Citrus Sinensis ID: 006114

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660
MKVVNMVKLKEEFDYESLCRKLETQVDHLTAEIERKQKLRENDKCELEKLLRECQISYDEAKDNLVTQVELLTAKIEMQQKLRENDKYEFEKQLRESQISYDESMRNLVTRSEFLEKENAHLELEVEKILGELNHQKDQNNLKREKIVQLEISLKNSKQQQLDNSSYQKVLADTTQMYEKKITELIKQLEIEHARSEGAEEQVDTMKKLISDNQKSIEQYEMENSTYQKALADTTQLYEKKIAELNKKLEDEHACFEGAVEQLDMVKKLLSDYQNSNQGQKEVHELCVKLKETRQLHESAVYEVQTLKSEYKNLLEEKETMSDELQAARQRLLVEEKQRKAIEYELVKLKKTAPEHDDDFEDKKPYTKDYISKGSSRFGAPMSLQKSNPSRELSGQRATIAKICDEVGLPKILQLLTSEDPDVQIHAVKVVANLAAEDINQEKIVEEGGLDALLLLLRTSQNTTILRVASGAIANLAMNEMNQGLIMSRGGGQLLAKTASKTDDPQTLRMVAGALANLCGNEKLHTMLEEDGAIKALLAMVRSGNIDVIAQVARGLANFAKCESRAIVQGQRKGRSHLMEDSALEWLIANSKTNSASTRRHVELALCHLAQNEDNARDFISRGGAKELVQISIESSREDIRNLAKKTMKSNPRLQADTHA
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHcHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccHHHHHHHHccccHHHHHHHHHHHHHHccccccHHHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHHccccccHHHHHHcccHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHcccccHHHHHHcccHHHHHHHcccccHHHHHHHHHHHHHHccccccHHHHHHcccHHHHHHHHHHccHHHHHHHHHHHHHcccHHHHHccc
ccEEEHEEEHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHcccHHHHHHHccccccccHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHHccHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHHHccHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHHHccHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHccccccHHHHccccHHHHHHHHccccHHHHHHHHHHHHHHHccHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHccccccccccc
mkvvnmvkLKEEFDYESLCRKLETQVDHLTAEIERKQKLRENDKCELEKLLRECQISYDEAKDNLVTQVELLTAKIEMQQKLRENDKYEFEKQLRESQISYDESMRNLVTRSEFLEKENAHLELEVEKILGElnhqkdqnnlkREKIVQLEISLKNskqqqldnSSYQKVLADTTQMYEKKITELIKQLEIEHARSEGAEEQVDTMKKLISDNQKSIEQYEMENSTYQKALADTTQLYEKKIAELNKKLEDEHACFEGAVEQLDMVKKLLSDYQNSNQGQKEVHELCVKLKETRQLHESAVYEVQTLKSEYKNLLEEKETMSDELQAARQRLLVEEKQRKAIEYELVKLkktapehdddfedkkpytkdyiskgssrfgapmslqksnpsrelsgqRATIAKICDEVGLPKILQLltsedpdvqIHAVKVVANLAaedinqekivEEGGLDALLLLLRTSQNTTILRVASGAIANLAMNEMNQGlimsrgggqllaktasktddpqTLRMVAGALANLCGNEKLHTMLEEDGAIKALLAMVRSGNIDVIAQVARGLANFAKCESRAIVQGQrkgrshlmeDSALEWLIANsktnsastRRHVELALCHLAQNEDNARDFISRGGAKELVQISIESSREDIRNLAKKTmksnprlqadtha
mkvvnmvklkeefdYESLCRKLETQVDHLTAEIErkqklrendkceLEKLLRECQISYDEAKDNLVTQVELLTAKIEMQqklrendkyEFEKQLresqisydesmRNLVTRSEFLEKENAHLELEVEKILgelnhqkdqnnLKREKIVQLEISlknskqqqldnssYQKVLADTTQMYEKKITELIKQLEIEHArsegaeeqvdtMKKLISDNQKSIEQYEMENSTYQKALADTTQLYEKKIAELNKKLEDEHACFEGAVEQLDMVKKLLSDYQNSNQGQKEVHELCVKLKETRQLHESAVYEVQTLKSEYKNLLEEKETMSDELQAARQRLLVEEKQRKAIEYElvklkktapehdddfedkkpyTKDYiskgssrfgapmslqksnpsrelsGQRATIAKICDEVGLPKILQLLTSEDPDVQIHAVKVVANLAAEDINQEKIVEEGGLDALLLLLRTSQNTTILRVASGAIANLAMNEMNQGLIMSRGGGQLLAKTASKTDDPQTLRMVAGALANLCGNEKLHTMLEEDGAIKALLAMVRSGNIDVIAQVARGLANFAKCESRAIVQGQRKGRSHLMEDSALEWLIANSKTNSASTRRHVELALCHLAQNEDNARDFISRGGAKELVQISIESSREDIRNLakktmksnprlqadtha
MKVVNMVKLKEEFDYESLCRKLETQVDHLTAEIERKQKLRENDKCELEKLLRECQISYDEAKDNLVTQVELLTAKIEMQQKLRENDKYEFEKQLRESQISYDESMRNLVTRSEFLEKENAHLELEVEKILGELNHQKDQNNLKREKIVQLEISLKNSKQQQLDNSSYQKVLADTTQMYEKKITELIKQLEIEHARSEGAEEQVDTMKKLISDNQKSIEQYEMENSTYQKALADTTQLYEKKIAELNKKLEDEHACFEGAVEQLDMVKKLLSDYQNSNQGQKEVHELCVKLKETRQLHESAVYEVQTLKSEYKNLLEEKETMSDELQAARQRLLVEEKQRKAIEYELVKLKKTAPEHDDDFEDKKPYTKDYISKGSSRFGAPMSLQKSNPSRELSGQRATIAKICDEVGLPKILQLLTSEDPDVQIHAVKVVANLAAEDINQEKIVEEGGLDAlllllRTSQNTTILRVASGAIANLAMNEMNQGLIMSRGGGQLLAKTASKTDDPQTLRMVAGALANLCGNEKLHTMLEEDGAIKALLAMVRSGNIDVIAQVARGLANFAKCESRAIVQGQRKGRSHLMEDSALEWLIANSKTNSASTRRHVELALCHLAQNEDNARDFISRGGAKELVQISIESSREDIRNLAKKTMKSNPRLQADTHA
******VKLKEEFDYESLCRKLETQVDHLTAEI**********KCELEKLLRECQISYDEAKDNLVTQVELLTAKIE**********************************************LEVEKIL********************************************TQMYEKKITELIKQ*******************************************ADTTQLYEKKIAELNKKLEDEHACFEGAVEQLDMVKKLLSDY*********VHELCVKLKETRQLHESAVYEVQTL************************************Y*****************************************************ATIAKICDEVGLPKILQLLTSEDPDVQIHAVKVVANLAAEDINQEKIVEEGGLDALLLLLRTSQNTTILRVASGAIANLAMNEMNQGLIMSR*****************TLRMVAGALANLCGNEKLHTMLEEDGAIKALLAMVRSGNIDVIAQVARGLANFAKCESRAIVQG**********DSALEWLIAN*********RHVELALCHLAQN******FI****************************************
MK*VNMVKLKEEF*******************************************************************************************************************************************************************************************************************************************************************************************************************************LVEEKQRKAIEYELVKLKKTAPEHDDDFEDKKPYTKDYISKGSSRFGAPMSLQKSNPSRELSGQRATIAKICDEVGLPKILQLLTSEDPDVQIHAVKVVANLAAEDINQEKIVEEGGLDALLLLLRTSQNTTILRVASGAIANLAMNEMNQGLIMSRGGGQLLAKTASKT*D*QTLRMVAGALANLCGNEKLHTMLEEDGAIKALLAMVRSGNIDVIAQVARGLANFAKCESRAIVQGQR*GRSHLMEDSALEWLIANSKTNSASTRRHVELALCHLAQNEDNARDFISRGGAKELVQISIE*****IRNLAKKTMKSNPR*******
MKVVNMVKLKEEFDYESLCRKLETQVDHLTAEIERKQKLRENDKCELEKLLRECQISYDEAKDNLVTQVELLTAKIEMQQKLRENDKYEFEKQLRESQISYDESMRNLVTRSEFLEKENAHLELEVEKILGELNHQKDQNNLKREKIVQLEISLKN********SSYQKVLADTTQMYEKKITELIKQLEIEHAR*********TMKKLISDNQKSIEQYEMENSTYQKALADTTQLYEKKIAELNKKLEDEHACFEGAVEQLDMVKKLLSDYQNSNQGQKEVHELCVKLKETRQLHESAVYEVQTLKSEYKNLLEEKETMSDELQAARQRLLVEEKQRKAIEYELVKLKKTAPEHDDDFEDKKPYTKDYISKGSSRFGAP***************RATIAKICDEVGLPKILQLLTSEDPDVQIHAVKVVANLAAEDINQEKIVEEGGLDALLLLLRTSQNTTILRVASGAIANLAMNEMNQGLIMSRGGGQLLAKTASKTDDPQTLRMVAGALANLCGNEKLHTMLEEDGAIKALLAMVRSGNIDVIAQVARGLANFAKCESRAIVQGQRKGRSHLMEDSALEWLIANSKTNSASTRRHVELALCHLAQNEDNARDFISRGGAKELVQISIESSREDIRNLAKKTMKSNPRLQADTHA
MKVVNMVKLKEEFDYESLCRKLETQVDHLTAEIERKQKLRENDKCELEKLLRECQISYDEAKDNLVTQVELLTAKIEMQQKLRENDKYEFEKQLRESQISYDESMRNLVTRSEFLEKENAHLELEVEKILGELNHQKDQNNLKREKIVQLEISLKNSKQQQLDNSSYQKVLADTTQMYEKKITELIKQLEIEHARSEGAEEQVDTMKKLISDNQKSIEQYEMENSTYQKALADTTQLYEKKIAELNKKLEDEHACFEGAVEQLDMVKKLLSDYQNSNQGQKEVHELCVKLKETRQLHESAVYEVQTLKSEYKNLLEEKETMSDELQAARQRLLVEEKQRKAIEYELVKLKKTAPEHDDDFEDKKPYTKDYISKGSSRFGAPMSLQKSNPSRELSGQRATIAKICDEVGLPKILQLLTSEDPDVQIHAVKVVANLAAEDINQEKIVEEGGLDALLLLLRTSQNTTILRVASGAIANLAMNEMNQGLIMSRGGGQLLAKTASKTDDPQTLRMVAGALANLCGNEKLHTMLEEDGAIKALLAMVRSGNIDVIAQVARGLANFAKCESRAIVQGQRKGRSHLMEDSALEWLIANSKTNSASTRRHVELALCHLAQNEDNARDFISRGGAKELVQISIESSREDIRNLAKKTMKS**********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKVVNMVKLKEEFDYESLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxCQISYDEAKDNLVTQVELLTAKIEMQQKLRENDKYEFEKQLRESQISYDESxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQLDNSSYQKVLADTTQMYEKKITELIKQLEIEHARSEGAEEQVDTMKKLISDNQKSxxxxxxxxxxxxxxxxxxxxxYEKKIAELNKKLEDEHACFEGAVEQLDMVKKLLSDYQNSNQGQKEVHELCVKLKETRQLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRKAIEYELVKLKKTAPEHDDDFEDKKPYTKDYISKGSSRFGAPMSLQKSNPSRELSGQRATIAKICDEVGLPKILQLLTSEDPDVQIHAVKVVANLAAEDINQEKIVEEGGLDALLLLLRTSQNTTILRVASGAIANLAMNEMNQGLIMSRGGGQLLAKTASKTDDPQTLRMVAGALANLCGNEKLHTMLEEDGAIKALLAMVRSGNIDVIAQVARGLANFAKCESRAIVQGQRKGRSHLMEDSALEWLIANSKTNSASTRRHVELALCHLAQNEDNARDFISRGGAKELVQISIESSREDIRNLAKKTMKSNPRLQADTHA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query660 2.2.26 [Sep-21-2011]
Q9SV361051 Armadillo repeat-containi yes no 0.921 0.578 0.572 0.0
Q0DV28945 Armadillo repeat-containi yes no 0.819 0.572 0.442 1e-133
Q5VQ09891 Armadillo repeat-containi no no 0.674 0.499 0.463 3e-96
Q9LPC6894 Armadillo repeat-containi no no 0.671 0.495 0.450 1e-93
Q9FZ06919 Armadillo repeat-containi no no 0.371 0.266 0.614 4e-90
Q757R0 568 Vacuolar protein 8 OS=Ash yes no 0.324 0.376 0.309 2e-11
Q6CX49 579 Vacuolar protein 8 OS=Klu yes no 0.321 0.366 0.288 2e-10
Q6C5Y8 573 Vacuolar protein 8 OS=Yar yes no 0.362 0.417 0.290 4e-10
P39968 578 Vacuolar protein 8 OS=Sac yes no 0.324 0.370 0.291 8e-10
Q6FJV1 582 Vacuolar protein 8 OS=Can yes no 0.324 0.367 0.286 1e-09
>sp|Q9SV36|ARK1_ARATH Armadillo repeat-containing kinesin-like protein 1 OS=Arabidopsis thaliana GN=ARK1 PE=1 SV=2 Back     alignment and function desciption
 Score =  698 bits (1801), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/653 (57%), Positives = 485/653 (74%), Gaps = 45/653 (6%)

Query: 1    MKVVNMVKLKEEFDYESLCRKLETQVDHLTAEIERKQKLRENDKCELEKLLRECQISYDE 60
            MK+VNMVKLKEEFDYESLCRKLETQVDHLTAE+ER+ KLR ++K ELEK LREC+ S+ E
Sbjct: 439  MKIVNMVKLKEEFDYESLCRKLETQVDHLTAEVERQNKLRNSEKHELEKRLRECENSFAE 498

Query: 61   AKDNLVTQVELLTAKIEMQQKLRENDKYEFEKQLRESQISYDESMRNLVTRSEFLEKENA 120
            A+ N V                                           TRS+FLEKEN 
Sbjct: 499  AEKNAV-------------------------------------------TRSKFLEKENT 515

Query: 121  HLELEVEKILGELNHQKDQNNLKREKIVQLEISLKNSKQQQLDNSSYQKVLADTTQMYEK 180
             LEL ++++L +L  QKDQ +L  +K +QLE+ LKN+KQQQL+NS+Y+  LADT+Q+YEK
Sbjct: 516  RLELSMKELLKDLQLQKDQCDLMHDKAIQLEMKLKNTKQQQLENSAYEAKLADTSQVYEK 575

Query: 181  KITELIKQLEIEHARSEGAEEQVDTMKKLISDNQKSIEQYEMENSTYQKALADTTQLYEK 240
            KI EL++++E E ARS  AE Q+  MK ++S  QKSI + E  N  YQ+ LA+TT  YE 
Sbjct: 576  KIAELVQRVEDEQARSTNAEHQLTEMKNILSKQQKSIHEQEKGNYQYQRELAETTHTYES 635

Query: 241  KIAELNKKLEDEHACFEGAVEQLDMVKKLLSDYQNSNQGQKEVHELCVKLKETRQLHESA 300
            KIAEL KKLE E+A    A +QL  +K+L+SD Q  +Q  +E +EL +KL+E  Q++ES 
Sbjct: 636  KIAELQKKLEGENARSNAAEDQLRQMKRLISDRQVISQENEEANELKIKLEELSQMYEST 695

Query: 301  VYEVQTLKSEYKNLLEEKETMSDELQAARQRLLVEEKQRKAIEYELVKLKKTAPEHDDDF 360
            V E+QT+K +Y +LL++KE + +E++  ++RLL+EEKQRK +E EL KLKK   E ++  
Sbjct: 696  VDELQTVKLDYDDLLQQKEKLGEEVRDMKERLLLEEKQRKQMESELSKLKKNLRESENVV 755

Query: 361  EDKKPYTKDYISKGSSRFGAPMSLQKSNP-SRELSGQRATIAKICDEVGLPKILQLLTSE 419
            E+K+ Y K+ +SKGS+  GA    Q+S    + LSGQRAT+A++C+EVG+ KILQL+ SE
Sbjct: 756  EEKR-YMKEDLSKGSAESGAQTGSQRSQGLKKSLSGQRATMARLCEEVGIQKILQLIKSE 814

Query: 420  DPDVQIHAVKVVANLAAEDINQEKIVEEGGLDALLLLLRTSQNTTILRVASGAIANLAMN 479
            D +VQI AVKVVANLAAE+ NQ KIVEEGG++ALL+L+++SQN+TILRVASGAIANLAMN
Sbjct: 815  DLEVQIQAVKVVANLAAEEANQVKIVEEGGVEALLMLVQSSQNSTILRVASGAIANLAMN 874

Query: 480  EMNQGLIMSRGGGQLLAKTASKTDDPQTLRMVAGALANLCGNEKLHTMLEEDGAIKALLA 539
            E +Q LIM++GG QLLAK  +KTDDPQTLRMVAGALANLCGNEK   +L+E+  IK LL 
Sbjct: 875  EKSQDLIMNKGGAQLLAKMVTKTDDPQTLRMVAGALANLCGNEKFLKLLKEEEGIKGLLT 934

Query: 540  MVRSGNIDVIAQVARGLANFAKCESRAIVQGQRKGRSHLMEDSALEWLIANSKTNSASTR 599
            M +SGNID+IAQVARG+ANFAKCE+R I+QG+RKGRS L+E+  LEWL +NS  +SAST+
Sbjct: 935  MAQSGNIDIIAQVARGMANFAKCETREIMQGRRKGRSLLLEEGVLEWLTSNSHIDSASTQ 994

Query: 600  RHVELALCHLAQNEDNARDFISRGGAKELVQISIESSREDIRNLAKKTMKSNP 652
            RH+ELALCHLAQNE+NA DF   G   E+V+IS+ESSR+DIR+LAKK +K+NP
Sbjct: 995  RHIELALCHLAQNEENANDFKRTGSVTEIVRISVESSRDDIRSLAKKILKTNP 1047
Involved in the control of root hair tip growth by promoting microtubule depolymerization and limiting the accumulation of endoplasmic microtubules. In vitro, binds to polymerized actin through ARM repeats, and to polymerized tubulin through N-terminal motor domain.
Arabidopsis thaliana (taxid: 3702)
>sp|Q0DV28|ARK1_ORYSJ Armadillo repeat-containing kinesin-like protein 1 OS=Oryza sativa subsp. japonica GN=Os03g0152900 PE=2 SV=2 Back     alignment and function description
>sp|Q5VQ09|ARK2_ORYSJ Armadillo repeat-containing kinesin-like protein 2 OS=Oryza sativa subsp. japonica GN=Os06g0137100 PE=2 SV=1 Back     alignment and function description
>sp|Q9LPC6|ARK2_ARATH Armadillo repeat-containing kinesin-like protein 2 OS=Arabidopsis thaliana GN=ARK2 PE=1 SV=2 Back     alignment and function description
>sp|Q9FZ06|ARK3_ARATH Armadillo repeat-containing kinesin-like protein 3 OS=Arabidopsis thaliana GN=ARK3 PE=1 SV=1 Back     alignment and function description
>sp|Q757R0|VAC8_ASHGO Vacuolar protein 8 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=VAC8 PE=3 SV=3 Back     alignment and function description
>sp|Q6CX49|VAC8_KLULA Vacuolar protein 8 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=VAC8 PE=3 SV=3 Back     alignment and function description
>sp|Q6C5Y8|VAC8_YARLI Vacuolar protein 8 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=VAC8 PE=3 SV=1 Back     alignment and function description
>sp|P39968|VAC8_YEAST Vacuolar protein 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VAC8 PE=1 SV=3 Back     alignment and function description
>sp|Q6FJV1|VAC8_CANGA Vacuolar protein 8 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=VAC8 PE=3 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query660
224109820 1067 predicted protein [Populus trichocarpa] 0.933 0.577 0.663 0.0
359486877 1017 PREDICTED: armadillo repeat-containing k 0.930 0.603 0.668 0.0
296085981 1331 unnamed protein product [Vitis vinifera] 0.930 0.461 0.663 0.0
255577444 1051 Kinesin-II 85 kDa subunit, putative [Ric 0.915 0.574 0.632 0.0
449444628 1061 PREDICTED: armadillo repeat-containing k 0.924 0.574 0.610 0.0
5541717 1070 kinesin-like protein [Arabidopsis thalia 0.927 0.571 0.569 0.0
193806750 1051 RecName: Full=Armadillo repeat-containin 0.921 0.578 0.572 0.0
297816786 1051 morphogenesis of root hair 2 [Arabidopsi 0.927 0.582 0.569 0.0
30694137 941 armadillo repeat-containing kinesin-like 0.725 0.509 0.553 1e-144
108706236 900 Kinesin motor domain containing protein, 0.819 0.601 0.442 1e-131
>gi|224109820|ref|XP_002315323.1| predicted protein [Populus trichocarpa] gi|222864363|gb|EEF01494.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  834 bits (2155), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/660 (66%), Positives = 513/660 (77%), Gaps = 44/660 (6%)

Query: 1    MKVVNMVKLKEEFDYESLCRKLETQVDHLTAEIERKQKLRENDKCELEKLLRECQISYDE 60
            MK+VNMVKLKEEFDYESLCRKLET                                    
Sbjct: 447  MKIVNMVKLKEEFDYESLCRKLET------------------------------------ 470

Query: 61   AKDNLVTQVELLTAKIEMQQKLRENDKYEFEKQLRESQISYDESMRNLVTRSEFLEKENA 120
                   QV+ LTA++E ++KLRE +K + EKQL++ Q+S+ ES +NLVTRSEFL+KEN 
Sbjct: 471  -------QVDHLTAELEREKKLRECEKLDLEKQLKQCQVSFSESEKNLVTRSEFLQKENT 523

Query: 121  HLELEVEKILGELNHQKDQNNLKREKIVQLEISLKNSKQQQLDNSSYQKVLADTTQMYEK 180
             LE+E++ IL EL  QK  N+L R+K+ QLEISL NS+Q QL+NS+YQK+LADTTQMYEK
Sbjct: 524  RLEVEMQDILSELESQKGCNDLMRDKVSQLEISLNNSQQHQLENSTYQKMLADTTQMYEK 583

Query: 181  KITELIKQLEIEHARSEGAEEQVDTMKKLISDNQKSIEQYEMENSTYQKALADTTQLYEK 240
            KI+ELIKQLE E AR E AEE+++  K L+ D QKSI+Q+E+ENS YQKALADTTQLYEK
Sbjct: 584  KISELIKQLENECARCERAEERLNLTKNLLGDYQKSIKQHEVENSVYQKALADTTQLYEK 643

Query: 241  KIAELNKKLEDEHACFEGAVEQLDMVKKLLSDYQNSNQGQKEVHELCVKLKETRQLHESA 300
            KIAEL K++EDEH   EGA EQLD+  KLLSD Q+  Q  KE  EL +KL+   Q HESA
Sbjct: 644  KIAELIKQVEDEHTRLEGAEEQLDLANKLLSDQQHLMQDLKETAELRMKLQRICQAHESA 703

Query: 301  VYEVQTLKSEYKNLLEEKETMSDELQAARQRLLVEEKQRKAIEYELVKLKKTAPEHDDDF 360
              E+Q+LK E+KNL  EK  +S+EL   +Q L  EEKQRK+IE+EL KLKK+APE D DF
Sbjct: 704  QTELQSLKLEHKNLSREKAILSEELHDMKQALAAEEKQRKSIEHELDKLKKSAPESDKDF 763

Query: 361  EDKKPYTKDYISKGSSRFGAPMSLQKSNPSRE-LSGQRATIAKICDEVGLPKILQLLTSE 419
            EDKKP+ K+ I  GSS FG    L KSN S+  LS QRATIAKIC+EVGL KILQLLTSE
Sbjct: 764  EDKKPFGKENIGNGSSTFGNLKGLHKSNSSKAALSSQRATIAKICEEVGLKKILQLLTSE 823

Query: 420  DPDVQIHAVKVVANLAAEDINQEKIVEEGGLDALLLLLRTSQNTTILRVASGAIANLAMN 479
            D DVQIHAVKV+ANLAAEDINQEKIVEEGGLDALL+LL++SQNTT+LRVASGAIANLAMN
Sbjct: 824  DSDVQIHAVKVIANLAAEDINQEKIVEEGGLDALLMLLKSSQNTTVLRVASGAIANLAMN 883

Query: 480  EMNQGLIMSRGGGQLLAKTASKTDDPQTLRMVAGALANLCGNEKLHTMLEEDGAIKALLA 539
            E+NQGLIMS+GGGQLLAKTA KTDDPQTLRMVAGALANLCGNE LH +L+EDG I ALL 
Sbjct: 884  ELNQGLIMSKGGGQLLAKTAFKTDDPQTLRMVAGALANLCGNESLHMILKEDGGINALLG 943

Query: 540  MVRSGNIDVIAQVARGLANFAKCESRAIVQGQRKGRSHLMEDSALEWLIANSKTNSASTR 599
            M RSGN DVIAQVARG+ANFAKCESR I+QG RKGRS L+ED  LEWL++ S T SASTR
Sbjct: 944  MARSGNNDVIAQVARGMANFAKCESRGIIQGHRKGRSLLIEDGVLEWLVSYSNTASASTR 1003

Query: 600  RHVELALCHLAQNEDNARDFISRGGAKELVQISIESSREDIRNLAKKTMKSNPRLQADTH 659
            RHVELALCHLAQN++N R+FIS GG +ELV+IS+ES+REDIRNLAKKT+K NP  QA+ +
Sbjct: 1004 RHVELALCHLAQNDNNDREFISCGGVRELVRISVESNREDIRNLAKKTLKMNPTFQAEVN 1063

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359486877|ref|XP_002273191.2| PREDICTED: armadillo repeat-containing kinesin-like protein 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296085981|emb|CBI31422.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255577444|ref|XP_002529601.1| Kinesin-II 85 kDa subunit, putative [Ricinus communis] gi|223530934|gb|EEF32793.1| Kinesin-II 85 kDa subunit, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449444628|ref|XP_004140076.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1-like [Cucumis sativus] gi|449490427|ref|XP_004158602.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|5541717|emb|CAB41097.2| kinesin-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|193806750|sp|Q9SV36.2|ARK1_ARATH RecName: Full=Armadillo repeat-containing kinesin-like protein 1; AltName: Full=Protein MORPHOGENESIS OF ROOT HAIR 2 gi|161138211|gb|ABX58060.1| morphogenesis of root hair 2 [Arabidopsis thaliana] gi|162958323|dbj|BAF95585.1| armadillo repeat kinesin1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297816786|ref|XP_002876276.1| morphogenesis of root hair 2 [Arabidopsis lyrata subsp. lyrata] gi|297322114|gb|EFH52535.1| morphogenesis of root hair 2 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|30694137|ref|NP_191047.3| armadillo repeat-containing kinesin-like protein 1 [Arabidopsis thaliana] gi|332645782|gb|AEE79303.1| armadillo repeat-containing kinesin-like protein 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|108706236|gb|ABF94031.1| Kinesin motor domain containing protein, expressed [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query660
TAIR|locus:2025497915 ARK2 "armadillo repeat kinesin 0.760 0.548 0.404 2.4e-83
GENEDB_PFALCIPARUM|PF11_02181544 PF11_0218 "hypothetical protei 0.531 0.227 0.261 7.3e-17
UNIPROTKB|Q8IIF61544 PF11_0218 "Conserved Plasmodiu 0.531 0.227 0.261 7.3e-17
UNIPROTKB|E1BSI8 1451 FYCO1 "Uncharacterized protein 0.503 0.228 0.25 1.3e-14
UNIPROTKB|F1NDQ5 1891 CCDC88A "Uncharacterized prote 0.913 0.318 0.217 3.7e-14
ZFIN|ZDB-GENE-091112-18 1686 si:ch211-150d5.2 "si:ch211-150 0.504 0.197 0.221 2.4e-13
DICTYBASE|DDB_G0271058 1528 vilC "villin-like protein C" [ 0.568 0.245 0.254 2.7e-13
MGI|MGI:19284011391 Clip1 "CAP-GLY domain containi 0.651 0.309 0.255 3.9e-13
DICTYBASE|DDB_G0290503 1492 DDB_G0290503 [Dictyostelium di 0.498 0.220 0.273 9.1e-13
MGI|MGI:105931 993 Sycp1 "synaptonemal complex pr 0.527 0.350 0.259 1.5e-12
TAIR|locus:2025497 ARK2 "armadillo repeat kinesin 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 835 (299.0 bits), Expect = 2.4e-83, P = 2.4e-83
 Identities = 211/522 (40%), Positives = 310/522 (59%)

Query:   145 EKIVQLEISLKNSKQQQLDNSSYQKVLADTTQMYEKKITELIKQLEIEHARSEGAEEQVD 204
             ++ +++E  LK   +++ D  S  K L    Q+ +K I E  +QL+   A  +  E    
Sbjct:   397 QRAMKVENMLKI--KEEFDYKSLSKKLE--VQL-DKVIAENERQLK---AFDDDVERINR 448

Query:   205 TMKKLISDNQKSI-EQYEMENSTYQKALADTTQLYEKKIAELNKKLED--EHACFEGAVE 261
               +  IS+ +K+  E  E E    Q    ++ +  E+K+    +  E+   +    G V 
Sbjct:   449 QAQNRISEVEKNFAEALEKEKLKCQMEYMESVKKLEEKLISNQRNHENGKRNGEVNGVVT 508

Query:   262 QLDMVKKLLSDYQNSNQGQKEVHELCVKLKETRQLHESAVYEVQTLKSEYKNLLEE---- 317
               +  + L    +N  + +K   E   K+K    L   +        +  + LLE+    
Sbjct:   509 ASEFTR-LKESLENEMKLRKSAEEEVSKVKSQSTLKTRSGEGEDAGITRLQKLLEDEALQ 567

Query:   318 KETMSDELQAARQRLLVEEKQRKAIEYELV-KLKKTAPEHDDDFEDKKPYTKDYISKGSS 376
             K+ + +E+   R +L+    +   I    +  LK     H   F+ ++    D  + G+S
Sbjct:   568 KKKLEEEVTILRSQLVQLTFEADQISLHCMPSLKILLNTHVLFFQMRR--CLDRGAPGNS 625

Query:   377 RFGAPMSLQKSNPSRE-LSGQRATIAKICDEVGLPKILQLLTSEDPDVQIHAVKVVANLA 435
               G      + + +RE ++GQ+A  A +C++VGL KILQLL S+D +++IHAVKVVANLA
Sbjct:   626 YSGTDSLPSRHSQARESVNGQKAPFATLCEQVGLQKILQLLESDDANIRIHAVKVVANLA 685

Query:   436 AEDINQEKIVEEGGLDAXXXXXRTSQNTTILRVASGAIANLAMNEMNQGLIMSRGGGQLL 495
             AE+ NQEKIVE GGL +     R+ ++ T+ RVA+GAIANLAMNE++Q LI+ +GG  LL
Sbjct:   686 AEEANQEKIVEAGGLTSLLMLLRSYEDETVRRVAAGAIANLAMNEVSQQLIVDQGGISLL 745

Query:   496 AKTASKTDDPQTLRMVAGALANLCGNEKLHTMLEEDGAIKALLAMVRSGNIDVIAQVARG 555
             + TA+  +DPQTLRMVAGA+ANLCGN+KL   L  DG IKALL MVR G+ DV+AQVARG
Sbjct:   746 SLTAADAEDPQTLRMVAGAIANLCGNDKLQARLWSDGGIKALLGMVRCGHPDVLAQVARG 805

Query:   556 LANFAKCESRAIVQGQRKGRSHLMEDSALEWLIANSKTNSASTRRHVELALCHLAQNEDN 615
             +ANFAKCESRA  QG + GRS L+ED AL W++ ++   +A  RRH+ELALCHLAQ+E N
Sbjct:   806 IANFAKCESRATTQGVKSGRSLLIEDGALPWIVQHANDEAAPIRRHIELALCHLAQHEVN 865

Query:   616 ARDFISRGGAKELVQISIESSREDIRNLAKKTMKSNPRLQAD 657
             A++ IS G   ELV+IS E SREDIR+LA +T+ S+P  +++
Sbjct:   866 AKEMISGGALWELVRISKECSREDIRSLAHRTLSSSPVFRSE 907
GO:0003777 "microtubule motor activity" evidence=IEA;ISS
GO:0005524 "ATP binding" evidence=IEA
GO:0007018 "microtubule-based movement" evidence=IEA
GO:0048364 "root development" evidence=IMP
GENEDB_PFALCIPARUM|PF11_0218 PF11_0218 "hypothetical protein" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IIF6 PF11_0218 "Conserved Plasmodium protein" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms
UNIPROTKB|E1BSI8 FYCO1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NDQ5 CCDC88A "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-091112-18 si:ch211-150d5.2 "si:ch211-150d5.2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0271058 vilC "villin-like protein C" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
MGI|MGI:1928401 Clip1 "CAP-GLY domain containing linker protein 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0290503 DDB_G0290503 [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
MGI|MGI:105931 Sycp1 "synaptonemal complex protein 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00018145001
SubName- Full=Chromosome chr13 scaffold_17, whole genome shotgun sequence; (995 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query660
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 1e-11
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-07
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 3e-06
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 5e-06
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 9e-06
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 1e-05
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 2e-05
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 3e-05
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 5e-05
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 6e-05
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 8e-05
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 1e-04
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 2e-04
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 2e-04
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 4e-04
pfam13166713 pfam13166, AAA_13, AAA domain 4e-04
PRK03918880 PRK03918, PRK03918, chromosome segregation protein 8e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.002
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.003
pfam06785401 pfam06785, UPF0242, Uncharacterized protein family 0.003
pfam0051441 pfam00514, Arm, Armadillo/beta-catenin-like repeat 0.003
pfam1364688 pfam13646, HEAT_2, HEAT repeats 0.004
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information 
 Score = 61.6 bits (150), Expect = 1e-11
 Identities = 37/120 (30%), Positives = 62/120 (51%), Gaps = 2/120 (1%)

Query: 401 AKICDEVGLPKILQLLTSEDPDVQIHAVKVVANLAAEDINQEK-IVEEGGLDALLLLLRT 459
             +    GLP ++ LL+S D +VQ  A   ++NL+A + +  + +VE GGL AL+ LL  
Sbjct: 1   EAVIQAGGLPALVSLLSSSDENVQREAAWALSNLSAGNNDNIQAVVEAGGLPALVQLL-K 59

Query: 460 SQNTTILRVASGAIANLAMNEMNQGLIMSRGGGQLLAKTASKTDDPQTLRMVAGALANLC 519
           S++  +++ A  A+ NLA    +  LI+   GG         + +    +   GAL+NL 
Sbjct: 60  SEDEEVVKAALWALRNLAAGPEDNKLIVLEAGGVPKLVNLLDSSNEDIQKNATGALSNLA 119

An approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila segment polarity gene armadillo; these repeats were also found in the mammalian armadillo homolog beta-catenin, the junctional plaque protein plakoglobin, the adenomatous polyposis coli (APC) tumor suppressor protein, and a number of other proteins. ARM has been implicated in mediating protein-protein interactions, but no common features among the target proteins recognized by the ARM repeats have been identified; related to the HEAT domain; three consecutive copies of the repeat are represented by this alignment model. Length = 120
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|221952 pfam13166, AAA_13, AAA domain Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|219176 pfam06785, UPF0242, Uncharacterized protein family (UPF0242) Back     alignment and domain information
>gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat Back     alignment and domain information
>gnl|CDD|222285 pfam13646, HEAT_2, HEAT repeats Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 660
KOG0166 514 consensus Karyopherin (importin) alpha [Intracellu 99.92
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 99.91
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 99.9
KOG4224 550 consensus Armadillo repeat protein VAC8 required f 99.9
KOG4224 550 consensus Armadillo repeat protein VAC8 required f 99.9
COG5064 526 SRP1 Karyopherin (importin) alpha [Intracellular t 99.89
KOG0166 514 consensus Karyopherin (importin) alpha [Intracellu 99.89
COG5064526 SRP1 Karyopherin (importin) alpha [Intracellular t 99.84
PF05804708 KAP: Kinesin-associated protein (KAP) 99.77
KOG4199461 consensus Uncharacterized conserved protein [Funct 99.71
PF05804 708 KAP: Kinesin-associated protein (KAP) 99.68
KOG4199461 consensus Uncharacterized conserved protein [Funct 99.62
KOG1048717 consensus Neural adherens junction protein Plakoph 99.56
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 99.54
KOG2122 2195 consensus Beta-catenin-binding protein APC, contai 99.5
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 99.44
KOG1048 717 consensus Neural adherens junction protein Plakoph 99.41
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 99.32
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 99.32
PRK09687280 putative lyase; Provisional 99.29
KOG2122 2195 consensus Beta-catenin-binding protein APC, contai 99.26
KOG0240607 consensus Kinesin (SMY1 subfamily) [Cytoskeleton] 99.24
PF10508 503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 99.2
PF10508 503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 99.19
KOG4500 604 consensus Rho/Rac GTPase guanine nucleotide exchan 99.12
PRK09687280 putative lyase; Provisional 99.12
KOG1222 791 consensus Kinesin associated protein KAP [Intracel 99.05
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 99.02
cd00256429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 98.99
KOG2160342 consensus Armadillo/beta-catenin-like repeat-conta 98.86
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 98.84
KOG3678 832 consensus SARM protein (with sterile alpha and arm 98.82
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 98.81
KOG2160342 consensus Armadillo/beta-catenin-like repeat-conta 98.79
KOG0168 1051 consensus Putative ubiquitin fusion degradation pr 98.78
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 98.76
KOG4646173 consensus Uncharacterized conserved protein, conta 98.72
KOG0168 1051 consensus Putative ubiquitin fusion degradation pr 98.71
KOG3678 832 consensus SARM protein (with sterile alpha and arm 98.71
KOG2759442 consensus Vacuolar H+-ATPase V1 sector, subunit H 98.7
KOG1222 791 consensus Kinesin associated protein KAP [Intracel 98.69
cd00256429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 98.69
KOG4500604 consensus Rho/Rac GTPase guanine nucleotide exchan 98.55
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 98.49
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 98.49
PF01602 526 Adaptin_N: Adaptin N terminal region; InterPro: IP 98.46
KOG0996 1293 consensus Structural maintenance of chromosome pro 98.33
KOG4646173 consensus Uncharacterized conserved protein, conta 98.33
KOG2759442 consensus Vacuolar H+-ATPase V1 sector, subunit H 98.27
TIGR02168 1179 SMC_prok_B chromosome segregation protein SMC, com 98.26
PF01602 526 Adaptin_N: Adaptin N terminal region; InterPro: IP 98.23
PRK02224880 chromosome segregation protein; Provisional 98.22
TIGR02169 1164 SMC_prok_A chromosome segregation protein SMC, pri 98.21
KOG1293678 consensus Proteins containing armadillo/beta-caten 98.19
KOG2973353 consensus Uncharacterized conserved protein [Funct 98.19
PRK02224880 chromosome segregation protein; Provisional 98.16
KOG0946 970 consensus ER-Golgi vesicle-tethering protein p115 98.15
KOG1293678 consensus Proteins containing armadillo/beta-caten 98.15
KOG2171 1075 consensus Karyopherin (importin) beta 3 [Nuclear s 98.14
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 98.05
KOG0946 970 consensus ER-Golgi vesicle-tethering protein p115 98.05
PF05536 543 Neurochondrin: Neurochondrin 98.04
TIGR02270 410 conserved hypothetical protein. Members are found 98.04
KOG4674 1822 consensus Uncharacterized conserved coiled-coil pr 98.03
KOG2973353 consensus Uncharacterized conserved protein [Funct 98.01
PF00038312 Filament: Intermediate filament protein; InterPro: 97.94
KOG0240607 consensus Kinesin (SMY1 subfamily) [Cytoskeleton] 97.92
COG1413335 FOG: HEAT repeat [Energy production and conversion 97.9
TIGR02270 410 conserved hypothetical protein. Members are found 97.89
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 97.88
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 97.85
PF00038312 Filament: Intermediate filament protein; InterPro: 97.84
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 97.81
KOG2171 1075 consensus Karyopherin (importin) beta 3 [Nuclear s 97.79
PTZ00429 746 beta-adaptin; Provisional 97.76
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 97.75
COG1413335 FOG: HEAT repeat [Energy production and conversion 97.74
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 97.7
KOG0977546 consensus Nuclear envelope protein lamin, intermed 97.64
PTZ00429 746 beta-adaptin; Provisional 97.63
PF07888546 CALCOCO1: Calcium binding and coiled-coil domain ( 97.62
KOG0964 1200 consensus Structural maintenance of chromosome pro 97.58
KOG1517 1387 consensus Guanine nucleotide binding protein MIP1 97.58
TIGR006061311 rad50 rad50. This family is based on the phylogeno 97.54
KOG4674 1822 consensus Uncharacterized conserved coiled-coil pr 97.54
KOG0996 1293 consensus Structural maintenance of chromosome pro 97.53
PF01576 859 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu 97.53
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 97.43
PF07888546 CALCOCO1: Calcium binding and coiled-coil domain ( 97.39
PF14664371 RICTOR_N: Rapamycin-insensitive companion of mTOR, 97.37
KOG0933 1174 consensus Structural maintenance of chromosome pro 97.37
KOG1059 877 consensus Vesicle coat complex AP-3, delta subunit 97.32
PF05536 543 Neurochondrin: Neurochondrin 97.31
KOG0977546 consensus Nuclear envelope protein lamin, intermed 97.31
KOG1517 1387 consensus Guanine nucleotide binding protein MIP1 97.3
KOG4413 524 consensus 26S proteasome regulatory complex, subun 97.26
KOG2023 885 consensus Nuclear transport receptor Karyopherin-b 97.26
PF01576859 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu 97.24
KOG17892235 consensus Endocytosis protein RME-8, contains DnaJ 97.19
KOG0999 772 consensus Microtubule-associated protein Bicaudal- 97.18
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 97.18
PF14664 371 RICTOR_N: Rapamycin-insensitive companion of mTOR, 97.12
PRK03918880 chromosome segregation protein; Provisional 97.1
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 97.08
TIGR006061311 rad50 rad50. This family is based on the phylogeno 97.08
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 97.07
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 97.06
KOG2734 536 consensus Uncharacterized conserved protein [Funct 97.04
COG5231432 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Ene 97.03
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 97.02
COG5369743 Uncharacterized conserved protein [Function unknow 96.96
PF09759102 Atx10homo_assoc: Spinocerebellar ataxia type 10 pr 96.94
COG5181975 HSH155 U2 snRNP spliceosome subunit [RNA processin 96.92
PF10174775 Cast: RIM-binding protein of the cytomatrix active 96.9
KOG4673961 consensus Transcription factor TMF, TATA element m 96.9
PRK03918880 chromosome segregation protein; Provisional 96.89
PF10165 446 Ric8: Guanine nucleotide exchange factor synembryn 96.86
KOG2734 536 consensus Uncharacterized conserved protein [Funct 96.85
PHA02562562 46 endonuclease subunit; Provisional 96.85
PF10165 446 Ric8: Guanine nucleotide exchange factor synembryn 96.83
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 96.82
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 96.82
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 96.78
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 96.78
PF10174775 Cast: RIM-binding protein of the cytomatrix active 96.77
KOG02131172 consensus Splicing factor 3b, subunit 1 [RNA proce 96.77
PF06160560 EzrA: Septation ring formation regulator, EzrA ; I 96.76
KOG1242569 consensus Protein containing adaptin N-terminal re 96.76
KOG1242 569 consensus Protein containing adaptin N-terminal re 96.74
COG5369743 Uncharacterized conserved protein [Function unknow 96.71
PF05701522 WEMBL: Weak chloroplast movement under blue light; 96.7
KOG4413 524 consensus 26S proteasome regulatory complex, subun 96.69
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 96.66
PF09759102 Atx10homo_assoc: Spinocerebellar ataxia type 10 pr 96.65
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 96.65
KOG2023 885 consensus Nuclear transport receptor Karyopherin-b 96.58
KOG4593716 consensus Mitotic checkpoint protein MAD1 [Cell cy 96.57
PRK01156895 chromosome segregation protein; Provisional 96.55
KOG4643 1195 consensus Uncharacterized coiled-coil protein [Fun 96.54
PHA02562562 46 endonuclease subunit; Provisional 96.53
PF13764 802 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 96.53
KOG1241 859 consensus Karyopherin (importin) beta 1 [Nuclear s 96.49
PF04063192 DUF383: Domain of unknown function (DUF383); Inter 96.45
PF15070617 GOLGA2L5: Putative golgin subfamily A member 2-lik 96.44
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 96.43
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 96.41
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 96.41
PRK11637428 AmiB activator; Provisional 96.39
PRK14707 2710 hypothetical protein; Provisional 96.23
PF04063192 DUF383: Domain of unknown function (DUF383); Inter 96.22
KOG1061 734 consensus Vesicle coat complex AP-1/AP-2/AP-4, bet 96.2
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 96.19
PRK14707 2710 hypothetical protein; Provisional 96.18
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 96.16
PF121281201 DUF3584: Protein of unknown function (DUF3584); In 96.12
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 96.07
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 96.05
PF11707330 Npa1: Ribosome 60S biogenesis N-terminal; InterPro 96.05
KOG0212 675 consensus Uncharacterized conserved protein [Funct 96.05
PRK04778569 septation ring formation regulator EzrA; Provision 96.04
KOG3036293 consensus Protein involved in cell differentiation 96.03
PF11698119 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 96.03
KOG0976 1265 consensus Rho/Rac1-interacting serine/threonine ki 96.01
PRK04778569 septation ring formation regulator EzrA; Provision 95.96
KOG0212 675 consensus Uncharacterized conserved protein [Funct 95.91
KOG0971 1243 consensus Microtubule-associated protein dynactin 95.9
KOG1059 877 consensus Vesicle coat complex AP-3, delta subunit 95.86
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 95.86
PF11698119 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 95.85
KOG2259 823 consensus Uncharacterized conserved protein [Funct 95.84
PF09730 717 BicD: Microtubule-associated protein Bicaudal-D; I 95.83
KOG3036293 consensus Protein involved in cell differentiation 95.82
KOG4643 1195 consensus Uncharacterized coiled-coil protein [Fun 95.82
PRK11637428 AmiB activator; Provisional 95.77
KOG2259 823 consensus Uncharacterized conserved protein [Funct 95.76
PRK04863 1486 mukB cell division protein MukB; Provisional 95.75
KOG1943 1133 consensus Beta-tubulin folding cofactor D [Posttra 95.72
PRK01156 895 chromosome segregation protein; Provisional 95.72
PF11841160 DUF3361: Domain of unknown function (DUF3361) 95.68
PF11841160 DUF3361: Domain of unknown function (DUF3361) 95.58
PF08569335 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like pro 95.56
COG5096 757 Vesicle coat complex, various subunits [Intracellu 95.55
COG5096 757 Vesicle coat complex, various subunits [Intracellu 95.55
PF08569335 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like pro 95.55
KOG10291118 consensus Endocytic adaptor protein intersectin [S 95.54
PF04078262 Rcd1: Cell differentiation family, Rcd1-like ; Int 95.52
KOG1241 859 consensus Karyopherin (importin) beta 1 [Nuclear s 95.45
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 95.45
PF05004309 IFRD: Interferon-related developmental regulator ( 95.45
KOG4535 728 consensus HEAT and armadillo repeat-containing pro 95.42
KOG09331174 consensus Structural maintenance of chromosome pro 95.35
KOG00181141 consensus Structural maintenance of chromosome pro 95.33
KOG02131172 consensus Splicing factor 3b, subunit 1 [RNA proce 95.3
KOG2611 698 consensus Neurochondrin/leucine-rich protein (Neur 95.3
PF11701157 UNC45-central: Myosin-binding striated muscle asse 95.28
KOG2025 892 consensus Chromosome condensation complex Condensi 95.24
PF06025379 DUF913: Domain of Unknown Function (DUF913); Inter 95.23
PF12719298 Cnd3: Nuclear condensing complex subunits, C-term 95.22
KOG0567289 consensus HEAT repeat-containing protein [General 95.22
KOG4151748 consensus Myosin assembly protein/sexual cycle pro 95.17
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 95.14
KOG1060 968 consensus Vesicle coat complex AP-3, beta subunit 95.12
PF15070617 GOLGA2L5: Putative golgin subfamily A member 2-lik 95.0
PF05911 769 DUF869: Plant protein of unknown function (DUF869) 95.0
KOG2611 698 consensus Neurochondrin/leucine-rich protein (Neur 94.99
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 94.96
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 94.92
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 94.86
PF06160560 EzrA: Septation ring formation regulator, EzrA ; I 94.8
KOG1062 866 consensus Vesicle coat complex AP-1, gamma subunit 94.78
PF05004309 IFRD: Interferon-related developmental regulator ( 94.78
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 94.78
PF05557722 MAD: Mitotic checkpoint protein; InterPro: IPR0086 94.7
KOG1062 866 consensus Vesicle coat complex AP-1, gamma subunit 94.66
KOG1824 1233 consensus TATA-binding protein-interacting protein 94.66
PF05622713 HOOK: HOOK protein; InterPro: IPR008636 This famil 94.65
PRK04863 1486 mukB cell division protein MukB; Provisional 94.58
PF04078262 Rcd1: Cell differentiation family, Rcd1-like ; Int 94.56
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 94.54
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 94.54
PF1466873 RICTOR_V: Rapamycin-insensitive companion of mTOR, 94.39
COG5181975 HSH155 U2 snRNP spliceosome subunit [RNA processin 94.36
KOG00181141 consensus Structural maintenance of chromosome pro 94.36
KOG1943 1133 consensus Beta-tubulin folding cofactor D [Posttra 94.33
PF08045257 CDC14: Cell division control protein 14, SIN compo 94.31
KOG0964 1200 consensus Structural maintenance of chromosome pro 94.24
KOG0567289 consensus HEAT repeat-containing protein [General 94.2
PF1466873 RICTOR_V: Rapamycin-insensitive companion of mTOR, 94.16
KOG0963629 consensus Transcription factor/CCAAT displacement 94.15
KOG2062 929 consensus 26S proteasome regulatory complex, subun 94.08
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 94.02
PF05483786 SCP-1: Synaptonemal complex protein 1 (SCP-1); Int 93.98
KOG0982502 consensus Centrosomal protein Nuf [Cell cycle cont 93.9
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 93.75
KOG4151748 consensus Myosin assembly protein/sexual cycle pro 93.73
KOG4653982 consensus Uncharacterized conserved protein [Funct 93.64
TIGR03185650 DNA_S_dndD DNA sulfur modification protein DndD. T 93.61
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 93.61
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 93.6
KOG1061 734 consensus Vesicle coat complex AP-1/AP-2/AP-4, bet 93.52
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 93.5
PF08324268 PUL: PUL domain; InterPro: IPR013535 The PUL (afte 93.42
PF11701157 UNC45-central: Myosin-binding striated muscle asse 93.4
KOG1077 938 consensus Vesicle coat complex AP-2, alpha subunit 93.4
PRK09039343 hypothetical protein; Validated 93.38
PF05483786 SCP-1: Synaptonemal complex protein 1 (SCP-1); Int 93.32
PF10212518 TTKRSYEDQ: Predicted coiled-coil domain-containing 93.24
KOG04141251 consensus Chromosome condensation complex Condensi 93.23
COG5240 898 SEC21 Vesicle coat complex COPI, gamma subunit [In 93.18
KOG2032533 consensus Uncharacterized conserved protein [Funct 93.15
PF08324268 PUL: PUL domain; InterPro: IPR013535 The PUL (afte 93.06
COG5231432 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Ene 93.06
PF05557722 MAD: Mitotic checkpoint protein; InterPro: IPR0086 93.05
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 93.03
PF06371187 Drf_GBD: Diaphanous GTPase-binding Domain; InterPr 92.82
PF06371187 Drf_GBD: Diaphanous GTPase-binding Domain; InterPr 92.77
KOG4535728 consensus HEAT and armadillo repeat-containing pro 92.74
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 92.72
PF08045257 CDC14: Cell division control protein 14, SIN compo 92.68
COG5215 858 KAP95 Karyopherin (importin) beta [Intracellular t 92.49
PF09730717 BicD: Microtubule-associated protein Bicaudal-D; I 92.45
KOG1824 1233 consensus TATA-binding protein-interacting protein 92.4
KOG0414 1251 consensus Chromosome condensation complex Condensi 92.28
KOG2062 929 consensus 26S proteasome regulatory complex, subun 92.24
COG5218 885 YCG1 Chromosome condensation complex Condensin, su 92.16
COG5215 858 KAP95 Karyopherin (importin) beta [Intracellular t 92.15
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 92.0
PF13764 802 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 91.46
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 91.28
KOG0982502 consensus Centrosomal protein Nuf [Cell cycle cont 91.25
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 91.16
KOG2999 713 consensus Regulator of Rac1, required for phagocyt 91.1
KOG0995581 consensus Centromere-associated protein HEC1 [Cell 91.04
PF10481307 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 91.02
smart00638574 LPD_N Lipoprotein N-terminal Domain. 90.62
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 90.61
KOG2025 892 consensus Chromosome condensation complex Condensi 90.59
KOG0963629 consensus Transcription factor/CCAAT displacement 90.43
PF13251182 DUF4042: Domain of unknown function (DUF4042) 90.36
PRK09039343 hypothetical protein; Validated 90.34
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 90.25
TIGR01005754 eps_transp_fam exopolysaccharide transport protein 90.24
KOG2956516 consensus CLIP-associating protein [General functi 90.14
PF10481307 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 90.03
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 89.92
PF05622713 HOOK: HOOK protein; InterPro: IPR008636 This famil 89.88
KOG0999 772 consensus Microtubule-associated protein Bicaudal- 89.8
TIGR03007498 pepcterm_ChnLen polysaccharide chain length determ 89.67
COG5116 926 RPN2 26S proteasome regulatory complex component [ 89.63
KOG2274 1005 consensus Predicted importin 9 [Intracellular traf 89.6
KOG0915 1702 consensus Uncharacterized conserved protein [Funct 89.56
PF06008264 Laminin_I: Laminin Domain I; InterPro: IPR009254 L 89.55
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 89.53
PF05918 556 API5: Apoptosis inhibitory protein 5 (API5); Inter 89.45
TIGR00634563 recN DNA repair protein RecN. All proteins in this 89.39
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 89.37
COG4942420 Membrane-bound metallopeptidase [Cell division and 89.02
COG5116 926 RPN2 26S proteasome regulatory complex component [ 89.0
PF12719298 Cnd3: Nuclear condensing complex subunits, C-term 88.96
KOG1058 948 consensus Vesicle coat complex COPI, beta subunit 88.67
KOG0915 1702 consensus Uncharacterized conserved protein [Funct 88.66
KOG1077 938 consensus Vesicle coat complex AP-2, alpha subunit 88.63
TIGR03007498 pepcterm_ChnLen polysaccharide chain length determ 88.48
PF06025 379 DUF913: Domain of Unknown Function (DUF913); Inter 88.44
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 88.43
KOG1060 968 consensus Vesicle coat complex AP-3, beta subunit 88.38
PF01347618 Vitellogenin_N: Lipoprotein amino terminal region; 88.37
PF0858179 Tup_N: Tup N-terminal; InterPro: IPR013890 The N-t 88.27
COG1340294 Uncharacterized archaeal coiled-coil protein [Func 88.0
COG5209315 RCD1 Uncharacterized protein involved in cell diff 87.9
KOG1820 815 consensus Microtubule-associated protein [Cytoskel 87.84
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 87.51
PF05010207 TACC: Transforming acidic coiled-coil-containing p 87.49
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 87.48
KOG1991 1010 consensus Nuclear transport receptor RANBP7/RANBP8 87.37
COG2433652 Uncharacterized conserved protein [Function unknow 87.35
PF05918 556 API5: Apoptosis inhibitory protein 5 (API5); Inter 87.27
PF14073178 Cep57_CLD: Centrosome localisation domain of Cep57 87.21
KOG0980980 consensus Actin-binding protein SLA2/Huntingtin-in 87.15
KOG1003205 consensus Actin filament-coating protein tropomyos 87.0
PRK09169 2316 hypothetical protein; Validated 86.98
PF09787511 Golgin_A5: Golgin subfamily A member 5; InterPro: 86.9
COG4942420 Membrane-bound metallopeptidase [Cell division and 86.52
PF15066527 CAGE1: Cancer-associated gene protein 1 family 86.49
COG5209315 RCD1 Uncharacterized protein involved in cell diff 86.43
KOG4653982 consensus Uncharacterized conserved protein [Funct 86.12
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 86.09
PF01347618 Vitellogenin_N: Lipoprotein amino terminal region; 86.01
KOG1248 1176 consensus Uncharacterized conserved protein [Funct 85.79
PF14988206 DUF4515: Domain of unknown function (DUF4515) 85.76
KOG02431041 consensus Kinesin-like protein [Cytoskeleton] 85.7
KOG2274 1005 consensus Predicted importin 9 [Intracellular traf 85.66
KOG2999 713 consensus Regulator of Rac1, required for phagocyt 85.45
KOG1078 865 consensus Vesicle coat complex COPI, gamma subunit 85.3
COG4026290 Uncharacterized protein containing TOPRIM domain, 85.15
KOG4360596 consensus Uncharacterized coiled coil protein [Fun 85.14
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 84.88
TIGR01005754 eps_transp_fam exopolysaccharide transport protein 84.77
KOG2032533 consensus Uncharacterized conserved protein [Funct 84.73
KOG1248 1176 consensus Uncharacterized conserved protein [Funct 84.6
PF13851201 GAS: Growth-arrest specific micro-tubule binding 84.51
PF15035182 Rootletin: Ciliary rootlet component, centrosome c 84.36
KOG1949 1005 consensus Uncharacterized conserved protein [Funct 84.29
PF07814361 WAPL: Wings apart-like protein regulation of heter 84.1
KOG1058 948 consensus Vesicle coat complex COPI, beta subunit 83.9
TIGR03185650 DNA_S_dndD DNA sulfur modification protein DndD. T 83.63
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 83.49
COG5240 898 SEC21 Vesicle coat complex COPI, gamma subunit [In 83.49
PF12530234 DUF3730: Protein of unknown function (DUF3730) ; I 83.42
KOG1003205 consensus Actin filament-coating protein tropomyos 82.9
COG0419908 SbcC ATPase involved in DNA repair [DNA replicatio 82.78
KOG2137 700 consensus Protein kinase [Signal transduction mech 82.75
KOG1949 1005 consensus Uncharacterized conserved protein [Funct 82.25
PF14073178 Cep57_CLD: Centrosome localisation domain of Cep57 81.98
KOG2933334 consensus Uncharacterized conserved protein [Funct 81.97
PF08167165 RIX1: rRNA processing/ribosome biogenesis 81.96
KOG1991 1010 consensus Nuclear transport receptor RANBP7/RANBP8 81.87
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 81.82
PF12031257 DUF3518: Domain of unknown function (DUF3518); Int 81.76
PF07814 361 WAPL: Wings apart-like protein regulation of heter 81.73
PF11707330 Npa1: Ribosome 60S biogenesis N-terminal; InterPro 81.33
KOG0301745 consensus Phospholipase A2-activating protein (con 81.32
KOG0211 759 consensus Protein phosphatase 2A regulatory subuni 81.22
PF06008264 Laminin_I: Laminin Domain I; InterPro: IPR009254 L 81.04
KOG0211 759 consensus Protein phosphatase 2A regulatory subuni 81.01
PF10498359 IFT57: Intra-flagellar transport protein 57 ; Inte 81.0
PRK10869553 recombination and repair protein; Provisional 80.9
KOG19671030 consensus DNA repair/transcription protein Mms19 [ 80.6
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 80.25
COG4477570 EzrA Negative regulator of septation ring formatio 80.01
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information 
Probab=99.92  E-value=2.8e-23  Score=228.24  Aligned_cols=275  Identities=17%  Similarity=0.216  Sum_probs=231.9

Q ss_pred             cccchhhhhhcccC-CCccccccchhhh---hhcCchhH-HHHHhCCCHHHHHHhhCCCCHHHHHHHHHHHHHhhC-Cch
Q 006114          366 YTKDYISKGSSRFG-APMSLQKSNPSRE---LSGQRATI-AKICDEVGLPKILQLLTSEDPDVQIHAVKVVANLAA-EDI  439 (660)
Q Consensus       366 ~~~g~i~~l~~~L~-~~~~~vr~~~~~~---laa~~~~~-~~I~e~ggI~~LV~LL~s~d~~vr~~Aa~aL~nLa~-~~e  439 (660)
                      ...|.++.++.++. +..+.++-.++|+   ++..++.. ..+++.|++|.++.++.+++..|+..|+|+|+|++. .+.
T Consensus       106 i~~G~v~~lV~~l~~~~~~~lq~eAAWaLTnIAsgtse~T~~vv~agavp~fi~Ll~s~~~~v~eQavWALgNIagds~~  185 (514)
T KOG0166|consen  106 IQSGVVPRLVEFLSRDDNPTLQFEAAWALTNIASGTSEQTKVVVDAGAVPIFIQLLSSPSADVREQAVWALGNIAGDSPD  185 (514)
T ss_pred             HHcCcHHHHHHHHccCCChhHHHHHHHHHHHHhcCchhhccccccCCchHHHHHHhcCCcHHHHHHHHHHHhccccCChH
Confidence            34488999999996 4556777777887   55555544 457799999999999999999999999999999999 577


Q ss_pred             hHHHHHHcCCHHHHHHHHccCCCHHHHHHHHHHHHHhhcCchhHHHHH-hcCccHHHHHhhcCCCCHHHHHHHHHHHHHH
Q 006114          440 NQEKIVEEGGLDALLLLLRTSQNTTILRVASGAIANLAMNEMNQGLIM-SRGGGQLLAKTASKTDDPQTLRMVAGALANL  518 (660)
Q Consensus       440 n~~~Ive~GgI~~Lv~LL~~s~d~~v~~~Aa~AL~nLA~~~~n~~~Iv-e~g~I~~Ll~LL~~s~d~~v~~~Aa~aLanL  518 (660)
                      .|..+.++|++++|+.++..+......++++|+|.|||.+......+. -..++|.|..++. +.|+.|+..|||||++|
T Consensus       186 ~Rd~vl~~g~l~pLl~~l~~~~~~~~lRn~tW~LsNlcrgk~P~P~~~~v~~iLp~L~~ll~-~~D~~Vl~Da~WAlsyL  264 (514)
T KOG0166|consen  186 CRDYVLSCGALDPLLRLLNKSDKLSMLRNATWTLSNLCRGKNPSPPFDVVAPILPALLRLLH-STDEEVLTDACWALSYL  264 (514)
T ss_pred             HHHHHHhhcchHHHHHHhccccchHHHHHHHHHHHHHHcCCCCCCcHHHHHHHHHHHHHHHh-cCCHHHHHHHHHHHHHH
Confidence            789999999999999999854444788999999999999853333333 3568899999996 48999999999999999


Q ss_pred             h-cChhHHHHHHhccHHHHHHHHhcCCCHHHHHHHHHHHHHhhccchhhhhhcchhhhHHHhhcChHHHHHHhhc-CCCH
Q 006114          519 C-GNEKLHTMLEEDGAIKALLAMVRSGNIDVIAQVARGLANFAKCESRAIVQGQRKGRSHLMEDSALEWLIANSK-TNSA  596 (660)
Q Consensus       519 a-~~~~~r~~iv~~G~V~~Lv~lL~s~~~~v~~~Al~aLanLA~~~~~~~aq~~~e~r~~Li~~G~v~~Lv~lL~-s~d~  596 (660)
                      + +.++.-+.+++.|++|.|+.+|.++.+.++.+|+++++|++.++.        .....+++.|++|.|..++. +..+
T Consensus       265 sdg~ne~iq~vi~~gvv~~LV~lL~~~~~~v~~PaLRaiGNIvtG~d--------~QTq~vi~~~~L~~l~~ll~~s~~~  336 (514)
T KOG0166|consen  265 TDGSNEKIQMVIDAGVVPRLVDLLGHSSPKVVTPALRAIGNIVTGSD--------EQTQVVINSGALPVLSNLLSSSPKE  336 (514)
T ss_pred             hcCChHHHHHHHHccchHHHHHHHcCCCcccccHHHhhccceeeccH--------HHHHHHHhcChHHHHHHHhccCcch
Confidence            9 778888889999999999999999999999999999999998753        45667999999999999998 5567


Q ss_pred             HHHHHHHHHHHHhhcCC-ccHHHHHhcCcHHHHHHHHhcCChHHHHHHHHHHHhc
Q 006114          597 STRRHVELALCHLAQNE-DNARDFISRGGAKELVQISIESSREDIRNLAKKTMKS  650 (660)
Q Consensus       597 ~vr~~Aa~AL~nLa~~~-e~~~~Ive~G~l~~Lv~lL~s~s~~~ir~~A~~~L~~  650 (660)
                      .++..|||++.|++.+. .....++.+|.+|.|+.++.+++ -++|.-|..++.+
T Consensus       337 ~ikkEAcW~iSNItAG~~~qiqaVida~l~p~Li~~l~~~e-f~~rKEAawaIsN  390 (514)
T KOG0166|consen  337 SIKKEACWTISNITAGNQEQIQAVIDANLIPVLINLLQTAE-FDIRKEAAWAISN  390 (514)
T ss_pred             hHHHHHHHHHHHhhcCCHHHHHHHHHcccHHHHHHHHhccc-hHHHHHHHHHHHh
Confidence            79999999999998766 78899999999999999999877 4555555555543

>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>KOG4199 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>KOG4199 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0240 consensus Kinesin (SMY1 subfamily) [Cytoskeleton] Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG1222 consensus Kinesin associated protein KAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures] Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>KOG4646 consensus Uncharacterized conserved protein, contains ARM repeats [Function unknown] Back     alignment and domain information
>KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures] Back     alignment and domain information
>KOG2759 consensus Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>KOG1222 consensus Kinesin associated protein KAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms] Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4646 consensus Uncharacterized conserved protein, contains ARM repeats [Function unknown] Back     alignment and domain information
>KOG2759 consensus Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] Back     alignment and domain information
>KOG2973 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] Back     alignment and domain information
>KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] Back     alignment and domain information
>KOG2973 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>KOG0240 consensus Kinesin (SMY1 subfamily) [Cytoskeleton] Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1059 consensus Vesicle coat complex AP-3, delta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4413 consensus 26S proteasome regulatory complex, subunit PSMD5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2023 consensus Nuclear transport receptor Karyopherin-beta2/Transportin (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG2734 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5231 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5369 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>PF10165 Ric8: Guanine nucleotide exchange factor synembryn; InterPro: IPR019318 Ric8 is involved in the EGL-30 neurotransmitter signalling pathway [] Back     alignment and domain information
>KOG2734 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PF10165 Ric8: Guanine nucleotide exchange factor synembryn; InterPro: IPR019318 Ric8 is involved in the EGL-30 neurotransmitter signalling pathway [] Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>KOG0213 consensus Splicing factor 3b, subunit 1 [RNA processing and modification] Back     alignment and domain information
>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site Back     alignment and domain information
>KOG1242 consensus Protein containing adaptin N-terminal region [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1242 consensus Protein containing adaptin N-terminal region [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG5369 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>KOG4413 consensus 26S proteasome regulatory complex, subunit PSMD5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>KOG2023 consensus Nuclear transport receptor Karyopherin-beta2/Transportin (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PF13764 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 Back     alignment and domain information
>KOG1241 consensus Karyopherin (importin) beta 1 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04063 DUF383: Domain of unknown function (DUF383); InterPro: IPR007205 This is a protein of unknown function Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PRK14707 hypothetical protein; Provisional Back     alignment and domain information
>PF04063 DUF383: Domain of unknown function (DUF383); InterPro: IPR007205 This is a protein of unknown function Back     alignment and domain information
>KOG1061 consensus Vesicle coat complex AP-1/AP-2/AP-4, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PRK14707 hypothetical protein; Provisional Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11707 Npa1: Ribosome 60S biogenesis N-terminal; InterPro: IPR021714 Npa1p is required for ribosome biogenesis and operates in the same functional environment as Rsa3p and Dbp6p during early maturation of 60S ribosomal subunits [] Back     alignment and domain information
>KOG0212 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>KOG3036 consensus Protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>KOG0212 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>KOG1059 consensus Vesicle coat complex AP-3, delta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG2259 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>KOG3036 consensus Protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>KOG2259 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>KOG1943 consensus Beta-tubulin folding cofactor D [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>PF11841 DUF3361: Domain of unknown function (DUF3361) Back     alignment and domain information
>PF11841 DUF3361: Domain of unknown function (DUF3361) Back     alignment and domain information
>PF08569 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like proteins are involved in both polarised growth and cytokinesis Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>PF08569 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like proteins are involved in both polarised growth and cytokinesis Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04078 Rcd1: Cell differentiation family, Rcd1-like ; InterPro: IPR007216 Rcd1 (Required cell differentiation 1) -like proteins are found among a wide range of organisms [] Back     alignment and domain information
>KOG1241 consensus Karyopherin (importin) beta 1 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>KOG4535 consensus HEAT and armadillo repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0213 consensus Splicing factor 3b, subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG2611 consensus Neurochondrin/leucine-rich protein (Neurochondrin) [Function unknown] Back     alignment and domain information
>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle Back     alignment and domain information
>KOG2025 consensus Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF06025 DUF913: Domain of Unknown Function (DUF913); InterPro: IPR010314 This is a domain of unknown function found towards the N terminus of a family of E3 ubiquitin protein ligases, including yeast TOM1, many of which appear to play a role in mRNA transcription and processing Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>KOG0567 consensus HEAT repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1060 consensus Vesicle coat complex AP-3, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants Back     alignment and domain information
>KOG2611 consensus Neurochondrin/leucine-rich protein (Neurochondrin) [Function unknown] Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site Back     alignment and domain information
>KOG1062 consensus Vesicle coat complex AP-1, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins Back     alignment and domain information
>KOG1062 consensus Vesicle coat complex AP-1, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1824 consensus TATA-binding protein-interacting protein [General function prediction only] Back     alignment and domain information
>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>PF04078 Rcd1: Cell differentiation family, Rcd1-like ; InterPro: IPR007216 Rcd1 (Required cell differentiation 1) -like proteins are found among a wide range of organisms [] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>PF14668 RICTOR_V: Rapamycin-insensitive companion of mTOR, domain 5 Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1943 consensus Beta-tubulin folding cofactor D [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08045 CDC14: Cell division control protein 14, SIN component; InterPro: IPR012535 Cdc14 is a component of the septation initiation network (SIN) and is required for the localisation and activity of Sid1 Back     alignment and domain information
>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0567 consensus HEAT repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF14668 RICTOR_V: Rapamycin-insensitive companion of mTOR, domain 5 Back     alignment and domain information
>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] Back     alignment and domain information
>KOG2062 consensus 26S proteasome regulatory complex, subunit RPN2/PSMD1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex Back     alignment and domain information
>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4653 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>KOG1061 consensus Vesicle coat complex AP-1/AP-2/AP-4, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF08324 PUL: PUL domain; InterPro: IPR013535 The PUL (after PLAP, UFD3 and lub1) domain is a predicted predominantly alpha helical globular domain found in eukaryotes Back     alignment and domain information
>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle Back     alignment and domain information
>KOG1077 consensus Vesicle coat complex AP-2, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex Back     alignment and domain information
>PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif Back     alignment and domain information
>KOG0414 consensus Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2032 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08324 PUL: PUL domain; InterPro: IPR013535 The PUL (after PLAP, UFD3 and lub1) domain is a predicted predominantly alpha helical globular domain found in eukaryotes Back     alignment and domain information
>COG5231 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PF06371 Drf_GBD: Diaphanous GTPase-binding Domain; InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division [] Back     alignment and domain information
>PF06371 Drf_GBD: Diaphanous GTPase-binding Domain; InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division [] Back     alignment and domain information
>KOG4535 consensus HEAT and armadillo repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>PF08045 CDC14: Cell division control protein 14, SIN component; InterPro: IPR012535 Cdc14 is a component of the septation initiation network (SIN) and is required for the localisation and activity of Sid1 Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>KOG1824 consensus TATA-binding protein-interacting protein [General function prediction only] Back     alignment and domain information
>KOG0414 consensus Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2062 consensus 26S proteasome regulatory complex, subunit RPN2/PSMD1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5218 YCG1 Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>PF13764 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>KOG2999 consensus Regulator of Rac1, required for phagocytosis and cell migration [Signal transduction mechanisms] Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] Back     alignment and domain information
>smart00638 LPD_N Lipoprotein N-terminal Domain Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>KOG2025 consensus Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] Back     alignment and domain information
>PF13251 DUF4042: Domain of unknown function (DUF4042) Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>KOG2956 consensus CLIP-associating protein [General function prediction only] Back     alignment and domain information
>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms Back     alignment and domain information
>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily Back     alignment and domain information
>COG5116 RPN2 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2274 consensus Predicted importin 9 [Intracellular trafficking, secretion, and vesicular transport; Nuclear structure] Back     alignment and domain information
>KOG0915 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information
>TIGR00634 recN DNA repair protein RecN Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>COG5116 RPN2 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>KOG1058 consensus Vesicle coat complex COPI, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0915 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1077 consensus Vesicle coat complex AP-2, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily Back     alignment and domain information
>PF06025 DUF913: Domain of Unknown Function (DUF913); InterPro: IPR010314 This is a domain of unknown function found towards the N terminus of a family of E3 ubiquitin protein ligases, including yeast TOM1, many of which appear to play a role in mRNA transcription and processing Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>KOG1060 consensus Vesicle coat complex AP-3, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF01347 Vitellogenin_N: Lipoprotein amino terminal region; InterPro: IPR001747 This entry represents a conserved region found in several lipid transport proteins, including vitellogenin, microsomal triglyceride transfer protein and apolipoprotein B-100 [] Back     alignment and domain information
>PF08581 Tup_N: Tup N-terminal; InterPro: IPR013890 The N-terminal region of the Tup protein has been shown to interact with the Ssn6 transcriptional co-repressor [] Back     alignment and domain information
>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] Back     alignment and domain information
>COG5209 RCD1 Uncharacterized protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>KOG1820 consensus Microtubule-associated protein [Cytoskeleton] Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>KOG1991 consensus Nuclear transport receptor RANBP7/RANBP8 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information
>PF14073 Cep57_CLD: Centrosome localisation domain of Cep57 Back     alignment and domain information
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] Back     alignment and domain information
>KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] Back     alignment and domain information
>PRK09169 hypothetical protein; Validated Back     alignment and domain information
>PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>PF15066 CAGE1: Cancer-associated gene protein 1 family Back     alignment and domain information
>COG5209 RCD1 Uncharacterized protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>KOG4653 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF01347 Vitellogenin_N: Lipoprotein amino terminal region; InterPro: IPR001747 This entry represents a conserved region found in several lipid transport proteins, including vitellogenin, microsomal triglyceride transfer protein and apolipoprotein B-100 [] Back     alignment and domain information
>KOG1248 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14988 DUF4515: Domain of unknown function (DUF4515) Back     alignment and domain information
>KOG0243 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>KOG2274 consensus Predicted importin 9 [Intracellular trafficking, secretion, and vesicular transport; Nuclear structure] Back     alignment and domain information
>KOG2999 consensus Regulator of Rac1, required for phagocytosis and cell migration [Signal transduction mechanisms] Back     alignment and domain information
>KOG1078 consensus Vesicle coat complex COPI, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>KOG2032 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1248 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion Back     alignment and domain information
>KOG1949 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07814 WAPL: Wings apart-like protein regulation of heterochromatin; InterPro: IPR022771 This entry contains sequences expressed in eukaryotic organisms (metazoa, fungi, plants) bearing high similarity to the WAPL conserved region of D Back     alignment and domain information
>KOG1058 consensus Vesicle coat complex COPI, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>PF12530 DUF3730: Protein of unknown function (DUF3730) ; InterPro: IPR022542 This domain is found in eukaryotes, and is typically between 220 and 262 amino acids in length Back     alignment and domain information
>KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2137 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1949 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14073 Cep57_CLD: Centrosome localisation domain of Cep57 Back     alignment and domain information
>KOG2933 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08167 RIX1: rRNA processing/ribosome biogenesis Back     alignment and domain information
>KOG1991 consensus Nuclear transport receptor RANBP7/RANBP8 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12031 DUF3518: Domain of unknown function (DUF3518); InterPro: IPR021906 This presumed domain is functionally uncharacterised Back     alignment and domain information
>PF07814 WAPL: Wings apart-like protein regulation of heterochromatin; InterPro: IPR022771 This entry contains sequences expressed in eukaryotic organisms (metazoa, fungi, plants) bearing high similarity to the WAPL conserved region of D Back     alignment and domain information
>PF11707 Npa1: Ribosome 60S biogenesis N-terminal; InterPro: IPR021714 Npa1p is required for ribosome biogenesis and operates in the same functional environment as Rsa3p and Dbp6p during early maturation of 60S ribosomal subunits [] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG0211 consensus Protein phosphatase 2A regulatory subunit A and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells Back     alignment and domain information
>KOG0211 consensus Protein phosphatase 2A regulatory subunit A and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms Back     alignment and domain information
>PRK10869 recombination and repair protein; Provisional Back     alignment and domain information
>KOG1967 consensus DNA repair/transcription protein Mms19 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query660
4hxt_A252 Crystal Structure Of Engineered Protein. Northeast 3e-08
4db8_A252 Designed Armadillo-Repeat Protein Length = 252 3e-05
>pdb|4HXT|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or329 Length = 252 Back     alignment and structure 
Iteration: 1

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 98/178 (55%), Gaps = 7/178 (3%)
Query: 394 SGQRATIAKICDEVGLPKILQLLTSEDPDVQIHAVKVVANLAA-EDINQEKIVEEGGLDA 452
           SG  + I  I D  G+  +++LLTS D +VQ  A + +AN+A+  D   + IV+ GG++ 
Sbjct: 31  SGPASAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPDEAIKAIVDAGGVEV 90
Query: 453 XXXXXRTSQNTTILRVASGAIANLAMNEMNQGL--IMSRGGGQLLAKTASKTDDPQTLRM 510
                 TS ++ + + A+ A+AN+A    ++ +  I+  GG ++L K  + TD  +  + 
Sbjct: 91  LVKLL-TSTDSEVQKEAARALANIASGP-DEAIKAIVDAGGVEVLVKLLTSTDS-EVQKE 147
Query: 511 VAGALANLC-GNEKLHTMLEEDGAIKALLAMVRSGNIDVIAQVARGLANFAKCESRAI 567
            A ALAN+  G ++    + + G ++ L+ ++ S + +V  + AR LAN A   + AI
Sbjct: 148 AARALANIASGPDEAIKAIVDAGGVEVLVKLLTSTDSEVQKEAARALANIASGPTSAI 205
>pdb|4DB8|A Chain A, Designed Armadillo-Repeat Protein Length = 252 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query660
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 3e-29
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 1e-26
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 3e-20
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 2e-19
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 4e-19
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 5e-12
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 1e-05
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 3e-29
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 4e-27
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 9e-27
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 8e-21
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 1e-20
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 3e-19
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 3e-11
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 3e-27
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 8e-26
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 1e-25
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 4e-22
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 7e-19
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 5e-11
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 6e-25
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 3e-20
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 1e-11
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 6e-25
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 2e-21
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 5e-10
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 8e-07
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 1e-24
2jdq_A 450 Importin alpha-1 subunit; transport, PB2 subunit, 3e-18
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 6e-17
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 2e-14
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 9e-24
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 6e-14
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 3e-06
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 1e-21
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 5e-21
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 1e-19
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 2e-16
3nmw_A 354 APC variant protein; ARMADIILO repeats domain, cel 8e-15
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 2e-12
3nmz_A458 APC variant protein; protein-protein complex, arma 7e-21
3nmz_A458 APC variant protein; protein-protein complex, arma 6e-16
3nmz_A458 APC variant protein; protein-protein complex, arma 6e-11
3nmz_A 458 APC variant protein; protein-protein complex, arma 8e-08
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 8e-21
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 7e-16
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 3e-09
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 3e-05
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 4e-20
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 8e-08
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 8e-06
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 5e-20
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 1e-16
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 5e-14
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 8e-12
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 3e-05
3oqs_A 510 Importin subunit alpha-2; importin alpha, karyophe 7e-20
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 3e-17
3oqs_A 510 Importin subunit alpha-2; importin alpha, karyophe 1e-16
3oqs_A 510 Importin subunit alpha-2; importin alpha, karyophe 1e-16
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 9e-16
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 3e-13
3now_A 810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 2e-18
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 3e-15
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 2e-13
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 6e-13
3now_A 810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 1e-11
1xm9_A 457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 4e-18
1xm9_A 457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 8e-17
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 1e-13
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 4e-11
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 3e-10
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 4e-15
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 4e-11
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 6e-06
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 5e-05
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-09
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 5e-06
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 9e-05
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 1e-04
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 1e-06
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 9e-06
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 2e-06
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 1e-04
3opb_A 778 SWI5-dependent HO expression protein 4; heat and a 6e-04
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 7e-05
1g8x_A1010 Myosin II heavy chain fused to alpha-actinin 3; mo 9e-05
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 8e-04
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 8e-04
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
 Score =  122 bits (308), Expect = 3e-29
 Identities = 50/258 (19%), Positives = 98/258 (37%), Gaps = 16/258 (6%)

Query: 391 RELSGQRATIAKICDEVGLPKILQLLTSEDPDVQIHAVKVVANLAA-EDINQEKIVEEGG 449
             LS  R  +  I    G+P ++++L S    V  +A+  + NL   ++  +  +   GG
Sbjct: 82  HNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGG 141

Query: 450 LDALLLLLRTSQNTTILRVASGAIANLAM-NEMNQGLIMSRGGGQLLAKTASKTDDPQTL 508
           L  ++ LL    N   L + +  +  LA  N+ ++ +I++ GG Q L          + L
Sbjct: 142 LQKMVALLN-KTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLL 200

Query: 509 RMVAGALANLCGNEKLHTMLEEDGAIKALLAMVRSGNIDVIAQVARGLANFAKCESRAIV 568
              +  L  L         + E G ++AL   +   +  ++      L N +   ++   
Sbjct: 201 WTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEG 260

Query: 569 QGQRKGRSHLMEDSALEWLIANSKTNSASTRRHVELALCHLAQNEDNARDFISRGGAKE- 627
                       +  L  L+    ++  +        L +L  N    +  + + G  E 
Sbjct: 261 -----------MEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEA 309

Query: 628 LVQISIESS-REDIRNLA 644
           LV+  + +  REDI   A
Sbjct: 310 LVRTVLRAGDREDITEPA 327
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Length = 778 Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Length = 778 Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Length = 778 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Length = 201 Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query660
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 99.96
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 99.95
3nmz_A458 APC variant protein; protein-protein complex, arma 99.95
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.94
3ul1_B 510 Importin subunit alpha-2; arm repeat, armadillo re 99.94
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 99.94
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 99.94
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.93
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 99.93
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.93
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 99.93
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 99.93
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.93
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 99.93
3tpo_A 529 Importin subunit alpha-2; nuclear import, protein 99.93
4b8j_A 528 Importin subunit alpha-1A; transport protein, nucl 99.92
3nmz_A458 APC variant protein; protein-protein complex, arma 99.92
4b8j_A 528 Importin subunit alpha-1A; transport protein, nucl 99.92
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 99.92
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.92
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 99.91
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 99.91
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 99.91
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 99.9
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.9
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 99.89
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 99.89
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 99.89
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.88
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 99.88
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 99.88
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.87
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.85
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 99.85
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 99.85
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.82
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 99.82
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 99.71
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 99.42
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 99.39
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 99.38
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 99.36
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 99.35
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 99.34
3grl_A 651 General vesicular transport factor P115; vesicle t 99.32
3grl_A 651 General vesicular transport factor P115; vesicle t 99.32
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 99.21
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 98.97
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 98.9
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 98.89
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 98.82
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 98.82
1b3u_A 588 Protein (protein phosphatase PP2A); scaffold prote 98.79
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 98.75
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 98.66
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 98.46
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 98.44
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 98.4
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 98.37
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 98.35
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 98.31
2db0_A253 253AA long hypothetical protein; heat repeats, hel 98.3
1ho8_A480 Vacuolar ATP synthase subunit H; heat repeat, hydr 98.29
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 98.29
1qgr_A 876 Protein (importin beta subunit); transport recepto 98.22
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 98.21
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 98.16
1qgr_A 876 Protein (importin beta subunit); transport recepto 98.14
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 98.1
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 98.03
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 97.97
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 97.95
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 97.9
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 97.89
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 97.88
2vgl_A 621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 97.87
2vgl_A 621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 97.84
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 97.83
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 97.82
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 97.61
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 97.56
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 97.52
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 97.34
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 97.32
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 97.28
1ho8_A 480 Vacuolar ATP synthase subunit H; heat repeat, hydr 97.27
2db0_A253 253AA long hypothetical protein; heat repeats, hel 97.18
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 97.18
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 96.95
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 96.09
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 96.0
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 95.91
3ebb_A304 Phospholipase A2-activating protein; armadillo rep 95.77
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 95.68
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 95.67
1lrv_A244 LRV, leucine-rich repeat variant; leucine-rich rep 95.62
2ocy_A154 RAB guanine nucleotide exchange factor SEC2; RAB, 95.44
1upk_A341 MO25 protein; transferase, armadillo; HET: MSE; 1. 95.41
1upk_A341 MO25 protein; transferase, armadillo; HET: MSE; 1. 95.18
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 95.09
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 95.06
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 95.03
2efr_A155 General control protein GCN4 and tropomyosin 1 Al; 94.97
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 94.9
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 94.82
2fv2_A268 RCD1 required for cell differentiation1 homolog; a 94.77
3ebb_A304 Phospholipase A2-activating protein; armadillo rep 94.76
2f31_A233 Diaphanous protein homolog 1; formin,MDIA1, protei 94.45
2f31_A233 Diaphanous protein homolog 1; formin,MDIA1, protei 94.41
2fv2_A268 RCD1 required for cell differentiation1 homolog; a 94.36
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 94.34
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 94.26
3eg5_B383 Protein diaphanous homolog 1; protein-protein comp 94.24
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 94.04
3eg5_B383 Protein diaphanous homolog 1; protein-protein comp 93.96
2efr_A155 General control protein GCN4 and tropomyosin 1 Al; 93.95
3oc3_A 800 Helicase MOT1, MOT1; regulation of transcription, 93.93
4hat_C 1023 Exportin-1; heat repeat, nuclear export, RAN-ranbp 93.87
3l9t_A240 Putative uncharacterized protein SMU.31; hypotheti 93.86
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 93.86
2e7s_A135 RAB guanine nucleotide exchange factor SEC2; coile 93.64
3c2g_A 619 SYS-1 protein; beta-catenin, phylogeny, SYS-1, dev 93.52
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 93.52
2bnx_A386 Diaphanous protein homolog 1; autoinhibition, acti 93.47
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 93.39
3s4r_A93 Vimentin; alpha-helix, cytoskeleton, intermediate 92.88
2x19_B 963 Importin-13; nuclear transport, protein transport; 92.88
3tnu_A131 Keratin, type I cytoskeletal 14; coiled-coil, stru 92.77
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 92.72
2bnx_A 386 Diaphanous protein homolog 1; autoinhibition, acti 92.67
3tnu_B129 Keratin, type II cytoskeletal 5; coiled-coil, stru 92.29
4hat_C 1023 Exportin-1; heat repeat, nuclear export, RAN-ranbp 91.63
3c2g_A619 SYS-1 protein; beta-catenin, phylogeny, SYS-1, dev 91.42
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 91.25
1lrv_A244 LRV, leucine-rich repeat variant; leucine-rich rep 91.23
3l9t_A240 Putative uncharacterized protein SMU.31; hypotheti 90.81
3gjx_A 1073 Exportin-1; transport, cytoplasm, nucleus, RNA-bin 90.75
2x1g_F 971 Cadmus; transport protein, developmental protein, 90.49
3m1i_C 1049 Exportin-1; heat repeat, GTP-binding, nucleotide-b 90.48
3tnu_B129 Keratin, type II cytoskeletal 5; coiled-coil, stru 90.26
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 90.24
3swk_A86 Vimentin; cytoskeleton, intermediate filament, alp 90.03
3oc3_A 800 Helicase MOT1, MOT1; regulation of transcription, 90.0
3m1i_C 1049 Exportin-1; heat repeat, GTP-binding, nucleotide-b 89.62
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 89.61
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 89.32
2ocy_A154 RAB guanine nucleotide exchange factor SEC2; RAB, 89.16
2eqb_B97 RAB guanine nucleotide exchange factor SEC2; coile 88.82
3m48_A33 General control protein GCN4; leucine zipper, synt 88.53
2x1g_F 971 Cadmus; transport protein, developmental protein, 87.91
3tnu_A131 Keratin, type I cytoskeletal 14; coiled-coil, stru 87.76
1uo4_A34 General control protein GCN4; four helix bundle, c 86.69
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 86.58
1deq_A390 Fibrinogen (alpha chain); coiled-coil, blood clott 86.57
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 86.3
3ghg_A562 Fibrinogen alpha chain; triple-stranded coiled coi 86.01
3o2t_A386 Symplekin; heat repeat, scaffold, protein binding; 85.85
3gs3_A257 Symplekin, LD45768P; helix-turn-helix heat repeat 85.82
3c3g_A33 Alpha/beta peptide with the GCN4-PLI SIDE chain S 85.38
1gk4_A84 Vimentin; intermediate filament, dimer, parallel c 84.95
2eqb_B97 RAB guanine nucleotide exchange factor SEC2; coile 84.89
1kd8_B36 GABH BLL, GCN4 acid base heterodimer base-D12LA16L 84.54
3c3f_A34 Alpha/beta peptide with the GCN4-PLI SIDE chain S 84.38
3ibv_A 980 Exportin-T; karyopherin, heat repeat, cytoplasm, n 84.3
1kd8_A36 GABH AIV, GCN4 acid base heterodimer acid-D12IA16V 84.3
1x8y_A86 Lamin A/C; structural protein, intermediate filame 84.19
1lsh_A 1056 Lipovitellin (LV-1N, LV-1C); vitellogenin, lipopro 83.57
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 82.86
2oxj_A34 Hybrid alpha/beta peptide based on the GCN4-P1 Se 82.81
3u0r_A 507 Apoptosis inhibitor 5; heat repeat, armadillo repe 82.45
2b9c_A147 Striated-muscle alpha tropomyosin; alpha-helix, co 81.98
3gjx_A 1073 Exportin-1; transport, cytoplasm, nucleus, RNA-bin 81.85
2wq1_A33 General control protein GCN4; TAA, nucleus, coiled 81.71
2hy6_A34 General control protein GCN4; protein design, para 81.58
2x19_B 963 Importin-13; nuclear transport, protein transport; 81.12
3u0r_A 507 Apoptosis inhibitor 5; heat repeat, armadillo repe 80.89
2bni_A34 General control protein GCN4; four helix bundle, a 80.67
3gae_A253 Protein DOA1; UFD3, CDC48, armadillo repeat, nucle 80.53
2e7s_A135 RAB guanine nucleotide exchange factor SEC2; coile 80.52
3swk_A86 Vimentin; cytoskeleton, intermediate filament, alp 80.22
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
Probab=99.96  E-value=9e-28  Score=258.23  Aligned_cols=254  Identities=20%  Similarity=0.199  Sum_probs=218.0

Q ss_pred             cccchhhh---hhcCchhHHHHHhCCCHHHHHHhhCC-----------CCHHHHHHHHHHHHHhhCCc-hhHHHHHHcCC
Q 006114          385 QKSNPSRE---LSGQRATIAKICDEVGLPKILQLLTS-----------EDPDVQIHAVKVVANLAAED-INQEKIVEEGG  449 (660)
Q Consensus       385 vr~~~~~~---laa~~~~~~~I~e~ggI~~LV~LL~s-----------~d~~vr~~Aa~aL~nLa~~~-en~~~Ive~Gg  449 (660)
                      ..+.++++   ++.+..++..|++.||++.|+.+|.+           .++.++..|+++|.||+.+. .++..|...||
T Consensus        48 ~~~~A~~aL~nls~d~e~R~~i~~~G~l~~Lv~LL~~~~~~~~~~~~~~~~~~q~~Aa~aL~nLa~~~~~~k~~i~~~~G  127 (354)
T 3nmw_A           48 QICPAVCVLMKLSFDEEHRHAMNELGGLQAIAELLQVDCEMYGLTNDHYSITLRRYAGMALTNLTFGDVANKATLCSMKG  127 (354)
T ss_dssp             THHHHHHHHHHHHTSHHHHHHHHHTTHHHHHHHHHHHHHHHHTTSCCHHHHHHHHHHHHHHHHHTSSCHHHHHHHHHCHH
T ss_pred             HHHHHHHHHHHHcCCHHHHHHHHHcCCHHHHHHHHhcccccccccCCCCCHHHHHHHHHHHHHHHcCCHHHHHHHHHcCC
Confidence            33445555   78887888889999999999999952           24789999999999999954 57878877666


Q ss_pred             -HHHHHHHHccCCCHHHHHHHHHHHHHhhcC--chhHHHHHhcCccHHHHHhhcCCCCHHHHHHHHHHHHHHhc-ChhHH
Q 006114          450 -LDALLLLLRTSQNTTILRVASGAIANLAMN--EMNQGLIMSRGGGQLLAKTASKTDDPQTLRMVAGALANLCG-NEKLH  525 (660)
Q Consensus       450 -I~~Lv~LL~~s~d~~v~~~Aa~AL~nLA~~--~~n~~~Ive~g~I~~Ll~LL~~s~d~~v~~~Aa~aLanLa~-~~~~r  525 (660)
                       ||+|+.+|. ++++.++..|+++|+||+.+  +.++..|++.|+||+|+.+|..+.++.++..|+++|+||+. +++++
T Consensus       128 aIp~LV~LL~-s~~~~v~~~A~~aL~nLs~~~~~~~k~~i~~~G~Ip~Lv~lL~~~~~~~~~~~A~~aL~nLs~~~~~nk  206 (354)
T 3nmw_A          128 CMRALVAQLK-SESEDLQQVIASVLRNLSWRADVNSKKTLREVGSVKALMECALEVKKESTLKSVLSALWNLSAHCTENK  206 (354)
T ss_dssp             HHHHHHHGGG-CSCHHHHHHHHHHHHHHHTTCCHHHHHHHHHTTHHHHHHHHHHHCCCHHHHHHHHHHHHHHHTTCHHHH
T ss_pred             cHHHHHHHHC-CCCHHHHHHHHHHHHHHhccCCHHHHHHHHHCCCHHHHHHHHhcCCCHHHHHHHHHHHHHHHccChhhh
Confidence             999999998 78999999999999999985  67899999999999999986556789999999999999997 88888


Q ss_pred             HHHH-hccHHHHHHHHhcCCCH----HHHHHHHHHHHHhhc---cchhhhhhcchhhhHHHhhcChHHHHHHhhcCCCHH
Q 006114          526 TMLE-EDGAIKALLAMVRSGNI----DVIAQVARGLANFAK---CESRAIVQGQRKGRSHLMEDSALEWLIANSKTNSAS  597 (660)
Q Consensus       526 ~~iv-~~G~V~~Lv~lL~s~~~----~v~~~Al~aLanLA~---~~~~~~aq~~~e~r~~Li~~G~v~~Lv~lL~s~d~~  597 (660)
                      ..++ ..|++|.|+.++.++++    .++..|+++|+||+.   .+        ++++..+.+.|++|+|+.+|.+.+..
T Consensus       207 ~~i~~~~Gai~~Lv~lL~~~~~~~~~~v~~~A~~aL~nLs~~~a~~--------~~~~~~i~~~g~i~~Lv~lL~~~~~~  278 (354)
T 3nmw_A          207 ADICAVDGALAFLVGTLTYRSQTNTLAIIESGGGILRNVSSLIATN--------EDHRQILRENNCLQTLLQHLKSHSLT  278 (354)
T ss_dssp             HHHHHSTTHHHHHHHHTTCCCSSSCCHHHHHHHHHHHHHHHHHTTC--------HHHHHHHHTTTHHHHHHHHTTCSCHH
T ss_pred             HHHHHhcCcHHHHHHHhccCCCcccHHHHHHHHHHHHHHHhhccCC--------HHHHHHHHHcCCHHHHHHHHcCCChH
Confidence            8888 78999999999987654    599999999999995   22        46788899999999999999999999


Q ss_pred             HHHHHHHHHHHhhc-CCccHHHHHhcCcHHHHHHHHhcCChHHHHHHHHHHH
Q 006114          598 TRRHVELALCHLAQ-NEDNARDFISRGGAKELVQISIESSREDIRNLAKKTM  648 (660)
Q Consensus       598 vr~~Aa~AL~nLa~-~~e~~~~Ive~G~l~~Lv~lL~s~s~~~ir~~A~~~L  648 (660)
                      ++..|+++|+||+. +++++..+++.|++|+|+.++.+++.. ++..|..+|
T Consensus       279 v~~~A~~aL~nLa~~~~~~~~~i~~~G~i~~Lv~LL~s~~~~-i~~~A~~aL  329 (354)
T 3nmw_A          279 IVSNACGTLWNLSARNPKDQEALWDMGAVSMLKNLIHSKHKM-IAMGSAAAL  329 (354)
T ss_dssp             HHHHHHHHHHHHTSSCHHHHHHHHHTTHHHHHHTTTTCSSHH-HHHHHHHHH
T ss_pred             HHHHHHHHHHHHhCCCHHHHHHHHHCCCHHHHHHHHhCCCHH-HHHHHHHHH
Confidence            99999999999995 568899999999999999999886654 455554444
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>1ho8_A Vacuolar ATP synthase subunit H; heat repeat, hydrolase; 2.95A {Saccharomyces cerevisiae} SCOP: a.118.1.9 Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>1ho8_A Vacuolar ATP synthase subunit H; heat repeat, hydrolase; 2.95A {Saccharomyces cerevisiae} SCOP: a.118.1.9 Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>3ebb_A Phospholipase A2-activating protein; armadillo repeat, structural genomics consortium, SGC, WD repeat, acetylation, ATP-binding; 1.90A {Homo sapiens} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 Back     alignment and structure
>2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>1upk_A MO25 protein; transferase, armadillo; HET: MSE; 1.85A {Homo sapiens} SCOP: a.118.1.15 PDB: 1upl_A 2wtk_A* 3gni_A* Back     alignment and structure
>1upk_A MO25 protein; transferase, armadillo; HET: MSE; 1.85A {Homo sapiens} SCOP: a.118.1.15 PDB: 1upl_A 2wtk_A* 3gni_A* Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>2fv2_A RCD1 required for cell differentiation1 homolog; armadillo-repeat, transcription; 2.20A {Homo sapiens} Back     alignment and structure
>3ebb_A Phospholipase A2-activating protein; armadillo repeat, structural genomics consortium, SGC, WD repeat, acetylation, ATP-binding; 1.90A {Homo sapiens} Back     alignment and structure
>2f31_A Diaphanous protein homolog 1; formin,MDIA1, protein-protein complex, armadillo repeats, structural protein; 2.10A {Mus musculus} Back     alignment and structure
>2f31_A Diaphanous protein homolog 1; formin,MDIA1, protein-protein complex, armadillo repeats, structural protein; 2.10A {Mus musculus} Back     alignment and structure
>2fv2_A RCD1 required for cell differentiation1 homolog; armadillo-repeat, transcription; 2.20A {Homo sapiens} Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>3eg5_B Protein diaphanous homolog 1; protein-protein complex, RHO proteins, formins, armadillo repeat, G-protein, GTPase, alternative splicing; HET: GNP; 2.70A {Mus musculus} SCOP: a.118.1.23 PDB: 1z2c_B* Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>3eg5_B Protein diaphanous homolog 1; protein-protein complex, RHO proteins, formins, armadillo repeat, G-protein, GTPase, alternative splicing; HET: GNP; 2.70A {Mus musculus} SCOP: a.118.1.23 PDB: 1z2c_B* Back     alignment and structure
>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Back     alignment and structure
>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} Back     alignment and structure
>4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B Back     alignment and structure
>3l9t_A Putative uncharacterized protein SMU.31; hypothetical protein, unknown function; HET: EPE; 2.21A {Streptococcus mutans} Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3c2g_A SYS-1 protein; beta-catenin, phylogeny, SYS-1, developmental protein, DNA-binding, nucleus; 2.50A {Caenorhabditis elegans} PDB: 3c2h_A* Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>2bnx_A Diaphanous protein homolog 1; autoinhibition, actin, nucleation, cytoskeleton, structural; 2.4A {Mus musculus} SCOP: a.118.1.23 PDB: 3o4x_A 3obv_A* 2bap_B Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure
>2bnx_A Diaphanous protein homolog 1; autoinhibition, actin, nucleation, cytoskeleton, structural; 2.4A {Mus musculus} SCOP: a.118.1.23 PDB: 3o4x_A 3obv_A* 2bap_B Back     alignment and structure
>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B Back     alignment and structure
>3c2g_A SYS-1 protein; beta-catenin, phylogeny, SYS-1, developmental protein, DNA-binding, nucleus; 2.50A {Caenorhabditis elegans} PDB: 3c2h_A* Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure
>1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 Back     alignment and structure
>3l9t_A Putative uncharacterized protein SMU.31; hypothetical protein, unknown function; HET: EPE; 2.21A {Streptococcus mutans} Back     alignment and structure
>3gjx_A Exportin-1; transport, cytoplasm, nucleus, RNA-binding, acetylation, GTP-binding, HOST-virus interaction, nucleotide-binding, phosphoprotein; HET: GTP; 2.50A {Mus musculus} PDB: 3nby_A* 3nbz_A* 3nc0_A* 3nc1_A* 3gb8_A Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B Back     alignment and structure
>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} Back     alignment and structure
>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} Back     alignment and structure
>3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3m48_A General control protein GCN4; leucine zipper, synthetic peptide, alpha helix, activa amino-acid biosynthesis, DNA-binding, nucleus; 1.45A {Synthetic} PDB: 3i1g_A 2ahp_A* 2o7h_A Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>1uo4_A General control protein GCN4; four helix bundle, cavity, iodobenzene; 1.70A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1uo3_A 1unt_A 1uo5_A 1unu_A 1unv_A 1uo1_A 2ccf_A 2cce_A 1unx_A 1unw_A 1w5j_A* 1w5k_A* 1u9f_A* 3f86_A* 3f87_A* 3hez_A* 3c3f_A* Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>3o2t_A Symplekin; heat repeat, scaffold, protein binding; 1.40A {Homo sapiens} PDB: 3odr_A 3ods_A 4h3k_A* 3o2s_A 3o2q_A* 4h3h_A* Back     alignment and structure
>3gs3_A Symplekin, LD45768P; helix-turn-helix heat repeat extended loop, transcription, protein binding; 2.40A {Drosophila melanogaster} Back     alignment and structure
>3c3g_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-beta) backbone; helix bundle, foldamer, unknown function protein; HET: HMR B3Q B3D B3E B3L BIL B3K BAL GOL; 1.80A {Synthetic} PDB: 3heu_A* 3het_A* 3hev_A* 3hew_A* 3hey_A* 3hex_A* 3c3h_A* Back     alignment and structure
>1gk4_A Vimentin; intermediate filament, dimer, parallel coiled coil, heptad repeat, stutter; 2.3A {Homo sapiens} SCOP: h.1.20.1 Back     alignment and structure
>2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>1kd8_B GABH BLL, GCN4 acid base heterodimer base-D12LA16L; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kd9_B 1kdd_B Back     alignment and structure
>3c3f_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-alpha-beta) backbone...; helix bundle, foldamer, unknown function, de novo protein; HET: B3K B3D B3E BIL B3L BAL; 2.00A {Synthetic} SCOP: h.1.3.1 Back     alignment and structure
>3ibv_A Exportin-T; karyopherin, heat repeat, cytoplasm, nucleus, RNA- binding, transport, tRNA processing, tRNA-binding, RNA binding protein; 3.10A {Schizosaccharomyces pombe} PDB: 3icq_T* Back     alignment and structure
>1kd8_A GABH AIV, GCN4 acid base heterodimer acid-D12IA16V; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kdd_A 1kd9_A Back     alignment and structure
>1x8y_A Lamin A/C; structural protein, intermediate filament protein; 2.20A {Homo sapiens} SCOP: h.1.20.1 PDB: 3v5b_A 3v4w_A 3v4q_A Back     alignment and structure
>1lsh_A Lipovitellin (LV-1N, LV-1C); vitellogenin, lipoprotein, plasma apolipoprote apolipoprotein B, APOB; HET: PLD UPL; 1.90A {Ichthyomyzon unicuspis} SCOP: a.118.4.1 f.7.1.1 f.7.1.1 Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>2oxj_A Hybrid alpha/beta peptide based on the GCN4-P1 Se heptad positions B and F substituted...; helix bundle, foldamer, unknown function; HET: B3K B3D B3E B3S B3Y B3X B3A BAL; 2.00A {Synthetic} PDB: 2oxk_A* Back     alignment and structure
>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A Back     alignment and structure
>2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 Back     alignment and structure
>3gjx_A Exportin-1; transport, cytoplasm, nucleus, RNA-binding, acetylation, GTP-binding, HOST-virus interaction, nucleotide-binding, phosphoprotein; HET: GTP; 2.50A {Mus musculus} PDB: 3nby_A* 3nbz_A* 3nc0_A* 3nc1_A* 3gb8_A Back     alignment and structure
>2wq1_A General control protein GCN4; TAA, nucleus, coiled coil, DNA-binding, protein export, ION coordination, polar core residues; 1.08A {Saccharomyces cerevisiae} PDB: 2wq0_A 2wq2_A 2wq3_A 2wpz_A 2wpy_A 1ij0_A 1ij1_A 1gcm_A 1rb5_A 1rb6_A 1rb1_A 1rb4_A 1swi_A 3k7z_A 1zii_A 1zij_A 1ij2_A 1ij3_A 1zil_A 1zim_A ... Back     alignment and structure
>2hy6_A General control protein GCN4; protein design, parallel heptamer, protein structure, biosyn protein; 1.25A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2nrn_A 3crp_A 2b1f_A 3crp_B 2ipz_A 3ck4_A 3ck4_B 2b22_A 1ce9_A Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A Back     alignment and structure
>2bni_A General control protein GCN4; four helix bundle, antiparallel four helix bundle acyl transferase; HET: TYZ; 1.5A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2ccn_A 1w5k_A* 2ccf_A 2cce_A 1w5j_A* 1uo2_A 1gcl_A 1uo1_A 1unv_A 1uo0_A 1unt_A 1uo5_A 1unz_A 1unx_A 1unu_A 1unw_A 1uo4_A 1uo3_A 1uny_A 1u9f_A* ... Back     alignment and structure
>3gae_A Protein DOA1; UFD3, CDC48, armadillo repeat, nucleus, phosphoprotein, UBL conjugation pathway, WD repeat, nuclear protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 660
d1jdha_ 529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 5e-15
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 8e-13
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 1e-09
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 8e-08
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 1e-06
d1jdha_ 529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 6e-06
d1xm9a1 457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 1e-14
d1xm9a1 457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 2e-11
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 5e-09
d1q1sc_ 434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 2e-11
d1q1sc_434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 7e-05
d1q1sc_ 434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 2e-04
d1q1sc_434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 7e-04
d1u6gc_ 1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 0.003
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Armadillo repeat
domain: beta-Catenin
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 76.1 bits (185), Expect = 5e-15
 Identities = 32/173 (18%), Positives = 67/173 (38%), Gaps = 3/173 (1%)

Query: 409 LPKILQLLTSEDPDVQIHAVKVVANLAAEDINQEKIVEEGG-LDALLLLLRTSQNTTILR 467
           +P++ +LL  ED  V   A  +V  L+ ++ ++  I+     + A++  ++ + +    R
Sbjct: 19  IPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETAR 78

Query: 468 VASGAIANLAMNEMNQGLIMSRGGGQLLAKTASKTDDPQTLRMVAGALANLC-GNEKLHT 526
             +G + NL+ +      I   GG   L K    +     L      L NL    E    
Sbjct: 79  CTAGTLHNLSHHREGLLAIFKSGGIPALVKML-GSPVDSVLFYAITTLHNLLLHQEGAKM 137

Query: 527 MLEEDGAIKALLAMVRSGNIDVIAQVARGLANFAKCESRAIVQGQRKGRSHLM 579
            +   G ++ ++A++   N+  +A     L   A     + +     G    +
Sbjct: 138 AVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQAL 190
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query660
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 99.88
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 99.88
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1wa5b_ 503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 99.86
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 99.86
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.85
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.82
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.78
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 98.93
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 98.77
d1b3ua_ 588 Constant regulatory domain of protein phosphatase 98.63
d1b3ua_588 Constant regulatory domain of protein phosphatase 98.55
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 98.37
d1ho8a_477 Regulatory subunit H of the V-type ATPase {Baker's 98.33
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 98.27
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 98.21
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 98.14
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 97.78
d1ho8a_477 Regulatory subunit H of the V-type ATPase {Baker's 97.74
d1qbkb_888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 97.62
d2vgla_ 584 Adaptin alpha C subunit N-terminal fragment {Mouse 97.6
d2vgla_ 584 Adaptin alpha C subunit N-terminal fragment {Mouse 97.36
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 97.35
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 97.33
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 97.32
d1qbkb_888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 97.18
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 97.01
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 96.99
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 96.93
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 96.49
d1upka_330 Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} 96.09
d1upka_330 Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} 95.95
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 95.94
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 95.3
d2bnxa1343 Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) { 93.86
d1lsha1336 Lipovitellin-phosvitin complex, superhelical domai 93.08
d2bnxa1343 Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) { 93.05
d1lsha1336 Lipovitellin-phosvitin complex, superhelical domai 91.5
d1wa5c_ 959 Exportin Cse1p {Baker's yeast (Saccharomyces cerev 90.69
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Armadillo repeat
domain: Importin alpha
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.88  E-value=2.5e-21  Score=204.77  Aligned_cols=273  Identities=15%  Similarity=0.224  Sum_probs=224.5

Q ss_pred             cccchhhhhhcccCCCccccccchhhh---hh--cCchhHHHHHhCCCHHHHHHhhCC-CCHHHHHHHHHHHHHhhC-Cc
Q 006114          366 YTKDYISKGSSRFGAPMSLQKSNPSRE---LS--GQRATIAKICDEVGLPKILQLLTS-EDPDVQIHAVKVVANLAA-ED  438 (660)
Q Consensus       366 ~~~g~i~~l~~~L~~~~~~vr~~~~~~---la--a~~~~~~~I~e~ggI~~LV~LL~s-~d~~vr~~Aa~aL~nLa~-~~  438 (660)
                      ..++++..++..+.+..+..+..+...   +.  ..++.+..++..|++|.|+.+|.+ +++.++..|+++|++++. .+
T Consensus        10 ~~~~~i~~lv~~l~s~~~~~~~~a~~~l~~l~s~~~~~~~~~i~~~g~i~~Lv~lL~~~~~~~v~~~a~~~L~~la~~~~   89 (434)
T d1q1sc_          10 TVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFESAWALTNIASGTS   89 (434)
T ss_dssp             SSSCCHHHHHHHHTSSCHHHHHHHHHHHHHHHHSSSCCCHHHHHHTTCHHHHHHHTTCGGGHHHHHHHHHHHHHHHTSCH
T ss_pred             hhhhhHHHHHHHHcCCCHHHHHHHHHHHHHHhcCCCCchHHHHHHCCCHHHHHHHHccCCCHHHHHHHHHHHHHHhcCCh
Confidence            456789999999999888877776555   22  233346788999999999999974 568899999999999988 56


Q ss_pred             hhHHHHHHcCCHHHHHHHHccCCCHHHHHHHHHHHHHhhcC-chhHHHHHhcCccHHHHHhhcC----------------
Q 006114          439 INQEKIVEEGGLDALLLLLRTSQNTTILRVASGAIANLAMN-EMNQGLIMSRGGGQLLAKTASK----------------  501 (660)
Q Consensus       439 en~~~Ive~GgI~~Lv~LL~~s~d~~v~~~Aa~AL~nLA~~-~~n~~~Ive~g~I~~Ll~LL~~----------------  501 (660)
                      ..+..+++.|++|.|+.+|. ++++.++..|+++|+||+.+ +..+..+...|+++.|+.++..                
T Consensus        90 ~~~~~i~~~~~i~~l~~~L~-~~~~~~~~~a~~~L~nl~~~~~~~~~~i~~~~~~~~l~~~l~~~~~~~~~~~~~~~~~~  168 (434)
T d1q1sc_          90 EQTKAVVDGGAIPAFISLLA-SPHAHISEQAVWALGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTW  168 (434)
T ss_dssp             HHHHHHHHTTHHHHHHHHTT-CSCHHHHHHHHHHHHHHHTTCHHHHHHHHHTTCHHHHHHHTCSSCGGGSCHHHHHHHHH
T ss_pred             hhhhHhhhccchhhhhhccc-cCCHHHHHHHHHHHHHHhccchHHHHHHHHhhhhhHHHHHHHhcccccchHHHHHHHHH
Confidence            77889999999999999997 78999999999999999976 6667777777766666554321                


Q ss_pred             ------------------------------CCCHHHHHHHHHHHHHHhcC-hhHHHHHHhccHHHHHHHHhcCCCHHHHH
Q 006114          502 ------------------------------TDDPQTLRMVAGALANLCGN-EKLHTMLEEDGAIKALLAMVRSGNIDVIA  550 (660)
Q Consensus       502 ------------------------------s~d~~v~~~Aa~aLanLa~~-~~~r~~iv~~G~V~~Lv~lL~s~~~~v~~  550 (660)
                                                    +++++++..|+++|++++.. +.....+...|+++.|+.++.++++.++.
T Consensus       169 ~l~~~~~~~~~~~~~~~~~~~l~~l~~ll~~~~~~~~~~a~~~l~~l~~~~~~~~~~~~~~~~~~~Lv~ll~~~~~~~~~  248 (434)
T d1q1sc_         169 TLSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVT  248 (434)
T ss_dssp             HHHHHTCCCTTCCCHHHHHHHHHHHHHHTTCSCHHHHHHHHHHHHHHTSSCHHHHHHHHTTTCHHHHHHHHTCSCHHHHH
T ss_pred             HHHHHhhcccccchhhhhhhHHHHHHHHHhccccchhhhHHhhhcccchhhhhhHHHHhhcccchhcccccccchhhhhh
Confidence                                          35677888899999999854 45666677889999999999999999999


Q ss_pred             HHHHHHHHhhccchhhhhhcchhhhHHHhhcChHHHHHHhhcCCCHHHHHHHHHHHHHhhcCC-ccHHHHHhcCcHHHHH
Q 006114          551 QVARGLANFAKCESRAIVQGQRKGRSHLMEDSALEWLIANSKTNSASTRRHVELALCHLAQNE-DNARDFISRGGAKELV  629 (660)
Q Consensus       551 ~Al~aLanLA~~~~~~~aq~~~e~r~~Li~~G~v~~Lv~lL~s~d~~vr~~Aa~AL~nLa~~~-e~~~~Ive~G~l~~Lv  629 (660)
                      .|+.+|++++..++        ..+..+...|+++.++.++.+.++.++..|+++|++|+.+. .....+...|+++.++
T Consensus       249 ~al~~l~~l~~~~~--------~~~~~~~~~~~~~~l~~ll~~~~~~v~~~a~~~L~~l~~~~~~~~~~i~~~~~i~~li  320 (434)
T d1q1sc_         249 PALRAIGNIVTGTD--------EQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLV  320 (434)
T ss_dssp             HHHHHHHHHTTSCH--------HHHHHHHHTTGGGGHHHHTTCSSHHHHHHHHHHHHHHTTSCHHHHHHHHHTTCHHHHH
T ss_pred             chhhhhhhHHhhhh--------HHHHHHHhccccchHHHhhcccchhhhHHHHHHHhhhccccchhHHHHhhhhhHHHHH
Confidence            99999999997653        34566888999999999999999999999999999999866 5567778999999999


Q ss_pred             HHHhcCChHHHHHHHHHHH
Q 006114          630 QISIESSREDIRNLAKKTM  648 (660)
Q Consensus       630 ~lL~s~s~~~ir~~A~~~L  648 (660)
                      .++.+++.+ ++..|..++
T Consensus       321 ~~l~~~~~~-v~~~a~~~l  338 (434)
T d1q1sc_         321 GVLSKADFK-TQKEAAWAI  338 (434)
T ss_dssp             HHHHSSCHH-HHHHHHHHH
T ss_pred             HHHhccChH-HHHHHHHHH
Confidence            999887654 455555444
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1upka_ a.118.1.15 (A:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upka_ a.118.1.15 (A:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bnxa1 a.118.1.23 (A:133-475) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lsha1 a.118.4.1 (A:285-620) Lipovitellin-phosvitin complex, superhelical domain {Lamprey (Ichthyomyzon unicuspis) [TaxId: 30308]} Back     information, alignment and structure
>d2bnxa1 a.118.1.23 (A:133-475) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lsha1 a.118.4.1 (A:285-620) Lipovitellin-phosvitin complex, superhelical domain {Lamprey (Ichthyomyzon unicuspis) [TaxId: 30308]} Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure