 KVFVKIDWLEQLNRHYMQVQGKDRQLVQSTAEQLGLEGSFIPRTYIEQIQLEKLINEVMA 419

Query:   421 LPDDLKTKLSIDDDLVSS--PKEALSRASADR---RTKYLSRSISNSFSNQREKNLTKLA 475
             LPDDLK KLS+D+DLVSS  PKEAL RASADR   R K L R +S+S+S QR+KNL+KLA
Sbjct:   420 LPDDLKNKLSLDEDLVSSSSPKEALLRASADRVAMRNKNLKRGMSHSYSTQRDKNLSKLA 479

Query:   476 RVAVNNRRFDGRTPESPASLANQGVINQLSEQISTLNERMDEFTSRIEEMNTKFAIRKVS 535
               + ++RR++ R  +SPA   N+G +  LSEQIS+LNERMDEFTSRIEE+N+K +  K S
Sbjct:   480 GYSSSDRRYEERNHDSPA---NEGFMTLLSEQISSLNERMDEFTSRIEELNSKLSCNKNS 536

Query:   536 ASQQNLALQAEACNGSGPTSLFMTGLANGSLTGSVLPNXXXXXQLARESPLMEEVLLVAR 595
              +QQ+L++Q E CNGS PTS F++GL NG LT S++P+     QLA++SPLMEE+  ++R
Sbjct:   537 PTQQSLSIQTEVCNGSAPTSYFISGLDNGCLTNSIMPHSSSSSQLAKDSPLMEEISTISR 596

Query:   596 GQRQIMHQLDSISNLLHEYWGERTRQERT 624
             GQRQ+MHQLD++ NL+ E   ER+R  RT
Sbjct:   597 GQRQVMHQLDNLCNLMRESSAERSRLART 625
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0006796 "phosphate-containing compound metabolic process" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0009058 "biosynthetic process" evidence=ISS
GO:0009507 "chloroplast" evidence=ISM
GO:0016301 "kinase activity" evidence=IEA;ISS
GO:0016773 "phosphotransferase activity, alcohol group as acceptor" evidence=IEA
GO:0009909 "regulation of flower development" evidence=RCA
GO:0016570 "histone modification" evidence=RCA
GO:0048449 "floral organ formation" evidence=RCA
TAIR|locus:2031541 AT1G73980 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0283371 udkC "adenylate cyclase domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0271146 udkD "adenylate cyclase domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KT67 udk "Uridine kinase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_1038 VC_1038 "uridine kinase" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
UNIPROTKB|P0A8F4 udk "uridine kinase / cytidine kinase" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_0872 CBU_0872 "uridine kinase" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
TIGR_CMR|SO_2617 SO_2617 "uridine kinase" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
UNIPROTKB|F1NB19 UCKL1 "Uridine kinase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.7.1.19LOW CONFIDENCE prediction!
4th Layer2.7.1.480.824
3rd Layer3.6.1.28LOW CONFIDENCE prediction!
3rd Layer2.7.10.766

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00017571001
SubName- Full=Chromosome chr17 scaffold_16, whole genome shotgun sequence; (661 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query661
PLN02318656 PLN02318, PLN02318, phosphoribulokinase/uridine ki 0.0
cd02028179 cd02028, UMPK_like, Uridine monophosphate kinase_l 5e-65
PRK05480209 PRK05480, PRK05480, uridine/cytidine kinase; Provi 2e-35
cd02023198 cd02023, UMPK, Uridine monophosphate kinase (UMPK, 1e-33
COG0572218 COG0572, Udk, Uridine kinase [Nucleotide transport 3e-33
TIGR00235207 TIGR00235, udk, uridine kinase 3e-32
pfam00485197 pfam00485, PRK, Phosphoribulokinase / Uridine kina 2e-22
pfam01928175 pfam01928, CYTH, CYTH domain 4e-19
cd02026273 cd02026, PRK, Phosphoribulokinase (PRK) is an enzy 6e-17
PTZ00301210 PTZ00301, PTZ00301, uridine kinase; Provisional 1e-15
PRK07429327 PRK07429, PRK07429, phosphoribulokinase; Provision 2e-15
PLN02348395 PLN02348, PLN02348, phosphoribulokinase 1e-11
PRK09270229 PRK09270, PRK09270, nucleoside triphosphate hydrol 2e-06
COG0378202 COG0378, HypB, Ni2+-binding GTPase involved in reg 2e-05
cd02024187 cd02024, NRK1, Nicotinamide riboside kinase (NRK) 3e-05
COG1072283 COG1072, CoaA, Panthothenate kinase [Coenzyme meta 0.001
>gnl|CDD|177952 PLN02318, PLN02318, phosphoribulokinase/uridine kinase Back     alignment and domain information 
 Score = 1247 bits (3227), Expect = 0.0
 Identities = 548/658 (83%), Positives = 605/658 (91%), Gaps = 4/658 (0%)

Query: 1   MAQDTSSGADSPRRRPGLLRDQVQLVKKKDSDRYEIVPIEDTLSFEKGFFIVIRACQLLA 60
           MAQDTS GA+SPRRR GLL+DQVQLVK+KDSDRYEIVPI+D LSFEKGFF+VIRACQLLA
Sbjct: 1   MAQDTS-GAESPRRRHGLLKDQVQLVKRKDSDRYEIVPIQDPLSFEKGFFVVIRACQLLA 59

Query: 61  QKNHGIILVGVAGPSGAGKTVFTEKVLNFMPSIAVITMDNYNDSSRIIDGNFDDPRLTDY 120
           QKN GIILVGVAGPSGAGKTVFTEKVLNFMPSIAVI+MDNYNDSSRIIDGNFDDPRLTDY
Sbjct: 60  QKNDGIILVGVAGPSGAGKTVFTEKVLNFMPSIAVISMDNYNDSSRIIDGNFDDPRLTDY 119

Query: 121 DTLLENIRGLKEGKAVQVPIYDFKSSSRIGYRTLEVPSSRIVIIEGIYALSEKLRPLIDL 180
           DTLL+NI  LK GK+VQVPIYDFKSSSR+GYRTLEVPSSRIVIIEGIYALSEKLRPL+DL
Sbjct: 120 DTLLDNIHDLKAGKSVQVPIYDFKSSSRVGYRTLEVPSSRIVIIEGIYALSEKLRPLLDL 179

Query: 181 RVSVTGGVHFDLVKRVFRDIQRVGQEPEEIIHQISETVYPMYKAFIEPDLQTAHIKIINK 240
           RVSVTGGVHFDLVKRV RDIQR GQEPEEIIHQISETVYPMYKAFIEPDLQTAHIKI+NK
Sbjct: 180 RVSVTGGVHFDLVKRVLRDIQRAGQEPEEIIHQISETVYPMYKAFIEPDLQTAHIKIVNK 239

Query: 241 FNPFTGFQNPTYILKSTRPVTVDEIKAVMSKEHTETTEETYDIYLLPPGEDPDACQSYLR 300
           FNPF+GFQNPTYILKS+R VTV++IKAV+S++HTETTEETYDIYLLPPGEDP+ CQSYLR
Sbjct: 240 FNPFSGFQNPTYILKSSRSVTVEQIKAVLSEDHTETTEETYDIYLLPPGEDPETCQSYLR 299

Query: 301 MRNRDGKYNLMFEEWVTDSPFIISPRITFEVSVRLLGGLMALGYTIATILKRSSHIFYDD 360
           MRNRDGKY+LMFEEWVTD PFIISPRITFEVSVRLLGGLMALGYTIATILKRSSH+F DD
Sbjct: 300 MRNRDGKYSLMFEEWVTDEPFIISPRITFEVSVRLLGGLMALGYTIATILKRSSHVFSDD 359

Query: 361 RVCVKTDWLEQLNRKYVQVQGRDRLYVKYVGEQLGLDGSYVPRTYIEQIQLEKLVNDVMA 420
           +VCVK DWLEQLNRKYVQVQG+DRL VK V EQLGL+GSY+PRTYIEQIQLEKLVN+VMA
Sbjct: 360 KVCVKIDWLEQLNRKYVQVQGKDRLVVKDVAEQLGLEGSYIPRTYIEQIQLEKLVNEVMA 419

Query: 421 LPDDLKTKLSIDDDLVSSPKEALSRASADRRTKYLSRSISNSFSNQREKNLTKLARVAVN 480
           LP+DLKTKLS+DDDLVSSPKEALSRASADRR K L   +S+S+S QR+KNL+KL  +AV 
Sbjct: 420 LPEDLKTKLSLDDDLVSSPKEALSRASADRRNKNLKSGLSHSYSTQRDKNLSKLTGLAVT 479

Query: 481 NRRFDGRTPESPASLANQGVINQLSEQISTLNERMDEFTSRIEEMNTKFAIRKVSASQQN 540
           NRRFD R  ESPA+L NQG I QLSEQIS+LNERMDEFTSRIEE+N+K +I+K S SQQN
Sbjct: 480 NRRFDERNSESPAAL-NQGAITQLSEQISSLNERMDEFTSRIEELNSKLSIKKNSPSQQN 538

Query: 541 LALQAEACNGSGPTSLFMTGLANGSLTGSVLPNSSSSSQLARESPLMEEVLLVARGQRQI 600
           LALQAEACNGS PTS F++GL NGSLTGS+LP SSSSSQLA+ESPLMEE+L +ARGQRQ+
Sbjct: 539 LALQAEACNGSAPTSYFVSGLGNGSLTGSILPLSSSSSQLAKESPLMEEILGIARGQRQV 598

Query: 601 MHQLDSISNLLHEYWGERTRQERTDRPSRVIDVDSIGVPLILTLAVGGLGLFLFKGLT 658
           MHQLD++SNLLHE  GE  R  R  R SR+++VDS  +PLIL+LA+GG+G+FLFK L 
Sbjct: 599 MHQLDNLSNLLHESLGE--RSGRNRRNSRLLNVDSSQLPLILSLAIGGIGIFLFKRLK 654

Length = 656
>gnl|CDD|238986 cd02028, UMPK_like, Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>gnl|CDD|235492 PRK05480, PRK05480, uridine/cytidine kinase; Provisional Back     alignment and domain information
>gnl|CDD|238981 cd02023, UMPK, Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>gnl|CDD|223645 COG0572, Udk, Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|232890 TIGR00235, udk, uridine kinase Back     alignment and domain information
>gnl|CDD|201257 pfam00485, PRK, Phosphoribulokinase / Uridine kinase family Back     alignment and domain information
>gnl|CDD|216793 pfam01928, CYTH, CYTH domain Back     alignment and domain information
>gnl|CDD|238984 cd02026, PRK, Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>gnl|CDD|140322 PTZ00301, PTZ00301, uridine kinase; Provisional Back     alignment and domain information
>gnl|CDD|180975 PRK07429, PRK07429, phosphoribulokinase; Provisional Back     alignment and domain information
>gnl|CDD|215198 PLN02348, PLN02348, phosphoribulokinase Back     alignment and domain information
>gnl|CDD|236442 PRK09270, PRK09270, nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>gnl|CDD|223455 COG0378, HypB, Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>gnl|CDD|238982 cd02024, NRK1, Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>gnl|CDD|223998 COG1072, CoaA, Panthothenate kinase [Coenzyme metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 661
PLN02318656 phosphoribulokinase/uridine kinase 100.0
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 100.0
PTZ00301210 uridine kinase; Provisional 99.97
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 99.95
cd02029277 PRK_like Phosphoribulokinase-like (PRK-like) is a 99.95
COG1437178 CyaB Adenylate cyclase, class 2 (thermophilic) [Nu 99.94
PRK05480209 uridine/cytidine kinase; Provisional 99.93
KOG4203473 consensus Armadillo/beta-Catenin/plakoglobin [Sign 99.93
PLN02348395 phosphoribulokinase 99.93
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 99.93
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 99.93
PRK15453290 phosphoribulokinase; Provisional 99.93
TIGR00318174 cyaB adenylyl cyclase CyaB, putative. The protein 99.92
TIGR00235207 udk uridine kinase. Model contains a number of lon 99.92
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 99.9
cd02026273 PRK Phosphoribulokinase (PRK) is an enzyme involve 99.89
PRK07429327 phosphoribulokinase; Provisional 99.89
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 99.89
PRK05439311 pantothenate kinase; Provisional 99.89
PRK09270229 nucleoside triphosphate hydrolase domain-containin 99.83
PRK06696223 uridine kinase; Validated 99.83
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 99.78
cd07890169 CYTH-like_AC_IV-like Adenylyl cyclase (AC) class I 99.78
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 99.75
PRK07667193 uridine kinase; Provisional 99.74
COG3842352 PotA ABC-type spermidine/putrescine transport syst 99.73
COG1126240 GlnQ ABC-type polar amino acid transport system, A 99.72
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 99.66
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 99.66
COG1136226 SalX ABC-type antimicrobial peptide transport syst 99.65
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 99.64
PRK06547172 hypothetical protein; Provisional 99.61
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 99.6
COG1127263 Ttg2A ABC-type transport system involved in resist 99.59
COG1072283 CoaA Panthothenate kinase [Coenzyme metabolism] 99.58
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 99.57
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 99.57
PRK08233182 hypothetical protein; Provisional 99.57
cd02022179 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 99.5
PLN03046460 D-glycerate 3-kinase; Provisional 99.49
PF01121180 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 Th 99.49
PRK11153343 metN DL-methionine transporter ATP-binding subunit 99.49
COG3638258 ABC-type phosphate/phosphonate transport system, A 99.49
PRK09452375 potA putrescine/spermidine ABC transporter ATPase 99.48
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 99.48
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 99.47
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 99.46
PRK13537306 nodulation ABC transporter NodI; Provisional 99.46
COG2884223 FtsE Predicted ATPase involved in cell division [C 99.45
PRK11607377 potG putrescine transporter ATP-binding subunit; P 99.45
COG0411250 LivG ABC-type branched-chain amino acid transport 99.44
PRK14732196 coaE dephospho-CoA kinase; Provisional 99.44
PRK14730195 coaE dephospho-CoA kinase; Provisional 99.43
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 99.43
PRK14734200 coaE dephospho-CoA kinase; Provisional 99.43
PRK14733204 coaE dephospho-CoA kinase; Provisional 99.43
PRK13536340 nodulation factor exporter subunit NodI; Provision 99.42
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 99.42
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, 99.42
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 99.41
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 99.41
PRK00081194 coaE dephospho-CoA kinase; Reviewed 99.41
PRK09473330 oppD oligopeptide transporter ATP-binding componen 99.4
PRK11000369 maltose/maltodextrin transporter ATP-binding prote 99.4
PRK14731208 coaE dephospho-CoA kinase; Provisional 99.4
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 99.4
PTZ00451244 dephospho-CoA kinase; Provisional 99.39
PLN02796347 D-glycerate 3-kinase 99.39
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 99.38
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 99.38
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 99.38
COG1123539 ATPase components of various ABC-type transport sy 99.38
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 99.37
PLN02422232 dephospho-CoA kinase 99.37
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 99.37
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 99.37
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 99.37
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 99.36
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 99.36
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 99.36
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 99.36
COG4152300 ABC-type uncharacterized transport system, ATPase 99.35
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 99.35
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 99.35
COG4181228 Predicted ABC-type transport system involved in ly 99.34
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 99.34
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 99.34
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 99.34
PF01928185 CYTH: CYTH domain; InterPro: IPR008172 The CYTH do 99.34
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 99.34
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 99.34
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 99.34
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 99.34
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 99.34
cd03269210 ABC_putative_ATPase This subfamily is involved in 99.33
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 99.33
PRK10070400 glycine betaine transporter ATP-binding subunit; P 99.33
PRK10619257 histidine/lysine/arginine/ornithine transporter su 99.33
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 99.33
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transp 99.33
cd07762180 CYTH-like_Pase_1 Uncharacterized subgroup 1 of the 99.33
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 99.32
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 99.32
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 99.32
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 99.32
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 99.32
COG4598256 HisP ABC-type histidine transport system, ATPase c 99.32
cd03215182 ABC_Carb_Monos_II This family represents domain II 99.32
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 99.32
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 99.31
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 99.31
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 99.31
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 99.31
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 99.31
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 99.31
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 99.31
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 99.31
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 99.31
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 99.31
COG4525259 TauB ABC-type taurine transport system, ATPase com 99.31
PRK11144352 modC molybdate transporter ATP-binding protein; Pr 99.31
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 99.3
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 99.3
PRK10908222 cell division protein FtsE; Provisional 99.3
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 99.3
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 99.3
PRK03333395 coaE dephospho-CoA kinase/protein folding accessor 99.3
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 99.3
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 99.29
PRK09536402 btuD corrinoid ABC transporter ATPase; Reviewed 99.29
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 99.29
PRK14242253 phosphate transporter ATP-binding protein; Provisi 99.29
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 99.29
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 99.29
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 99.29
PRK10261623 glutathione transporter ATP-binding protein; Provi 99.29
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 99.29
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 99.29
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 99.28
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 99.28
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 99.28
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 99.28
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 99.28
cd03246173 ABCC_Protease_Secretion This family represents the 99.28
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 99.28
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 99.28
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 99.28
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 99.28
PRK10762501 D-ribose transporter ATP binding protein; Provisio 99.28
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 99.28
COG1137243 YhbG ABC-type (unclassified) transport system, ATP 99.28
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 99.27
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 99.27
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 99.27
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 99.27
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 99.27
PRK09700510 D-allose transporter ATP-binding protein; Provisio 99.27
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 99.26
COG1117253 PstB ABC-type phosphate transport system, ATPase c 99.26
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 99.26
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 99.26
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 99.26
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 99.26
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 99.26
PRK09984262 phosphonate/organophosphate ester transporter subu 99.26
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 99.25
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 99.25
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 99.25
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 99.25
cd07758196 ThTPase Thiamine Triphosphatase. ThTPase is a solu 99.25
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 99.25
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 99.25
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 99.25
TIGR00152188 dephospho-CoA kinase. This model produces scores i 99.25
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 99.25
PRK10261623 glutathione transporter ATP-binding protein; Provi 99.25
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 99.24
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 99.24
PRK14239252 phosphate transporter ATP-binding protein; Provisi 99.24
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 99.24
COG0410237 LivF ABC-type branched-chain amino acid transport 99.24
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 99.24
PRK14235267 phosphate transporter ATP-binding protein; Provisi 99.24
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 99.23
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 99.23
PRK10253265 iron-enterobactin transporter ATP-binding protein; 99.23
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 99.23
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 99.23
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 99.23
PRK13477512 bifunctional pantoate ligase/cytidylate kinase; Pr 99.23
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 99.23
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 99.23
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 99.23
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 99.23
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 99.23
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 99.23
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 99.23
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 99.23
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 99.22
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 99.22
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 99.22
KOG3220225 consensus Similar to bacterial dephospho-CoA kinas 99.22
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 99.22
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 99.22
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 99.22
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 99.22
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 99.22
PRK14238271 phosphate transporter ATP-binding protein; Provisi 99.21
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 99.21
TIGR02142354 modC_ABC molybdenum ABC transporter, ATP-binding p 99.21
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 99.21
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 99.21
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 99.21
PRK14240250 phosphate transporter ATP-binding protein; Provisi 99.21
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 99.21
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 99.21
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 99.2
COG1129500 MglA ABC-type sugar transport system, ATPase compo 99.2
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 99.2
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 99.2
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 99.2
PRK11288501 araG L-arabinose transporter ATP-binding protein; 99.2
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 99.19
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 99.19
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 99.19
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 99.19
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 99.19
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 99.19
PRK14241258 phosphate transporter ATP-binding protein; Provisi 99.19
COG1123539 ATPase components of various ABC-type transport sy 99.19
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 99.19
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 99.18
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 99.18
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 99.18
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 99.18
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 99.17
PRK10938490 putative molybdenum transport ATP-binding protein 99.17
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 99.17
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 99.17
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 99.17
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 99.17
COG4172534 ABC-type uncharacterized transport system, duplica 99.16
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 99.16
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 99.16
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 99.16
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 99.16
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 99.16
COG4619223 ABC-type uncharacterized transport system, ATPase 99.16
COG4604252 CeuD ABC-type enterochelin transport system, ATPas 99.16
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 99.15
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 99.15
cd03234226 ABCG_White The White subfamily represents ABC tran 99.15
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 99.15
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 99.15
COG0237201 CoaE Dephospho-CoA kinase [Coenzyme metabolism] 99.15
COG4175386 ProV ABC-type proline/glycine betaine transport sy 99.15
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 99.14
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 99.14
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 99.14
PRK14237267 phosphate transporter ATP-binding protein; Provisi 99.14
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 99.14
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 99.14
PRK14236272 phosphate transporter ATP-binding protein; Provisi 99.14
KOG00551228 consensus Multidrug/pheromone exporter, ABC superf 99.14
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 99.13
PRK11819556 putative ABC transporter ATP-binding protein; Revi 99.13
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 99.13
KOG0055 1228 consensus Multidrug/pheromone exporter, ABC superf 99.13
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 99.13
PRK09700510 D-allose transporter ATP-binding protein; Provisio 99.13
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 99.13
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 99.13
PRK15064530 ABC transporter ATP-binding protein; Provisional 99.12
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 99.12
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 99.12
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 99.12
COG3845501 ABC-type uncharacterized transport systems, ATPase 99.11
KOG2702323 consensus Predicted panthothenate kinase/uridine k 99.11
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 99.11
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 99.11
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 99.11
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 99.11
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 99.11
PRK14254285 phosphate ABC transporter ATP-binding protein; Pro 99.11
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 99.1
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 99.1
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 99.1
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 99.1
PRK14243264 phosphate transporter ATP-binding protein; Provisi 99.1
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 99.1
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 99.1
TIGR012572272 rim_protein retinal-specific rim ABC transporter. 99.1
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 99.09
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 99.09
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 99.09
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 99.09
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 99.09
PRK15064530 ABC transporter ATP-binding protein; Provisional 99.09
KOG3308225 consensus Uncharacterized protein of the uridine k 99.08
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 99.08
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 99.08
COG4618580 ArpD ABC-type protease/lipase transport system, AT 99.08
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 99.07
cd03299235 ABC_ModC_like Archeal protein closely related to M 99.07
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 99.07
PRK09580248 sufC cysteine desulfurase ATPase component; Review 99.06
PRK10535648 macrolide transporter ATP-binding /permease protei 99.06
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 99.06
cd03216163 ABC_Carb_Monos_I This family represents the domain 99.06
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 99.06
PRK14266250 phosphate ABC transporter ATP-binding protein; Pro 99.06
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 99.06
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 99.06
PRK10789569 putative multidrug transporter membrane\ATP-bindin 99.05
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 99.05
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 99.05
COG4167267 SapF ABC-type antimicrobial peptide transport syst 99.05
PRK14264305 phosphate ABC transporter ATP-binding protein; Pro 99.05
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 99.05
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 99.05
PRK03695248 vitamin B12-transporter ATPase; Provisional 99.05
PRK10762501 D-ribose transporter ATP binding protein; Provisio 99.05
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 99.04
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 99.04
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 99.04
PTZ002651466 multidrug resistance protein (mdr1); Provisional 99.04
PRK10790592 putative multidrug transporter membrane\ATP-bindin 99.04
PRK13546264 teichoic acids export protein ATP-binding subunit; 99.03
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 99.03
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 99.03
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 99.02
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 99.02
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 99.02
KOG0057591 consensus Mitochondrial Fe/S cluster exporter, ABC 99.02
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 99.01
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 99.0
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 99.0
PTZ00265 1466 multidrug resistance protein (mdr1); Provisional 99.0
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 98.99
PRK10522547 multidrug transporter membrane component/ATP-bindi 98.99
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 98.98
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 98.98
COG4172534 ABC-type uncharacterized transport system, duplica 98.97
COG4674249 Uncharacterized ABC-type transport system, ATPase 98.97
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 98.97
TIGR00017217 cmk cytidylate kinase. This family consists of cyt 98.97
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 98.96
KOG0056790 consensus Heavy metal exporter HMT1, ABC superfami 98.96
PRK11819556 putative ABC transporter ATP-binding protein; Revi 98.96
PRK11288501 araG L-arabinose transporter ATP-binding protein; 98.96
COG4559259 ABC-type hemin transport system, ATPase component 98.95
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 98.95
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 98.95
COG4148352 ModC ABC-type molybdate transport system, ATPase c 98.95
PRK11147635 ABC transporter ATPase component; Reviewed 98.94
PLN032321495 ABC transporter C family member; Provisional 98.94
COG4778235 PhnL ABC-type phosphonate transport system, ATPase 98.94
PLN03211659 ABC transporter G-25; Provisional 98.94
COG4988559 CydD ABC-type transport system involved in cytochr 98.94
PRK14252265 phosphate ABC transporter ATP-binding protein; Pro 98.93
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 98.93
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 98.93
PRK10938490 putative molybdenum transport ATP-binding protein 98.92
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 98.92
COG0283222 Cmk Cytidylate kinase [Nucleotide transport and me 98.92
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 98.92
PLN031301622 ABC transporter C family member; Provisional 98.92
PRK13409590 putative ATPase RIL; Provisional 98.91
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 98.91
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 98.91
PRK13545549 tagH teichoic acids export protein ATP-binding sub 98.9
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 98.9
PRK10636638 putative ABC transporter ATP-binding protein; Prov 98.9
PRK10636638 putative ABC transporter ATP-binding protein; Prov 98.89
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 98.88
COG4136213 ABC-type uncharacterized transport system, ATPase 98.88
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 98.88
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 98.87
TIGR00954659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 98.87
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 98.87
COG4133209 CcmA ABC-type transport system involved in cytochr 98.87
TIGR009561394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 98.86
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 98.85
PRK14263261 phosphate ABC transporter ATP-binding protein; Pro 98.85
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 98.83
COG4161242 ArtP ABC-type arginine transport system, ATPase co 98.83
COG4987573 CydC ABC-type transport system involved in cytochr 98.83
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 98.83
COG0488530 Uup ATPase components of ABC transporters with dup 98.82
COG4107258 PhnK ABC-type phosphonate transport system, ATPase 98.81
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 98.81
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 98.8
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 98.78
PRK08118167 topology modulation protein; Reviewed 98.78
PRK07261171 topology modulation protein; Provisional 98.77
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 98.77
PF00005137 ABC_tran: ABC transporter This structure is on hol 98.76
TIGR00955617 3a01204 The Eye Pigment Precursor Transporter (EPP 98.76
PRK11147635 ABC transporter ATPase component; Reviewed 98.76
PRK01184184 hypothetical protein; Provisional 98.73
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 98.73
PLN03073718 ABC transporter F family; Provisional 98.72
COG1101263 PhnK ABC-type uncharacterized transport system, AT 98.71
TIGR01187325 potA spermidine/putrescine ABC transporter ATP-bin 98.7
PRK00023225 cmk cytidylate kinase; Provisional 98.69
PRK11860661 bifunctional 3-phosphoshikimate 1-carboxyvinyltran 98.67
PRK06217183 hypothetical protein; Validated 98.67
PRK13409590 putative ATPase RIL; Provisional 98.66
PTZ002431560 ABC transporter; Provisional 98.66
PRK14737186 gmk guanylate kinase; Provisional 98.66
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 98.65
PLN03140 1470 ABC transporter G family member; Provisional 98.64
COG4586325 ABC-type uncharacterized transport system, ATPase 98.6
COG5265497 ATM1 ABC-type transport system involved in Fe-S cl 98.58
cd07891148 CYTH-like_CthTTM-like_1 CYTH-like Clostridium ther 98.57
PRK06762166 hypothetical protein; Provisional 98.56
PLN031401470 ABC transporter G family member; Provisional 98.56
KOG0061613 consensus Transporter, ABC superfamily (Breast can 98.55
TIGR012711490 CFTR_protein cystic fibrosis transmembrane conduct 98.55
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 98.54
PLN03232 1495 ABC transporter C family member; Provisional 98.54
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 98.53
PLN03130 1622 ABC transporter C family member; Provisional 98.53
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 98.52
TIGR00957 1522 MRP_assoc_pro multi drug resistance-associated pro 98.5
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 98.5
COG0488530 Uup ATPase components of ABC transporters with dup 98.49
PRK04182180 cytidylate kinase; Provisional 98.47
PLN03073718 ABC transporter F family; Provisional 98.46
TIGR01271 1490 CFTR_protein cystic fibrosis transmembrane conduct 98.46
PRK12269 863 bifunctional cytidylate kinase/ribosomal protein S 98.45
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 98.44
KOG0059885 consensus Lipid exporter ABCA1 and related protein 98.4
COG3954289 PrkB Phosphoribulokinase [Energy production and co 98.39
PRK05541176 adenylylsulfate kinase; Provisional 98.38
KOG00541381 consensus Multidrug resistance-associated protein/ 98.37
COG0194191 Gmk Guanylate kinase [Nucleotide transport and met 98.34
PRK00300205 gmk guanylate kinase; Provisional 98.33
PTZ00243 1560 ABC transporter; Provisional 98.33
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 98.3
PRK08356195 hypothetical protein; Provisional 98.29
COG4240300 Predicted kinase [General function prediction only 98.29
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 98.29
PRK04040188 adenylate kinase; Provisional 98.28
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 98.27
COG1119257 ModF ABC-type molybdenum transport system, ATPase 98.2
COG4615546 PvdE ABC-type siderophore export system, fused ATP 98.2
KOG2878282 consensus Predicted kinase [General function predi 98.11
COG4138248 BtuD ABC-type cobalamin transport system, ATPase c 98.09
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 98.04
smart00072184 GuKc Guanylate kinase homologues. Active enzymes c 98.0
PLN02200234 adenylate kinase family protein 98.0
KOG00651391 consensus Pleiotropic drug resistance proteins (PD 97.98
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 97.96
COG4170330 SapD ABC-type antimicrobial peptide transport syst 97.94
PRK05057172 aroK shikimate kinase I; Reviewed 97.94
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 97.91
cd07761146 CYTH-like_CthTTM-like Clostridium thermocellum (Ct 97.89
PRK13949169 shikimate kinase; Provisional 97.89
TIGR03238504 dnd_assoc_3 dnd system-associated protein 3. cereu 97.87
COG4178604 ABC-type uncharacterized transport system, permeas 97.86
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-asso 97.84
PRK03839180 putative kinase; Provisional 97.81
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 97.81
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain 97.8
KOG0054 1381 consensus Multidrug resistance-associated protein/ 97.8
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 97.79
cd03272243 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein 97.77
PRK03846198 adenylylsulfate kinase; Provisional 97.76
PRK09825176 idnK D-gluconate kinase; Provisional 97.74
KOG0062582 consensus ATPase component of ABC transporters wit 97.73
PRK14738206 gmk guanylate kinase; Provisional 97.73
PRK00131175 aroK shikimate kinase; Reviewed 97.7
COG2401593 ABC-type ATPase fused to a predicted acetyltransfe 97.63
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 97.63
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 97.61
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 97.6
PRK02496184 adk adenylate kinase; Provisional 97.6
PRK14530215 adenylate kinase; Provisional 97.59
PRK00625173 shikimate kinase; Provisional 97.57
cd07374174 CYTH-like_Pase CYTH-like (also known as triphospha 97.56
COG1428216 Deoxynucleoside kinases [Nucleotide transport and 97.51
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 97.5
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 97.5
PRK14528186 adenylate kinase; Provisional 97.5
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are simil 97.5
COG1936180 Predicted nucleotide kinase (related to CMP and AM 97.49
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 97.49
TIGR00041195 DTMP_kinase thymidylate kinase. Function: phosphor 97.49
cd07756197 CYTH-like_Pase_CHAD Uncharacterized subgroup of th 97.48
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 97.48
PLN02772398 guanylate kinase 97.47
TIGR00455184 apsK adenylylsulfate kinase (apsK). Important resi 97.46
PRK12338319 hypothetical protein; Provisional 97.45
PRK14532188 adenylate kinase; Provisional 97.43
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 97.42
cd01673193 dNK Deoxyribonucleoside kinase (dNK) catalyzes the 97.41
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 97.4
PRK14527191 adenylate kinase; Provisional 97.39
COG1245591 Predicted ATPase, RNase L inhibitor (RLI) homolog 97.39
>PLN02318 phosphoribulokinase/uridine kinase Back     alignment and domain information 
Probab=100.00  E-value=3.9e-178  Score=1468.54  Aligned_cols=655  Identities=84%  Similarity=1.252  Sum_probs=637.4

Q ss_pred             CCcccCCCCCCCCcccccccchhhhcccCCCceeeeecccceeeeccCceEEEeeccceeccCCcceEEEEECCCCCcHH
Q 006094            1 MAQDTSSGADSPRRRPGLLRDQVQLVKKKDSDRYEIVPIEDTLSFEKGFFIVIRACQLLAQKNHGIILVGVAGPSGAGKT   80 (661)
Q Consensus         1 ~~~~~~~~~~s~~r~~~ll~~~~~l~~~~~~~~iei~~l~~~~s~~~g~~~vL~~Isl~i~~ge~~~IIGI~GpSGSGKS   80 (661)
                      ||||+ +++.|++|+.|||++|+++|++|+++.++|.+++.+++|++|++.+++++++..+...++++|||+||||||||
T Consensus         1 ~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~sfd~g~~~~ira~qlL~~~~~~riIIGIaGpSGSGKT   79 (656)
T PLN02318          1 MAQDT-SGAESPRRRHGLLKDQVQLVKRKDSDRYEIVPIQDPLSFEKGFFVVIRACQLLAQKNDGIILVGVAGPSGAGKT   79 (656)
T ss_pred             CCccc-ccCcCcccccchhHHhhhheeeccCCceEEEeCCCccccccchhhhhHHHHHHHhcCCCeEEEEEECCCCCcHH
Confidence            99999 88999999999999999999999999999999999999999999999999999988888999999999999999


Q ss_pred             HHHHHHHHhCCCceEEecCCccccccccccccCCCCCCchhhHHHHHHhhhccccccccccccccccccccceeeccCcc
Q 006094           81 VFTEKVLNFMPSIAVITMDNYNDSSRIIDGNFDDPRLTDYDTLLENIRGLKEGKAVQVPIYDFKSSSRIGYRTLEVPSSR  160 (661)
Q Consensus        81 TLak~La~llp~~g~I~lD~~~~~~~~i~~~fq~p~~~d~~tl~enL~~L~~g~~I~~P~yd~~~~~r~~~~~~~v~~a~  160 (661)
                      ||++.|++.+|+++.|++|+|+.......++|++|.++|++.+.++|..|++|+.+.+|.|||..+.+.+.....+++.+
T Consensus        80 TLAk~LaglLp~vgvIsmDdy~~~~~~i~~nfD~P~a~D~d~L~enL~~Lr~GksV~iPiYDf~t~~r~~~~~i~v~p~~  159 (656)
T PLN02318         80 VFTEKVLNFMPSIAVISMDNYNDSSRIIDGNFDDPRLTDYDTLLDNIHDLKAGKSVQVPIYDFKSSSRVGYRTLEVPSSR  159 (656)
T ss_pred             HHHHHHHhhCCCcEEEEEcceecchhhhCccCCChhhcchhHHHHHHHHHhCCCceecCccccccCcccCCceeecCCCc
Confidence            99999999998899999999976555577899999999999999999999999999999999999988765567788999


Q ss_pred             EEEEEehhhhhccccCCCCEEEEEEcCchhHHHHHHHHHHHhhCCCHHHHHHHHHhhcccchhhccCCCCCCceEEEECC
Q 006094          161 IVIIEGIYALSEKLRPLIDLRVSVTGGVHFDLVKRVFRDIQRVGQEPEEIIHQISETVYPMYKAFIEPDLQTAHIKIINK  240 (661)
Q Consensus       161 VVIVEGilaL~deLr~llDlkIfVdad~diRLiRRI~RDi~eRG~s~EeVi~q~~~~v~P~~~~fIeP~k~~ADIII~N~  240 (661)
                      |||+||+|++++++++++|++|||++|.++++.||+.||+.++|+++++++++|.+.++|+|.+||+|++++||+||.|+
T Consensus       160 VVIVEGIyaL~~~Lr~LlDlkIFVDtdvDirL~RRI~RD~~eRGrs~EsVi~q~~~~VkP~y~~FIeP~kk~ADIII~n~  239 (656)
T PLN02318        160 IVIIEGIYALSEKLRPLLDLRVSVTGGVHFDLVKRVLRDIQRAGQEPEEIIHQISETVYPMYKAFIEPDLQTAHIKIVNK  239 (656)
T ss_pred             EEEEechhhccHhHHhhCCEEEEEcCCccHHHHHHHHHHHHHhCCCHHHHHHHHHHhhcchHHHHhCcchhcceEEEecC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCCCeeeeccCCCccHHHHHHHHcccccccccceeeeecCCCCCCcccccceEEEeecCCeEEEEEeeeecCCC
Q 006094          241 FNPFTGFQNPTYILKSTRPVTVDEIKAVMSKEHTETTEETYDIYLLPPGEDPDACQSYLRMRNRDGKYNLMFEEWVTDSP  320 (661)
Q Consensus       241 ~~p~~g~~n~v~iLKsa~~v~~~~IravL~~l~~~~~~~~~DIYl~pP~~df~~tde~LRvR~~dg~~~Ltykgp~~d~~  320 (661)
                      |+|++++.|++||+|+.+++..++|+..|.+.....+++++||||+||++||++|++|||+|+++|+|+||||+|++|+|
T Consensus       240 f~P~~g~~np~~Ilk~~~~~~~~~i~~~L~~~~~~~~~~~~DiYl~~P~~d~~~~~e~LRvR~~~Gk~~Ltyke~i~dgp  319 (656)
T PLN02318        240 FNPFSGFQNPTYILKSSRSVTVEQIKAVLSEDHTETTEETYDIYLLPPGEDPETCQSYLRMRNRDGKYSLMFEEWVTDEP  319 (656)
T ss_pred             CCCCCCCCCCeEEecCCccccHHHHHHHhhhccccccceeeEEEecCCCCCchhccceEEEEecCCEEEEEEecccccCC
Confidence            99999999999999999999999999999998888899999999999999999999999999999999999999999999


Q ss_pred             ceeeeeeEEEeehhhHHHHhhcCCeEEEEEEeeeeeeeeCCEEEEeecccccCcceEEEEeccHHHHHHHHHHcCCCCCc
Q 006094          321 FIISPRITFEVSVRLLGGLMALGYTIATILKRSSHIFYDDRVCVKTDWLEQLNRKYVQVQGRDRLYVKYVGEQLGLDGSY  400 (661)
Q Consensus       321 fi~rp~~ef~V~v~~~~gL~~LGf~~~a~V~R~re~y~~g~~~i~lD~ve~Lg~~FveI~g~~~~~V~~~~~~Lgl~g~~  400 (661)
                      ||++|+++|||++++++||++|||+++|+|+|+|++|.+|+++|++|||||||++||||+|.+|+.|.++|++|||+|+|
T Consensus       320 ~ii~pk~~fEv~v~~~~gL~aLGy~~~a~vkk~r~iy~~g~v~i~lD~ve~Lg~~FvqIeg~~r~~V~~~a~kLGl~g~~  399 (656)
T PLN02318        320 FIISPRITFEVSVRLLGGLMALGYTIATILKRSSHVFSDDKVCVKIDWLEQLNRKYVQVQGKDRLVVKDVAEQLGLEGSY  399 (656)
T ss_pred             eecCcceeEEEeeehHhHHHHcCCceEEEEEEEEEEEecCCEEEEeehhhccCCeeEEEehhHHHHHHHHHHHcCCCCCc
Confidence            99999999999999999999999999999999999999999999999999999889999999999999999999999999


Q ss_pred             ccchhHHHHHHhhhcccccCCChhhhhccccCcccccCchhhhhhhhhhhhccccccccccccccccccccccccccccc
Q 006094          401 VPRTYIEQIQLEKLVNDVMALPDDLKTKLSIDDDLVSSPKEALSRASADRRTKYLSRSISNSFSNQREKNLTKLARVAVN  480 (661)
Q Consensus       401 i~kSYLEli~lek~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  480 (661)
                      ||+||||||||||+++++|+||||||+|||+|+++|+||||||+|||||+|+||+++|||||||+||+||++||++++++
T Consensus       400 i~~SYlE~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  479 (656)
T PLN02318        400 IPRTYIEQIQLEKLVNEVMALPEDLKTKLSLDDDLVSSPKEALSRASADRRNKNLKSGLSHSYSTQRDKNLSKLTGLAVT  479 (656)
T ss_pred             ccccHHHHHHHHHhHHHHhhccHHhhhhcccccccccCcHHHhhhhhhhhhhhhcccCcccccccccccccccccccccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccCCCCCCCCccccccchhhHHHHHHhhHhHhHHHHHHHHHHhhccccccccCccccccceeecccCCCCCcceeecc
Q 006094          481 NRRFDGRTPESPASLANQGVINQLSEQISTLNERMDEFTSRIEEMNTKFAIRKVSASQQNLALQAEACNGSGPTSLFMTG  560 (661)
Q Consensus       481 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  560 (661)
                      +||||+|++++||++ |||+|||||||||+|||||||||||||||||||+++|+||||||+|+|+|+||||||||||++|
T Consensus       480 ~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  558 (656)
T PLN02318        480 NRRFDERNSESPAAL-NQGAITQLSEQISSLNERMDEFTSRIEELNSKLSIKKNSPSQQNLALQAEACNGSAPTSYFVSG  558 (656)
T ss_pred             ccccCCCCCCCchhh-ccchHHHHHHhhcchhhhhHHHHHHHHHHhhccccccCChhhhhhhccccccCCCCcchhhhcc
Confidence            999999999999999 9999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCccccccccCCCCcccccccchhHHHHHHHhhhhHHHHHhHhhHHHHHHHhhhhcchhcccCCCCceeeeccCCcce
Q 006094          561 LANGSLTGSVLPNSSSSSQLARESPLMEEVLLVARGQRQIMHQLDSISNLLHEYWGERTRQERTDRPSRVIDVDSIGVPL  640 (661)
Q Consensus       561 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  640 (661)
                      ++||+|||++||+|||||||++|+||||||..|+|||||||||||+|+|||||++|||++..  .+++.+.++++..+|+
T Consensus       559 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~  636 (656)
T PLN02318        559 LGNGSLTGSILPLSSSSSQLAKESPLMEEILGIARGQRQVMHQLDNLSNLLHESLGERSGRN--RRNSRLLNVDSSQLPL  636 (656)
T ss_pred             CCCcccccccccccccccccCccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhccccc--hhhccccccCcccchH
Confidence            99999999999999999999999999999999999999999999999999999999999554  5667788999999999


Q ss_pred             eeeeeccceeeeeeecccc
Q 006094          641 ILTLAVGGLGLFLFKGLTF  659 (661)
Q Consensus       641 ~~~~~~~~~~~~~~~~~~~  659 (661)
                      +++||+||+|+|+|+++.+
T Consensus       637 ~~~~~~~~~~~~~~~~~~~  655 (656)
T PLN02318        637 ILSLAIGGIGIFLFKRLKN  655 (656)
T ss_pred             HHHHHHhhhhhhhhhhhhc
Confidence            9999999999999999865

>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>COG1437 CyaB Adenylate cyclase, class 2 (thermophilic) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>KOG4203 consensus Armadillo/beta-Catenin/plakoglobin [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PLN02348 phosphoribulokinase Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>PRK15453 phosphoribulokinase; Provisional Back     alignment and domain information
>TIGR00318 cyaB adenylyl cyclase CyaB, putative Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>PRK07429 phosphoribulokinase; Provisional Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>cd07890 CYTH-like_AC_IV-like Adenylyl cyclase (AC) class IV-like, a subgroup of the CYTH-like superfamily Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG1072 CoaA Panthothenate kinase [Coenzyme metabolism] Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 Back     alignment and domain information
>PLN03046 D-glycerate 3-kinase; Provisional Back     alignment and domain information
>PF01121 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 This family contains dephospho-CoA kinases (2 Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14732 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK14730 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK14734 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK14733 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK00081 coaE dephospho-CoA kinase; Reviewed Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14731 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>PTZ00451 dephospho-CoA kinase; Provisional Back     alignment and domain information
>PLN02796 D-glycerate 3-kinase Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PLN02422 dephospho-CoA kinase Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>PF01928 CYTH: CYTH domain; InterPro: IPR008172 The CYTH domain is an ancient enzymatic domain that was present in the Last Universal Common Ancestor and was involved in nucleotide or organic phosphate metabolism [] Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd07762 CYTH-like_Pase_1 Uncharacterized subgroup 1 of the CYTH-like superfamily Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>PRK03333 coaE dephospho-CoA kinase/protein folding accessory domain-containing protein; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>cd07758 ThTPase Thiamine Triphosphatase Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00152 dephospho-CoA kinase Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>KOG3220 consensus Similar to bacterial dephospho-CoA kinase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>KOG2702 consensus Predicted panthothenate kinase/uridine kinase-related protein [Nucleotide transport and metabolism; Coenzyme transport and metabolism] Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG3308 consensus Uncharacterized protein of the uridine kinase family [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>TIGR00017 cmk cytidylate kinase Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>COG0283 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK00023 cmk cytidylate kinase; Provisional Back     alignment and domain information
>PRK11860 bifunctional 3-phosphoshikimate 1-carboxyvinyltransferase/cytidine monophosphate kinase; Provisional Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd07891 CYTH-like_CthTTM-like_1 CYTH-like Clostridium thermocellum TTM-like subgroup 1 Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>KOG0061 consensus Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>KOG0059 consensus Lipid exporter ABCA1 and related proteins, ABC superfamily [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>COG3954 PrkB Phosphoribulokinase [Energy production and conversion] Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>COG4240 Predicted kinase [General function prediction only] Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2878 consensus Predicted kinase [General function prediction only] Back     alignment and domain information
>COG4138 BtuD ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>smart00072 GuKc Guanylate kinase homologues Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>COG4170 SapD ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>cd07761 CYTH-like_CthTTM-like Clostridium thermocellum (Cth)TTM and similar proteins, a subgroup of the CYTH-like superfamily Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>TIGR03238 dnd_assoc_3 dnd system-associated protein 3 Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>cd07374 CYTH-like_Pase CYTH-like (also known as triphosphate tunnel metalloenzyme (TTM)-like) Phosphatases Back     alignment and domain information
>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>cd07756 CYTH-like_Pase_CHAD Uncharacterized subgroup of the CYTH-like superfamily having an associated CHAD domain Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>PRK12338 hypothetical protein; Provisional Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>cd01673 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs) Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query661
3asy_A211 Ligand-Free Structure Of Uridine Kinase From Thermu 3e-16
1xrj_A261 Rapid Structure Determination Of Human Uridine-Cyti 4e-16
2jeo_A245 Crystal Structure Of Human Uridine-Cytidine Kinase 4e-16
1udw_A252 Crystal Structure Of Human Uridine-cytidine Kinase 5e-16
>pdb|3ASY|A Chain A, Ligand-Free Structure Of Uridine Kinase From Thermus Thermophilus Hb8 Length = 211 Back     alignment and structure 
Iteration: 1

 Score = 83.6 bits (205), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 59/191 (30%), Positives = 98/191 (51%), Gaps = 15/191 (7%)
Query: 68  LVGVAGPSGAGKTVFTEKVLNFM-PSIAVITMDNYNDS------SRIIDGNFDDPRLTDY 120
           ++G+AG + +GKT   + +   +   +A++ MD+Y            +  N+D P   D 
Sbjct: 8   VIGIAGGTASGKTTLAQALARTLGERVALLPMDHYYKDLGHLPLEERLRVNYDHPDAFDL 67
Query: 121 DTLLENIRGLKEGKAVQVPIYDFKSSSRIGYRTLEVPSSRIVIIEGIYALSEK-LRPLID 179
              LE+ + L  G  V++P+YDF++ +R   RT   P+  +VI+EGI  L  K LR L+D
Sbjct: 68  ALYLEHAQALLRGLPVEMPVYDFRAYTRSPRRTPVRPAP-VVILEGILVLYPKELRDLMD 126
Query: 180 LRVSVTGGVHFDLVKRVFRDIQRVGQEPEEIIHQISETVYPMYKAFIEPDLQTAHIKIIN 239
           L+V V        ++R+ RD+   G+  E ++ Q  E V PM+  F+EP  + A + +  
Sbjct: 127 LKVFVDADADERFIRRLKRDVLERGRSLEGVVAQYLEQVKPMHLHFVEPTKRYADVIVPR 186
Query: 240 KFNPFTGFQNP 250
                 G QNP
Sbjct: 187 ------GGQNP 191
>pdb|1XRJ|A Chain A, Rapid Structure Determination Of Human Uridine-Cytidine Kinase 2 Using A Conventional Laboratory X-Ray Source And A Single Samarium Derivative Length = 261 Back     alignment and structure
>pdb|2JEO|A Chain A, Crystal Structure Of Human Uridine-Cytidine Kinase 1 Length = 245 Back     alignment and structure
>pdb|1UDW|A Chain A, Crystal Structure Of Human Uridine-cytidine Kinase 2 Complexed With A Feedback-inhibitor, Ctp Length = 252 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query661
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 2e-50
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 2e-47
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 4e-45
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 2e-43
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 2e-33
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 4e-24
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 2e-23
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 3e-17
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 9e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-14
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 2e-14
2een_A183 Hypothetical protein PH1819; dimer, NPPSFA, nation 2e-06
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 8e-05
2hf9_A226 Probable hydrogenase nickel incorporation protein 1e-04
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 7e-04
1yem_A179 Hypothetical protein; structural genomics, southea 8e-04
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Length = 211 Back     alignment and structure
 Score =  173 bits (440), Expect = 2e-50
 Identities = 59/195 (30%), Positives = 101/195 (51%), Gaps = 15/195 (7%)

Query: 67  ILVGVAGPSGAGKTVFTEKVLN-FMPSIAVITMDNY-NDSSRI-----IDGNFDDPRLTD 119
            ++G+AG + +GKT   + +       +A++ MD+Y  D   +     +  N+D P   D
Sbjct: 7   FVIGIAGGTASGKTTLAQALARTLGERVALLPMDHYYKDLGHLPLEERLRVNYDHPDAFD 66

Query: 120 YDTLLENIRGLKEGKAVQVPIYDFKSSSRIGYRTLEVPSSRIVIIEGIYALS-EKLRPLI 178
               LE+ + L  G  V++P+YDF++ +R   R   V  + +VI+EGI  L  ++LR L+
Sbjct: 67  LALYLEHAQALLRGLPVEMPVYDFRAYTRSP-RRTPVRPAPVVILEGILVLYPKELRDLM 125

Query: 179 DLRVSVTGGVHFDLVKRVFRDIQRVGQEPEEIIHQISETVYPMYKAFIEPDLQTAHIKII 238
           DL+V V        ++R+ RD+   G+  E ++ Q  E V PM+  F+EP  + A + I+
Sbjct: 126 DLKVFVDADADERFIRRLKRDVLERGRSLEGVVAQYLEQVKPMHLHFVEPTKRYADV-IV 184

Query: 239 NKFNPFTGFQNPTYI 253
                  G QNP  +
Sbjct: 185 P-----RGGQNPVAL 194
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Length = 252 Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Length = 245 Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Length = 201 Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Length = 207 Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Length = 290 Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Length = 208 Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Length = 312 Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Length = 321 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Length = 308 Back     alignment and structure
>2een_A Hypothetical protein PH1819; dimer, NPPSFA, national project on Pro structural and functional analyses; 1.65A {Pyrococcus horikoshii} Length = 183 Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Length = 221 Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Length = 226 Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Length = 359 Back     alignment and structure
>1yem_A Hypothetical protein; structural genomics, southeast collaboratory for structural genomics, secsg, protein structure initiative, PSI; 2.30A {Pyrococcus furiosus} SCOP: d.63.1.2 Length = 179 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query661
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 99.9
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 99.88
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 99.85
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 99.85
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 99.84
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 99.83
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 99.82
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 99.8
1yem_A179 Hypothetical protein; structural genomics, southea 99.78
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 99.78
3ghx_A179 Adenylate cyclase CYAB; CYTH domain, antiparallel 99.77
2een_A183 Hypothetical protein PH1819; dimer, NPPSFA, nation 99.77
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 99.76
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 99.74
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 99.71
3n10_A179 Adenylate cyclase 2; CYTH domain, antiparallel bar 99.68
2dc4_A165 PH1012 protein, 165AA long hypothetical protein; d 99.68
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 99.6
2aca_A189 Putative adenylate cyclase; NESG, VPR19, Q87NV8, s 99.6
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 99.57
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 99.56
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 99.55
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 99.53
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 99.52
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 99.52
1g6h_A257 High-affinity branched-chain amino acid transport 99.52
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 99.51
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 99.5
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 99.5
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 99.49
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 99.49
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 99.49
1b0u_A262 Histidine permease; ABC transporter, transport pro 99.49
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 99.48
1ji0_A240 ABC transporter; ATP binding protein, structural g 99.47
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 99.47
4i1u_A210 Dephospho-COA kinase; structural genomics, niaid, 99.46
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 99.46
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 99.45
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 99.44
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 99.44
1sgw_A214 Putative ABC transporter; structural genomics, P p 99.43
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 99.43
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 99.42
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 99.41
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 99.39
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 99.35
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 99.35
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 99.35
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 99.34
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 99.33
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 99.32
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 99.32
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 99.32
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 99.29
2ghi_A260 Transport protein; multidrug resistance protein, M 99.28
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 99.27
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 99.26
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 99.26
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 99.25
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 99.25
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 99.24
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 99.24
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 99.2
3bhd_A234 Thtpase, thiamine triphosphatase; hydrolase, struc 99.17
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 99.17
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 99.17
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 99.16
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 99.13
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 99.11
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 99.09
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 99.09
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 99.08
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 99.08
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 99.07
3r20_A233 Cytidylate kinase; structural genomics, seattle st 99.06
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 99.03
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 99.03
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 99.02
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 99.02
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 99.0
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 98.99
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 98.96
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 98.91
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 98.88
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 98.84
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 98.84
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 98.81
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 98.78
3tj7_A195 GBAA_1210 protein; structural genomics, adenosine 98.78
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 98.78
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 98.77
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 98.76
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 98.74
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 98.7
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 98.7
3vaa_A199 Shikimate kinase, SK; structural genomics, center 98.68
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 98.64
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 98.63
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 98.62
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 98.62
3ux8_A670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 98.6
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 98.57
3v85_A210 CYTH-like phosphatase; CYTH domain, hydrolase; HET 98.56
2gfg_A193 BH2851; antiparallel barrel, structural genomics, 98.55
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 98.53
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 98.51
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 98.5
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 98.49
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 98.48
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 98.47
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 98.43
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 98.41
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 98.37
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 98.34
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 98.34
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 98.31
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 98.31
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 98.27
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 98.26
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 98.25
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 98.25
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 98.25
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 98.24
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 98.24
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 98.23
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 98.22
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 98.21
3ux8_A670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 98.14
2og2_A359 Putative signal recognition particle receptor; nuc 98.13
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 98.12
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 98.1
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 98.09
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 98.09
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 98.07
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 98.06
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 98.05
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 98.05
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 98.03
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 98.03
3euj_A483 Chromosome partition protein MUKB, linker; MUKB, M 98.01
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 98.0
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 97.99
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 97.98
3fdi_A201 Uncharacterized protein; cytidylate kinase like pr 97.97
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 97.96
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 97.93
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 97.92
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 97.92
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 97.92
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 97.9
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 97.89
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 97.88
3hdt_A223 Putative kinase; structura genomics, PSI-2, protei 97.87
2fbl_A153 Hypothetical protein NE1496; APC5855, PSI, protein 97.87
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 97.85
2eyu_A261 Twitching motility protein PILT; pilus retraction 97.85
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 97.85
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 97.85
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 97.83
3tlx_A243 Adenylate kinase 2; structural genomics, structura 97.82
3szr_A608 Interferon-induced GTP-binding protein MX1; interf 97.82
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 97.82
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 97.82
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 97.81
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 97.81
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 97.79
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 97.79
4a74_A231 DNA repair and recombination protein RADA; hydrola 97.77
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 97.75
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 97.73
1via_A175 Shikimate kinase; structural genomics, transferase 97.73
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 97.71
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 97.67
1p9r_A418 General secretion pathway protein E; bacterial typ 97.61
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 97.59
2oap_1511 GSPE-2, type II secretion system protein; hexameri 97.58
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 97.57
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 97.57
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 97.52
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 97.51
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 97.49
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 97.48
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 97.45
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 97.45
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 97.45
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 97.39
3pih_A916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 97.39
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 97.38
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 97.38
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 97.37
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 97.34
1kag_A173 SKI, shikimate kinase I; transferase, structural g 97.33
2ewv_A372 Twitching motility protein PILT; pilus retraction 97.29
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 97.21
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 97.17
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 97.17
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 97.13
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 97.1
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 97.09
1qhl_A227 Protein (cell division protein MUKB); SMC, chromos 97.09
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 97.08
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 97.08
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 97.08
4aby_A415 DNA repair protein RECN; hydrolase, double strand 97.07
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 97.06
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 97.03
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 97.01
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 96.99
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 96.99
2o8b_B1022 DNA mismatch repair protein MSH6; DNA damage respo 96.96
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 96.94
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 96.93
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 96.93
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 96.91
2gks_A546 Bifunctional SAT/APS kinase; transferase, sulfuryl 96.89
3thx_B918 DNA mismatch repair protein MSH3; ABC family ATPas 96.88
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 96.87
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 96.87
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 96.86
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 96.86
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 96.84
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 96.77
3kta_A182 Chromosome segregation protein SMC; structural mai 96.76
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 96.76
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 96.76
2vf7_A842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 96.71
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 96.68
1ewq_A765 DNA mismatch repair protein MUTS; multiple domains 96.67
2kjq_A149 DNAA-related protein; solution structure, NESG, st 96.65
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 96.64
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 96.62
3ch4_B202 Pmkase, phosphomevalonate kinase; parallel beta-sh 96.6
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 96.59
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 96.57
2axn_A520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 96.57
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 96.56
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 96.56
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 96.53
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 96.51
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 96.48
2vli_A183 Antibiotic resistance protein; transferase, tunica 96.48
2ygr_A993 Uvrabc system protein A; hydrolase, nucleotide exc 96.47
2cvh_A220 DNA repair and recombination protein RADB; filamen 96.38
2r6f_A972 Excinuclease ABC subunit A; UVRA, nucleotide excis 96.38
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 96.33
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 96.32
1vma_A306 Cell division protein FTSY; TM0570, structural gen 96.32
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 96.26
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 96.24
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 96.24
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 96.24
1xjc_A169 MOBB protein homolog; structural genomics, midwest 96.23
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 96.13
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 96.11
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 95.99
1x6v_B630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 95.98
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 95.97
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 95.93
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 95.93
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 95.89
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 95.83
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 95.81
3k1j_A604 LON protease, ATP-dependent protease LON; ATP-bind 95.8
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 95.79
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 95.74
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 95.74
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 95.7
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 95.66
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 95.65
2o5v_A359 DNA replication and repair protein RECF; ABC ATPas 95.59
2vf7_A 842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 95.53
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 95.51
1w1w_A430 Structural maintenance of chromosome 1; cohesin, c 95.43
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 95.39
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 95.37
3ice_A422 Transcription termination factor RHO; transcriptio 95.36
2www_A349 Methylmalonic aciduria type A protein, mitochondri 95.32
2wji_A165 Ferrous iron transport protein B homolog; membrane 95.29
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 95.27
2ygr_A 993 Uvrabc system protein A; hydrolase, nucleotide exc 95.24
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 95.23
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 95.12
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 95.07
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 95.05
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 95.03
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 94.99
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 94.91
3pih_A 916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 94.8
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 94.78
2r6f_A 972 Excinuclease ABC subunit A; UVRA, nucleotide excis 94.75
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 94.67
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 94.62
1e69_A322 Chromosome segregation SMC protein; structural mai 94.58
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 94.57
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 94.48
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 94.47
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 94.43
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 94.38
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 94.35
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 94.34
1dek_A241 Deoxynucleoside monophosphate kinase; transferase, 94.31
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 94.3
2ged_A193 SR-beta, signal recognition particle receptor beta 94.27
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 94.25
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 94.24
3lxx_A239 GTPase IMAP family member 4; structural genomics c 94.24
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 94.24
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 94.2
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 94.19
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 94.18
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 94.18
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 94.13
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 94.12
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 94.12
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 94.08
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 94.05
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 94.04
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 93.98
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 93.97
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 93.97
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 93.94
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 93.94
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 93.93
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 93.92
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 93.92
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 93.9
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 93.9
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 93.89
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 93.86
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 93.85
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 93.85
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 93.83
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 93.81
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 93.8
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 93.79
3bos_A242 Putative DNA replication factor; P-loop containing 93.77
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 93.75
3qkt_A339 DNA double-strand break repair RAD50 ATPase; RECA- 93.75
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 93.74
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 93.67
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 93.67
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 93.62
1kjw_A295 Postsynaptic density protein 95; protein-protein i 93.6
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 93.58
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 93.52
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 93.51
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 93.5
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 93.47
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 93.47
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 93.42
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 93.41
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 93.38
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 93.35
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 93.33
1nrj_B218 SR-beta, signal recognition particle receptor beta 93.28
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 93.27
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 93.27
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 93.25
2hf9_A226 Probable hydrogenase nickel incorporation protein 93.24
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 93.21
2z43_A324 DNA repair and recombination protein RADA; archaea 93.2
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 93.18
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 93.13
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 93.11
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 93.08
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 93.08
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 93.06
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 93.05
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 93.0
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 92.92
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 92.91
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 92.9
3t1o_A198 Gliding protein MGLA; G domain containing protein, 92.89
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 92.88
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 92.86
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 92.83
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 92.78
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 92.77
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 92.75
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 92.7
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 92.69
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 92.68
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 92.64
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 92.63
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 92.6
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 92.6
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 92.54
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 92.54
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 92.54
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 92.5
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 92.5
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 92.49
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 92.47
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 92.46
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 92.44
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 92.44
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 92.44
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 92.43
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 92.38
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 92.34
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 92.34
3lxw_A247 GTPase IMAP family member 1; immunity, structural 92.32
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 92.29
4ag6_A392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 92.24
2chg_A226 Replication factor C small subunit; DNA-binding pr 92.22
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 92.22
2ohf_A396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 92.2
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 92.19
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 92.18
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 92.13
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 92.12
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 92.11
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 92.1
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 92.1
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 92.07
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 92.07
2fh5_B214 SR-beta, signal recognition particle receptor beta 92.02
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 92.01
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 92.01
3hjn_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 91.99
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 91.99
1ko7_A314 HPR kinase/phosphatase; protein kinase, phosphotra 91.96
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 91.92
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 91.91
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 91.88
2r6a_A454 DNAB helicase, replicative helicase; replication, 91.87
3auy_A371 DNA double-strand break repair RAD50 ATPase; DNA r 91.87
4ad8_A517 DNA repair protein RECN; DNA binding protein, ATPa 91.84
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 91.83
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 91.82
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 91.81
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 91.8
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 91.79
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 91.77
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 91.76
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 91.75
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 91.71
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 91.7
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 91.67
3iby_A256 Ferrous iron transport protein B; G protein, G dom 91.63
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 91.59
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 91.56
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 91.56
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 91.53
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 91.5
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 91.48
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 91.36
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 91.35
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 91.27
2r62_A268 Cell division protease FTSH homolog; ATPase domain 91.25
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 91.24
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 91.24
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 91.2
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 91.19
2v1u_A387 Cell division control protein 6 homolog; DNA repli 91.16
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 91.1
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 91.09
1p6x_A334 Thymidine kinase; P-loop, LID, transferase; HET: T 91.08
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 91.07
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 91.06
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 91.05
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 91.04
3llu_A196 RAS-related GTP-binding protein C; structural geno 91.02
1bif_A469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 91.0
2dby_A368 GTP-binding protein; GDP, structural genomics, NPP 90.94
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 90.9
2xkx_A721 Disks large homolog 4; structural protein, scaffol 90.87
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 90.83
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 90.79
1of1_A376 Thymidine kinase; transferase, antiviral drug, enz 90.74
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 90.7
1e2k_A331 Thymidine kinase; transferase, antiviral drug, enz 90.57
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 90.41
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 90.34
1u94_A356 RECA protein, recombinase A; homologous recombinat 90.3
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 90.25
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 90.25
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 90.23
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 90.22
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 90.22
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 90.14
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 90.14
2dy1_A665 Elongation factor G; translocation, GTP complex, s 90.05
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 90.05
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 90.04
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 90.03
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 90.01
1jal_A363 YCHF protein; nucleotide-binding fold, structural 89.97
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 89.86
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 89.84
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 89.84
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 89.61
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 89.55
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 89.5
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 89.48
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 89.41
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 89.4
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 89.28
2ius_A512 DNA translocase FTSK; nucleotide-binding, chromoso 89.14
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
Probab=99.90  E-value=1.7e-23  Score=221.31  Aligned_cols=193  Identities=18%  Similarity=0.193  Sum_probs=157.8

Q ss_pred             CceEEEeeccceeccC---CcceEEEEECCCCCcHHHHHHHHHHhCC------CceEEecCCccccccc-----cccccC
Q 006094           48 GFFIVIRACQLLAQKN---HGIILVGVAGPSGAGKTVFTEKVLNFMP------SIAVITMDNYNDSSRI-----IDGNFD  113 (661)
Q Consensus        48 g~~~vL~~Isl~i~~g---e~~~IIGI~GpSGSGKSTLak~La~llp------~~g~I~lD~~~~~~~~-----i~~~fq  113 (661)
                      +...++++++..+.+.   ..+++|||+||||||||||+++|.+++.      .++.+.+|+++.....     ....++
T Consensus        71 ~~~~~l~~~~~~~l~~~~~~~p~iigI~GpsGSGKSTl~~~L~~ll~~~~~~~~v~~i~~D~f~~~~~~l~~~~~~~~~g  150 (321)
T 3tqc_A           71 TARQTLQQATYQFLGKPEPKVPYIIGIAGSVAVGKSTTSRVLKALLSRWPDHPNVEVITTDGFLYSNAKLEKQGLMKRKG  150 (321)
T ss_dssp             HHHHHHHHHHHHHHTCCCCCCCEEEEEECCTTSSHHHHHHHHHHHHTTSTTCCCEEEEEGGGGBCCHHHHHHTTCGGGTT
T ss_pred             cchHHHHHHHHHHhccCCCCCCEEEEEECCCCCCHHHHHHHHHHHhcccCCCCeEEEEeecccccchhhhhhHHHHhhcc
Confidence            4445566666665443   4678999999999999999999999862      4677999998643211     123466


Q ss_pred             CCCCCchhhHHHHHHhhhccc-cccccccccccccccccceeeccCccEEEEEehhhhhcc-----------ccCCCCEE
Q 006094          114 DPRLTDYDTLLENIRGLKEGK-AVQVPIYDFKSSSRIGYRTLEVPSSRIVIIEGIYALSEK-----------LRPLIDLR  181 (661)
Q Consensus       114 ~p~~~d~~tl~enL~~L~~g~-~I~~P~yd~~~~~r~~~~~~~v~~a~VVIVEGilaL~de-----------Lr~llDlk  181 (661)
                      .|..||...+.+.+..++.|+ .+..|.||+..+.+.......+.+.++||+||++++++.           +.+++|.+
T Consensus       151 ~P~~~D~~~l~~~L~~L~~g~~~v~~P~yd~~~~~r~~~~~~~v~~~dIVIvEGi~lL~~~~~~~~~~~~~~l~~~~D~~  230 (321)
T 3tqc_A          151 FPESYDMPSLLRVLNAIKSGQRNVRIPVYSHHYYDIVRGQYEIVDQPDIVILEGLNILQTGVRKTLQQLQVFVSDFFDFS  230 (321)
T ss_dssp             SGGGBCHHHHHHHHHHHHTTCSSEEEEEEETTTTEEEEEEEEEECSCSEEEEECTTTTCCCCCSSSSSCCCCGGGGCSEE
T ss_pred             CcccccHHHHHHHHHhhhccccccccchhhhhccccccCceeeccCCCEEEEEccccccccccccccchhhhhhhhcCeE
Confidence            789999999999999999998 899999999999887545566788899999999999865           88999999


Q ss_pred             EEEEcCchhHHHHHHHHHHHhhC---------------CCHHH----HHHHHHhhcccchhhccCCCCCCceEEEECC
Q 006094          182 VSVTGGVHFDLVKRVFRDIQRVG---------------QEPEE----IIHQISETVYPMYKAFIEPDLQTAHIKIINK  240 (661)
Q Consensus       182 IfVdad~diRLiRRI~RDi~eRG---------------~s~Ee----Vi~q~~~~v~P~~~~fIeP~k~~ADIII~N~  240 (661)
                      |||++|.++++.|++.||...+|               .+.++    +..+|.....|++++||+|++.+||+||+.+
T Consensus       231 I~Vda~~d~~~~R~i~Rd~~~r~~a~~~~~s~~~~y~~~s~~ea~~~a~~~w~~~~~pn~~~~I~ptr~~Adlil~~g  308 (321)
T 3tqc_A          231 LFVDAQAQVIQKWYIDRVLSFWRTTFKDPHSYFHYLTQMSETEVAAFAKHVWNEINKVNLMENILPYKNRAQLILEKA  308 (321)
T ss_dssp             EEEECCHHHHHHHHHHHHHHHHHTGGGSTTSTTGGGGGSCHHHHHHHHHHHHHHTHHHHHHHHTGGGGGGCSEEEEEC
T ss_pred             EEEECCHHHHHHHHHHhcchhhhhhccChHHHHHHHhcCCHHHHHHHHHHHHHhccccCHHHhCccCccCceEEEecC
Confidence            99999999999999999988765               34443    3456767778999999999999999999743
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>1yem_A Hypothetical protein; structural genomics, southeast collaboratory for structural genomics, secsg, protein structure initiative, PSI; 2.30A {Pyrococcus furiosus} SCOP: d.63.1.2 Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>2een_A Hypothetical protein PH1819; dimer, NPPSFA, national project on Pro structural and functional analyses; 1.65A {Pyrococcus horikoshii} Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>3n10_A Adenylate cyclase 2; CYTH domain, antiparallel barrel, product complex, cyclic AM; HET: CMP; 1.60A {Yersinia pestis} PDB: 3n0z_A* 3n0y_A* 2fjt_A Back     alignment and structure
>2dc4_A PH1012 protein, 165AA long hypothetical protein; dimer, X-RAY diffraction, structural genomics, NPPSFA; 1.65A {Pyrococcus horikoshii} Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>2aca_A Putative adenylate cyclase; NESG, VPR19, Q87NV8, structural genomics, PSI, protein structure initiative; 2.25A {Vibrio parahaemolyticus} SCOP: d.63.1.2 Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3bhd_A Thtpase, thiamine triphosphatase; hydrolase, structural genomics consortium, CYTH SGC; HET: MSE CIT; 1.50A {Homo sapiens} PDB: 2jmu_A Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>3tj7_A GBAA_1210 protein; structural genomics, adenosine monophosphate, center for STR genomics of infectious diseases, csgid; HET: AMP; 2.10A {Bacillus anthracis} PDB: 3sy3_A* Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>3v85_A CYTH-like phosphatase; CYTH domain, hydrolase; HET: CIT; 1.90A {Arabidopsis thaliana} Back     alignment and structure
>2gfg_A BH2851; antiparallel barrel, structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, unknow function; 2.12A {Bacillus halodurans} Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} Back     alignment and structure
>2fbl_A Hypothetical protein NE1496; APC5855, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.90A {Nitrosomonas europaea} SCOP: d.63.1.2 Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>3ch4_B Pmkase, phosphomevalonate kinase; parallel beta-sheet with the strand order 23145, walker A motif, cholesterol biosynthesis, lipid synthesis; 1.76A {Homo sapiens} Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>1dek_A Deoxynucleoside monophosphate kinase; transferase, phosphotransferase; HET: DGP; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 PDB: 1del_A* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Back     alignment and structure
>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>1p6x_A Thymidine kinase; P-loop, LID, transferase; HET: THM; 2.00A {Equid herpesvirus 4} SCOP: c.37.1.1 PDB: 1p72_A* 1p73_A* 1p75_A* Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>1of1_A Thymidine kinase; transferase, antiviral drug, enzyme- prodrug gene, DNA synthesis, ATP-binding; HET: SCT; 1.95A {Herpes simplex virus} SCOP: c.37.1.1 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1e2k_A Thymidine kinase; transferase, antiviral drug, enzyme-prodrug gene therapy, sugar ring pucker; HET: TMC; 1.7A {Herpes simplex virus} SCOP: c.37.1.1 PDB: 1e2i_A* 1e2h_A* 1e2m_A* 1e2n_A* 1e2p_A* 1ki2_A* 1ki3_A* 1ki4_A* 1ki6_B* 1ki7_A* 1ki8_A* 3rdp_A* 2ki5_A* 1kim_A* 1qhi_A* 1p7c_A* 1vtk_A* 2vtk_A* 3vtk_A* 3f0t_A* ... Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 661
d1a7ja_288 c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sph 1e-31
d1uj2a_213 c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Ho 4e-19
d1sq5a_308 c.37.1.6 (A:) Pantothenate kinase PanK {Escherichi 4e-17
d1rz3a_198 c.37.1.6 (A:) Hypothetical protein rbstp0775 {Baci 5e-14
d2acaa1174 d.63.1.2 (A:8-181) Putative adenylate cyclase VP17 4e-10
d1odfa_286 c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker' 2e-04
d1yrba1244 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB09 8e-04
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Length = 288 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Phosphoribulokinase/pantothenate kinase
domain: Phosphoribulokinase
species: Rhodobacter sphaeroides [TaxId: 1063]

 Score =  122 bits (308), Expect = 1e-31
 Identities = 33/207 (15%), Positives = 56/207 (27%), Gaps = 34/207 (16%)

Query: 62  KNHGIILVGVAGPSGAGKTVFTEKVLNFMP----SIAVITMDNYNDSSR----------- 106
           K H II   V G SGAG +                   I  D ++  +R           
Sbjct: 2   KKHPII--SVTGSSGAGTSTVKHTFDQIFRREGVKAVSIEGDAFHRFNRADMKAELDRRY 59

Query: 107 ---IIDGNFDDPRLTDYDTLLENIRGLKEGKAVQVPIYDFKSSSRIGYR---------TL 154
                  +       +   L    R   E    +   Y    +                 
Sbjct: 60  AAGDATFSHFSYEANELKELERVFREYGETGQGRTRTYVHDDAEAARTGVAPGNFTDWRD 119

Query: 155 EVPSSRIVIIEGIYAL----SEKLRPLIDLRVSVTGGVHFDLVKRVFRDIQRVGQEPEEI 210
               S ++  EG++         +  L DL++ V   ++ + ++++ RD    G   E +
Sbjct: 120 FDSDSHLLFYEGLHGAVVNSEVNIAGLADLKIGVVPVINLEWIQKIHRDRATRGYTTEAV 179

Query: 211 IHQISETVYPMYKAFIEPDLQTAHIKI 237
              I       Y   I P      I  
Sbjct: 180 TDVI-LRRMHAYVHCIVPQFSQTDINF 205
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 213 Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Length = 308 Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Length = 198 Back     information, alignment and structure
>d2acaa1 d.63.1.2 (A:8-181) Putative adenylate cyclase VP1760 {Vibrio parahaemolyticus [TaxId: 670]} Length = 174 Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 286 Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Length = 244 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query661
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 99.94
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 99.94
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 99.92
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 99.77
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 99.75
d1yema_163 Hypothetical protein PF0863 {Pyrococcus furiosus [ 99.74
d2awna2232 Maltose transport protein MalK, N-terminal domain 99.73
d1g2912240 Maltose transport protein MalK, N-terminal domain 99.73
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 99.73
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 99.72
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 99.72
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 99.7
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 99.69
d2acaa1174 Putative adenylate cyclase VP1760 {Vibrio parahaem 99.67
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 99.65
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 99.63
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 99.61
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 99.52
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 99.52
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 99.49
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 99.49
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 99.47
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 99.47
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 99.45
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 99.44
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 99.42
d2hyda1255 Putative multidrug export ATP-binding/permease pro 99.39
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 99.38
d2jmua1223 Thiamine-triphosphatase (ThTPase) {Mouse (Mus musc 99.24
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 99.23
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 99.21
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 98.82
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 98.41
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 98.39
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 98.32
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 98.3
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 98.28
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 98.25
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 98.22
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 98.18
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 98.16
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 98.15
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 98.14
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 98.14
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 98.12
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 98.06
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 98.06
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 98.05
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 98.03
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 98.01
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 97.78
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 97.77
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 97.7
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 97.69
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 97.67
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 97.64
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 97.61
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 97.56
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 97.56
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 97.54
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 97.52
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.39
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 97.38
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 97.37
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 97.37
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 97.36
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 97.34
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.29
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 97.18
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 97.17
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.97
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 96.94
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 96.91
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.8
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 96.68
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 96.65
d1vmaa2213 GTPase domain of the signal recognition particle r 96.63
d2qy9a2211 GTPase domain of the signal recognition particle r 96.57
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.57
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.53
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 96.53
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 96.46
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.42
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 96.4
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 96.37
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.31
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 96.2
d1okkd2207 GTPase domain of the signal recognition particle r 96.17
d1ls1a2207 GTPase domain of the signal sequence recognition p 95.96
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 95.43
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 95.13
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 95.11
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 95.08
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 94.9
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 94.9
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 94.88
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 94.77
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 94.66
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.6
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 94.52
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 94.48
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 94.45
d1nrjb_209 Signal recognition particle receptor beta-subunit 94.39
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 94.31
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 94.3
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 94.22
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 94.2
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 94.19
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 94.15
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 94.09
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 94.0
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 93.97
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 93.91
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 93.86
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 93.86
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 93.75
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 93.73
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 93.55
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 93.51
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 93.47
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 93.43
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 93.43
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 93.38
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 93.31
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 93.3
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 93.2
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 93.18
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 92.97
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 92.96
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 92.9
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 92.89
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 92.81
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 92.76
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 92.69
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 92.61
d2fh5b1207 Signal recognition particle receptor beta-subunit 92.6
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 92.56
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 92.54
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 92.42
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 92.37
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 92.31
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 92.29
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 92.16
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 92.15
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 92.15
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 92.06
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 92.06
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 92.02
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 91.95
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 91.95
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 91.92
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 91.9
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 91.87
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 91.77
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 91.73
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 91.64
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 91.57
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 91.55
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 91.54
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 91.42
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 91.41
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 91.31
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 91.28
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 91.25
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 91.09
d1svma_362 Papillomavirus large T antigen helicase domain {Si 91.06
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 91.05
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 91.04
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 91.0
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 90.99
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 90.86
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 90.83
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 90.82
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 90.77
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 90.72
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 90.63
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 90.51
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 90.43
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 90.41
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 90.31
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 90.27
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 90.27
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 90.23
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 90.15
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 90.14
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 90.05
d2fbla1150 Hypothetical protein NE1496 {Nitrosomonas europaea 89.85
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 89.8
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 89.79
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 89.78
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 89.78
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 89.73
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 89.73
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 89.71
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 89.67
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 89.64
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 89.63
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 89.58
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 89.54
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 89.4
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 89.3
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 89.22
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 89.2
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 88.7
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 88.68
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 88.51
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 88.49
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 88.41
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 88.4
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 88.22
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 88.21
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 87.99
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 87.73
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 87.62
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 87.47
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 87.41
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 87.22
d1kjwa2199 Guanylate kinase-like domain of Psd-95 {Rat (Rattu 87.21
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 86.97
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 86.5
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 86.38
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 86.22
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 86.02
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 85.95
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 85.53
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 85.47
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 85.24
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 84.65
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 84.57
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 84.47
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 83.74
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 83.45
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 83.15
d1xpua3289 Transcription termination factor Rho, ATPase domai 82.22
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 81.87
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 81.62
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 80.95
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 80.59
d1tuea_205 Replication protein E1 helicase domain {Human papi 80.36
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Phosphoribulokinase/pantothenate kinase
domain: Uridine-cytidine kinase 2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.94  E-value=7.6e-28  Score=234.13  Aligned_cols=194  Identities=28%  Similarity=0.493  Sum_probs=164.0

Q ss_pred             cceEEEEECCCCCcHHHHHHHHHHhCC---------CceEEecCCcccccc--------ccccccCCCCCCchhhHHHHH
Q 006094           65 GIILVGVAGPSGAGKTVFTEKVLNFMP---------SIAVITMDNYNDSSR--------IIDGNFDDPRLTDYDTLLENI  127 (661)
Q Consensus        65 ~~~IIGI~GpSGSGKSTLak~La~llp---------~~g~I~lD~~~~~~~--------~i~~~fq~p~~~d~~tl~enL  127 (661)
                      .|++|||+||+||||||+++.|+..+.         .+.+|++|+|+....        ...+.|+++..++.+.+.+.+
T Consensus         1 ~P~iIgI~G~~gSGKSTla~~L~~~l~~~~~~~~~~~~~vi~~D~yy~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~   80 (213)
T d1uj2a_           1 EPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTL   80 (213)
T ss_dssp             CCEEEEEECSTTSSHHHHHHHHHHHTTGGGSCGGGCSEEEEEGGGGBCCCCHHHHHHHHTTCSCTTSGGGBCHHHHHHHH
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHhchhccccCCCceEEEeccccccccchhhhhhhhhcccccCCcHHHHHHHHHhhh
Confidence            489999999999999999999998872         356899999864311        123567888999999999999


Q ss_pred             HhhhccccccccccccccccccccceeeccCccEEEEEehhhhh-ccccCCCCEEEEEEcCchhHHHHHHHHHHHhhCCC
Q 006094          128 RGLKEGKAVQVPIYDFKSSSRIGYRTLEVPSSRIVIIEGIYALS-EKLRPLIDLRVSVTGGVHFDLVKRVFRDIQRVGQE  206 (661)
Q Consensus       128 ~~L~~g~~I~~P~yd~~~~~r~~~~~~~v~~a~VVIVEGilaL~-deLr~llDlkIfVdad~diRLiRRI~RDi~eRG~s  206 (661)
                      ..+..+..+..|.|++..+.+.. ......+.+++++||.+++. ..+++++|++|||++|.++|+.||+.||...+|++
T Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~iiveg~~~l~~~~l~~~~D~~i~v~~~~~~~~~R~~~Rd~~~rg~~  159 (213)
T d1uj2a_          81 KEITEGKTVQIPVYDFVSHSRKE-ETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRD  159 (213)
T ss_dssp             HHHHTTCCEEEEEEETTTTEEEE-EEEEECCCSEEEEECTTTTSSHHHHHHCSEEEEEECCHHHHHHHHHHHHHHHSCCC
T ss_pred             hhhhcCCcccccccccccccccC-ceEEecccceEEecchhhhccHHHHhhhheeeeecCCHHHHHHHHHHHHHHHcCCC
Confidence            99999999999999999888765 34556788999999999987 67899999999999999999999999999999999


Q ss_pred             HHHHHHHHHhhcccchhhccCCCCCCceEEEECCCCCCCCCCCCeeeeccCCCccHHHHHHHHc
Q 006094          207 PEEIIHQISETVYPMYKAFIEPDLQTAHIKIINKFNPFTGFQNPTYILKSTRPVTVDEIKAVMS  270 (661)
Q Consensus       207 ~EeVi~q~~~~v~P~~~~fIeP~k~~ADIII~N~~~p~~g~~n~v~iLKsa~~v~~~~IravL~  270 (661)
                      .++++++|...++|+|++|++|++++||+||+|+.+.      .+     ++..+...|+.+|.
T Consensus       160 ~e~~~~~~~~~~~~~~~~~i~p~k~~ADlIi~~~~d~------~~-----~i~~i~~~I~~ll~  212 (213)
T d1uj2a_         160 LEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADN------LV-----AINLIVQHIQDILN  212 (213)
T ss_dssp             HHHHHHHHHHTHHHHHHHHTGGGGGGCSEEEETGGGC------HH-----HHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHhHHHHHHHhhhhHhcCCEEEeCCCcc------HH-----HHHHHHHHHHHHhC
Confidence            9999999999999999999999999999999987532      11     23445566666654
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yema_ d.63.1.2 (A:) Hypothetical protein PF0863 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2acaa1 d.63.1.2 (A:8-181) Putative adenylate cyclase VP1760 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2jmua1 d.63.1.2 (A:2-224) Thiamine-triphosphatase (ThTPase) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d2fbla1 d.63.1.2 (A:2-151) Hypothetical protein NE1496 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kjwa2 c.37.1.1 (A:526-724) Guanylate kinase-like domain of Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure