Citrus Sinensis ID: 006188

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------

MQGQRGTIGSLPETLSFDHGSTSTSAVDQQMFWNNMRNPPESRPPDNMLSPAGTRTTMTYVNSMSHEQQMSTAWSLGEPSSHGPQNKVTHDERRTQHGWQCEPTSSMPVDGANVNPMLVQSSNSNMMSQNLNLNAGSGGYLAEENNGRPGSSSEGGRRASCKRKALEGNVENSSVGGTSSYFQHAESSACPAVSASYNGGSSLSISDPSGQVNSGRGLGVRGPVRDGLPEWPVAGNAERSRRNYRVRINPSNQQKVMPYAQFPTNAAVRHSSISSTQESSRLPPNDQSLDSMAAPSVENTGPQSQPVLLHVPMFPQNLQPFRWDKGSSSRSGSSSSSNGARDRDVQREEARPRIMGRNILENPMFIPAPDLRNLVRSPANRSLAGGNISTPGNVASSSRAGSSSGVHPPSAPTWVPHPNPYQYPRRFSELIRRSLTSSSGSESAGQSSNQTPPHSVPLSPEEMVLSSGAGNQRHHPSYPRSASRLERQDGVLGFPHPLRALAAVGEGRNRVLVSEIRNVLDLMRRGEGLQFEDVMILDQSVFFGVADINDRHRDMRLDVDNMSYEELLALEERIGNVSTGLTEETIKNRLKQQKYSISLGSQQEQEPCCICQEEYNDGEDTGILHCGHDFHTSCIKQWLMHKNLCPICKTTALSTSS

cccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccHHHHHcHHHHccccccccHHcccccccccccHHHHHHHHHHHccccccccHHHHHHHcccEEccccccccccccccccccccccccccEEEEccccccHHHHHHHHHHccccccccccccccccc

cccccccccccHHHccccccccccccccccHHHHcccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccHHHEEEEccHHHHccccccccccccccccccccHHHHHHHHHHcccccccccHHHHHHHccccEEccccccccccccEEEEEHHccccccEEEEcccccHHHHHHHHHHHHHccccccEcccccccc

mqgqrgtigslpetlsfdhgststsaVDQQMFWnnmrnppesrppdnmlspagtrtTMTYVNSMSHEQQMSTawslgepsshgpqnkvthderrtqhgwqceptssmpvdganvnpmlvqssnsnmmsqnlnlnagsggylaeenngrpgssseggrrasckrkalegnvenssvggtssyfqhaessacpavsasynggsslsisdpsgqvnsgrglgvrgpvrdglpewpvagnaersrrnyrvrinpsnqqkvmpyaqfptnaavrhssisstqessrlppndqsldsmaapsventgpqsqpvllhvpmfpqnlqpfrwdkgsssrsgsssssngardrdvqreearprimgrnilenpmfipapdlrnlvrspanrslaggnistpgnvasssragsssgvhppsaptwvphpnpyqyprrFSELIRRSltsssgsesagqssnqtpphsvplspeemvlssgagnqrhhpsyprsasrlerqdgvlgfphPLRALAAVGEGRNRVLVSEIRNVLDLMrrgeglqfedvmildqsvffgvadindrhrdmrldvdnmSYEELLALEERIgnvstgltEETIKNRLKQQKYSislgsqqeqepccicqeeyndgedtgilhcghdfhtSCIKQWLmhknlcpickttalstss

mqgqrgtigslpetlsfdhGSTSTSAVDQQMFWNNMRNPPESRPPDNMLSPAGTRTTMTYVNSMSHEQQMSTAWSLGEPSSHGPQNKVTHDERRTQHGWQCEPTSSMPVDGANVNPMLVQSSNSNMMSQNLNLNAGSGGYLAEENNgrpgssseggrraSCKRKALegnvenssvGGTSSYFQHAESSACPAVSASYNGGSSLSISDPSGQVNSGRGLgvrgpvrdglpewpvagnaersrrnyrvrinpsnqqkvmpyAQFPTNAAVRHSSISSTQESSRLPPNDQSLDSMAAPSVENTGPQSQPVLLHVPMFPQNLQPFRWDKGsssrsgsssssngardrdvqreearprimgrnilenpmfIPAPDLRNLVRSPANRslaggnistpgnVASSSRAGSSSGVHPPSAPTWVPHPNPYQYPRRFSELIRRSLTSSsgsesagqssnqtpphsVPLSPEEMVLSSGAGNQRHHPSYPRSASRLERQDGVLGFPHPLRALaavgegrnrvLVSEIRNVLDLMRRGEGLQFEDVMILDQSVFFGVADINDRHRDMRLDVDNMSYEELLALEERIGNVSTGLTEETIKNRLKQQKYSIslgsqqeqePCCICQEEYNDGEDTGILHCGHDFHTSCIKQWLMHKNLCPICKttalstss

MQGQRGTIGSLPETLSFDHGSTSTSAVDQQMFWNNMRNPPESRPPDNMLSPAGTRTTMTYVNSMSHEQQMSTAWSLGEPSSHGPQNKVTHDERRTQHGWQCEPTSSMPVDGANVNPMLVqssnsnmmsqnlnlnAGSGGYLAeenngrpgssseggrrASCKRKALEGNVENSSVGGTSSYFQHAESSACPAVSASYNGGSSLSISDPSGQVNSGRGLGVRGPVRDGLPEWPVAGNAERSRRNYRVRINPSNQQKVMPYAQFPTNAAVRHSSISSTQESSRLPPNDQSLDSMAAPSVENTGPQSQPVLLHVPMFPQNLQPFRWDKgsssrsgsssssNGARDRDVQREEARPRIMGRNILENPMFIPAPDLRNLVRSPANRSLAGGNISTPGNVasssragsssgVHPPSAPTWVPHPNPYQYPRRFSELIRRsltsssgsesagqssNQTPPHSVPLSPEEMVLSSGAGNQRHHPSYPRSASRLERQDGVLGFPHPLRALAAVGEGRNRVLVSEIRNVLDLMRRGEGLQFEDVMILDQSVFFGVADINDRHRDMRLDVDNMSYEELLALEERIGNVSTGLTEETIKNRLKQQKYSISLGSqqeqepccicqeeYNDGEDTGILHCGHDFHTSCIKQWLMHKNLCPICKTTALSTSS

**********************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************VLGFPHPLRALAAVGEGRNRVLVSEIRNVLDLMRRGEGLQFEDVMILDQSVFFGVADINDRHRDMRLDVDNMSYEELLALEERIGNVSTGLTE***********************PCCICQEEYNDGEDTGILHCGHDFHTSCIKQWLMHKNLCPICKTT******

**************L***************MFWNNMRNPPESRP***********************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************ILDQSVFFG******RHRDMRLDVDNMSYEELLALEERIGNVSTGLTEETIKNRLKQQK**********QEPCCICQEEYNDGEDTGILHCGHDFHTSCIKQWLMHKNLCPICKTTALS***

********GSLPETLSFDHGSTSTSAVDQQMFWNNMRNPPESRPPDNMLSPAGTRTTMTYVNSMS**********************************QCEPTSSMPVDGANVNPMLVQSSNSNMMSQNLNLNAGSGGYLAEE******************RKALEGNVENSSVGGTSSYFQHAESSACPAVSASYNGGSSLSISDPSGQVNSGRGLGVRGPVRDGLPEWPVAGNAERSRRNYRVRINPSNQQKVMPYAQFPTNA********************QSLDSMAAPSVENTGPQSQPVLLHVPMFPQNLQPFRW*************************EARPRIMGRNILENPMFIPAPDLRNLVRSPANRSLAGGNISTP******************SAPTWVPHPNPYQYPRRFSELIRRS************************SPEEM********************RLERQDGVLGFPHPLRALAAVGEGRNRVLVSEIRNVLDLMRRGEGLQFEDVMILDQSVFFGVADINDRHRDMRLDVDNMSYEELLALEERIGNVSTGLTEETIKNRLKQQKYSISLGSQQEQEPCCICQEEYNDGEDTGILHCGHDFHTSCIKQWLMHKNLCPICKTTALSTSS

**********************STSAVDQQMFWNNMRNPPESRPPDNMLSPAGTRTTMTYVNSMSHEQQMSTAWS********************************P***ANVNP******NSNMMSQNLNLNA*SGG***************************************************************L*I*DPSGQVNSGR*LGVRGPVRDGLPEW****************I*********PY********************SRLPPNDQSLDSM*********P*SQPVLLHVPMFPQNLQP*****************************ARPRIMGRNILENPMFIPAPDL******************************SSSGVHPPSAPTWVPHPNPY******************************************************************************A*******RNRVLVSEIRNVLDLMRRGEGLQFEDVMILDQSVFFGVADINDRHRDMRLDVDNMSYEELLALEERIGNVSTGLTEETIKNRLKQQKYSISLGSQQEQEPCCICQEEYNDGEDTGILHCGHDFHTSCIKQWLMHKNLCPICKTT******

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		657	2.2.26 [Sep-21-2011]
Q9LT17		340	E3 ubiquitin ligase BIG B	no	no	0.152	0.294	0.392	2e-14
E9QAU8		347	RING finger protein 165 O	yes	no	0.133	0.253	0.404	3e-13
Q6ZSG1		346	RING finger protein 165 O	yes	no	0.133	0.254	0.393	9e-13
Q8L649		248	E3 ubiquitin ligase BIG B	no	no	0.147	0.391	0.367	1e-12
Q5R476		986	E3 ubiquitin-protein liga	yes	no	0.132	0.088	0.360	5e-11
Q7L0R7		432	RING finger protein 44 OS	no	no	0.146	0.222	0.352	6e-11
Q90ZT7		923	E3 ubiquitin-protein liga	N/A	no	0.132	0.094	0.361	1e-10
Q66J97		967	E3 ubiquitin-protein liga	N/A	no	0.132	0.089	0.361	1e-10
Q6NRV8		959	E3 ubiquitin-protein liga	N/A	no	0.132	0.090	0.361	1e-10
Q0V9R0		954	E3 ubiquitin-protein liga	yes	no	0.132	0.091	0.361	1e-10

>sp\|Q9LT17\|BBR_ARATH E3 ubiquitin ligase BIG BROTHER-related OS=Arabidopsis thaliana GN=BBR PE=2 SV=1	Back alignment and function desciption

 Score = 81.3 bits (199), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 59/102 (57%), Gaps = 2/102 (1%)

Query: 556 RLDVDNMSYEELLALEERIGNVSTGLTEETIKNRLKQQKYSISLGSQQEQEPCCICQEEY 615
            +D D +SYEELLAL + +G  S GL+ +TI + L  ++Y          E C IC+ +Y
Sbjct: 237 EMDPDELSYEELLALGDIVGTESRGLSADTIAS-LPSKRYKEGDNQNGTNESCVICRLDY 295

Query: 616 NDGEDTGILHCGHDFHTSCIKQWLMHKNLCPICKTTALSTSS 657
            D ED  +L C H +H+ CI  WL    +CP+C +  +STS+
Sbjct: 296 EDDEDLILLPCKHSYHSECINNWLKINKVCPVC-SAEVSTST 336

E3 ubiquitin-ligase probably involved in organ size regulation.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -

>sp\|E9QAU8\|RN165_MOUSE RING finger protein 165 OS=Mus musculus GN=Rnf165 PE=2 SV=1	Back alignment and function description

>sp\|Q6ZSG1\|RN165_HUMAN RING finger protein 165 OS=Homo sapiens GN=RNF165 PE=1 SV=1	Back alignment and function description

>sp\|Q8L649\|BB_ARATH E3 ubiquitin ligase BIG BROTHER OS=Arabidopsis thaliana GN=BB PE=1 SV=1	Back alignment and function description

>sp\|Q5R476\|RN111_PONAB E3 ubiquitin-protein ligase Arkadia OS=Pongo abelii GN=RNF111 PE=2 SV=1	Back alignment and function description

>sp\|Q7L0R7\|RNF44_HUMAN RING finger protein 44 OS=Homo sapiens GN=RNF44 PE=2 SV=1	Back alignment and function description

>sp\|Q90ZT7\|R111A_XENLA E3 ubiquitin-protein ligase arkadia-A (Fragment) OS=Xenopus laevis GN=rnf111-a PE=2 SV=1	Back alignment and function description

>sp\|Q66J97\|R111C_XENLA E3 ubiquitin-protein ligase arkadia-C OS=Xenopus laevis GN=rnf111-c PE=2 SV=1	Back alignment and function description

>sp\|Q6NRV8\|R111B_XENLA E3 ubiquitin-protein ligase arkadia-B OS=Xenopus laevis GN=rnf111-b PE=2 SV=1	Back alignment and function description

>sp\|Q0V9R0\|RN111_XENTR E3 ubiquitin-protein ligase arkadia OS=Xenopus tropicalis GN=rnf111 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		657
255538248		709	protein binding protein, putative [Ricin	0.983	0.911	0.562	0.0
147845456		1022	hypothetical protein VITISV_042276 [Viti	0.993	0.638	0.560	0.0
225458665		734	PREDICTED: uncharacterized protein LOC10	0.987	0.884	0.563	0.0
307135853		713	zinc finger protein binding protein [Cuc	0.983	0.906	0.495	1e-170
449450233		713	PREDICTED: uncharacterized protein LOC10	0.983	0.906	0.495	1e-168
449530824		713	PREDICTED: LOW QUALITY PROTEIN: uncharac	0.983	0.906	0.494	1e-167
224063495		765	predicted protein [Populus trichocarpa]	0.980	0.841	0.480	1e-164
356510442		707	PREDICTED: uncharacterized protein LOC10	0.975	0.906	0.475	1e-159
356519268		708	PREDICTED: uncharacterized protein LOC10	0.977	0.906	0.485	1e-157
83853835		787	zinc finger protein [Glycine max]	0.977	0.815	0.454	1e-150

>gi\|255538248\|ref\|XP_002510189.1\| protein binding protein, putative [Ricinus communis] gi\|223550890\|gb\|EEF52376.1\| protein binding protein, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  702 bits (1812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/718 (56%), Positives = 495/718 (68%), Gaps = 72/718 (10%)

Query: 1   MQGQRGTIGSLPETLSFDHGSTSTSAV-DQQMFWNNMRNPPESRPPDNMLSPAGTRTTMT 59
           MQGQRG IGSLPE L FDHGSTS +A+ DQQ+ WNNM+N  ESR P+ MLSP  +     
Sbjct: 1   MQGQRGIIGSLPEILDFDHGSTSGNAIIDQQICWNNMQNSAESRLPEFMLSP--SHMNNA 58

Query: 60  YVNSMSHEQQMSTAWSLGEPSSHGPQNKVTHDERRTQHGW-----------------QCE 102
           YV S+  E+Q  + WSLGEPSS   QN+ + +E++++HGW                 + E
Sbjct: 59  YVGSVDQERQSLSGWSLGEPSSSSAQNEASREEQKSEHGWSSSGSTCAGAGPRLEERRYE 118

Query: 103 PTSSMPVDGANVNPMLVQSSNSNMMSQNLNLNA--------------------------- 135
           PT+ + +D  NV+P  VQSSNSN + QNLNLNA                           
Sbjct: 119 PTNILSLDSVNVDPQFVQSSNSNPIPQNLNLNAGFVGHGSDNSPLMESSGMYKSGRAQNE 178

Query: 136 ---------------GSGGYLAEENNGRPGSSSEGGRRASCKRKALEGNVENSSVGGTSS 180
                          GS GY+ EEN+ RPGSS + GRR SCKRKA+EG++  SSV  +S 
Sbjct: 179 RIAPASSSGTFLHPSGSSGYIVEENDSRPGSSLD-GRRQSCKRKAVEGHMGQSSVSESSG 237

Query: 181 YFQHAESSACPAVSASYNGGSSLSISDPSGQVNSGRGLGVRGPVRDGLPEWPVAGNAERS 240
           +FQ ++ SA P V   Y+ G SLSIS PS Q+N   GLG+RG   D +P+  VAG  E S
Sbjct: 238 FFQCSDGSAWPGVPPRYDAGGSLSISAPSEQMNPRLGLGLRGLASDSIPDLAVAGRPETS 297

Query: 241 RRNYRVRINPSNQQKVMPYAQFPTNAAVRHSSISSTQESSRLPPNDQSLDSMAAPSVENT 300
           +RN+R+RI+ SNQ+ V P + F T +AVR S++ S+  SSRL P + SLD  +A  V+N 
Sbjct: 298 QRNFRLRISSSNQESVPP-SSFSTGSAVRRSNVPSSHRSSRLLPVNHSLDFRSASGVDNA 356

Query: 301 GPQSQPVLLHVPMFPQNLQPFRWDKGSSSRSGSSSSSNGARDRDVQREEARPRIMGRNIL 360
              SQPV++ VP  PQN+  FRW++ SSSR GSSSSS    D    REEA  R M RN+ 
Sbjct: 357 TSHSQPVIIPVPALPQNVPSFRWNENSSSRIGSSSSSITLPD----REEASSRSMSRNMW 412

Query: 361 ENPMFIPAPDLRNLVRSPANRSLAGGNISTPGNVASSSRAGSSSGVHPPSAPTWVPHPN- 419
           E+PMF+P  +LR   R+P NRS+ GGN S PGN+AS+SRAGSSSGVHP SAPTWV HPN 
Sbjct: 413 EHPMFVPTTELRTSARNPTNRSVTGGNASVPGNIASASRAGSSSGVHPLSAPTWVSHPNP 472

Query: 420 PYQYPRRFSELIRRSLTSSSGSESAGQSSNQT-PPHSVPLSPEEMVLSSGAGNQRHHPSY 478
           P +  RR +E +RRSL  S+G++S GQS+  +  P   P S EE +  SG GNQ HH SY
Sbjct: 473 PSRNSRRLAEFVRRSLF-SAGADSGGQSTTHSLLPSGPPGSLEETMHPSGVGNQGHHQSY 531

Query: 479 PRSASRLERQ-DGVLGFPHPLRALAAVGEGRNRVLVSEIRNVLDLMRRGEGLQFEDVMIL 537
           PRSAS +ERQ +GVLG P+PLR LAA  +GR+R+LVSEIRNVLDLMRRGE L+FEDVMIL
Sbjct: 532 PRSASWMERQGEGVLGIPYPLRTLAANSDGRSRLLVSEIRNVLDLMRRGESLRFEDVMIL 591

Query: 538 DQSVFFGVADINDRHRDMRLDVDNMSYEELLALEERIGNVSTGLTEETIKNRLKQQKYSI 597
           DQSVFFGVADI+DRHRDMRLDVDNMSYEELLALEERIGNVSTGL+EETI N+LKQ+KYSI
Sbjct: 592 DQSVFFGVADIHDRHRDMRLDVDNMSYEELLALEERIGNVSTGLSEETITNQLKQRKYSI 651

Query: 598 SLGSQQEQEPCCICQEEYNDGEDTGILHCGHDFHTSCIKQWLMHKNLCPICKTTALST 655
           ++G++ E EPCC+CQEEYN+GED G L CGHDFHT+CIKQWLM KN CPICKTT L+T
Sbjct: 652 AVGTEVEAEPCCVCQEEYNNGEDVGTLDCGHDFHTNCIKQWLMLKNWCPICKTTGLAT 709

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|147845456\|emb\|CAN83345.1\| hypothetical protein VITISV_042276 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225458665\|ref\|XP_002282892.1\| PREDICTED: uncharacterized protein LOC100267740 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|307135853\|gb\|ADN33722.1\| zinc finger protein binding protein [Cucumis melo subsp. melo]	Back alignment and taxonomy information

>gi\|449450233\|ref\|XP_004142868.1\| PREDICTED: uncharacterized protein LOC101203243 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449530824\|ref\|XP_004172392.1\| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101228751 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|224063495\|ref\|XP_002301172.1\| predicted protein [Populus trichocarpa] gi\|222842898\|gb\|EEE80445.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|356510442\|ref\|XP_003523947.1\| PREDICTED: uncharacterized protein LOC100784575 [Glycine max]	Back alignment and taxonomy information

>gi\|356519268\|ref\|XP_003528295.1\| PREDICTED: uncharacterized protein LOC100783014 [Glycine max]	Back alignment and taxonomy information

>gi\|83853835\|gb\|ABC47867.1\| zinc finger protein [Glycine max]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		657
TAIR\|locus:2160031		691	AT5G42940 [Arabidopsis thalian	0.744	0.707	0.418	1.4e-101
TAIR\|locus:2028225		645	AT1G45180 [Arabidopsis thalian	0.569	0.579	0.405	1.1e-78
TAIR\|locus:2124271		666	MBR2 "MED25 BINDING RING-H2 PR	0.721	0.711	0.385	8.5e-77
TAIR\|locus:2125284		497	AT4G31450 [Arabidopsis thalian	0.219	0.289	0.451	1.8e-26
TAIR\|locus:2149378		520	AT5G24870 [Arabidopsis thalian	0.214	0.271	0.433	1.8e-24
TAIR\|locus:2159634		525	AT5G10650 [Arabidopsis thalian	0.211	0.264	0.418	2.1e-22
TAIR\|locus:2027804		367	AT1G73760 [Arabidopsis thalian	0.194	0.348	0.438	4e-22
TAIR\|locus:2009660		494	AT1G53190 [Arabidopsis thalian	0.185	0.246	0.421	2.9e-20
TAIR\|locus:2030933		368	AT1G17970 [Arabidopsis thalian	0.179	0.320	0.404	1.5e-17
TAIR\|locus:2086305		486	AT3G15070 [Arabidopsis thalian	0.170	0.230	0.393	1.7e-16

TAIR\|locus:2160031 AT5G42940 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 871 (311.7 bits), Expect = 1.4e-101, Sum P(2) = 1.4e-101
 Identities = 216/516 (41%), Positives = 283/516 (54%)

Query:   159 ASCKRKALEGNVENSSVGGTSSYFQHAESSACPAVSASYNGGSSLSISDPSGQVNSG-RG 217
             ASCKRKALEG++  SS GG    FQ  ESS+    S  +  G+ L+IS   G +++G RG
Sbjct:   179 ASCKRKALEGSISQSSSGGYHD-FQRGESSSWTPGSTVFRPGNGLNIS---GSLDNGPRG 234

Query:   218 LGVRGPVRD---GLPEWPVAGNAERSRRNYRVRINPSNQQKVMPYAQFPTNAAVRHSSIS 274
             + V G V +     P +PV+  AE S RN  VR NPS+ Q+ +  + F     VR     
Sbjct:   235 M-VSGTVPNFPVSAPNFPVSAIAESSSRNICVRSNPSDHQETVNPSTFAAGTVVRRPVPP 293

Query:   275 STQESSR-LPPNDQSLDSMAAPS-VENTGPQSQPVLLHVPMFPQNLQPFRWDKXXXXXXX 332
             S    SR LP +  SLD     S V +  P S PV +  P     L PFRW         
Sbjct:   294 SQLNLSRHLPADQHSLDLRPGQSFVVSRNPNSTPVSIP-PGSRTMLPPFRW--TGSSLVG 350

Query:   333 XXXXXNGARDRDVQREEARPRIMGRNILENPMFIPAPDLRNLVRSPANRSLAGGNISTPG 392
                      +R++  +E R R +  N LE PMF  AP++ N  RS ++R++  GN+++  
Sbjct:   351 GTSNSTAPVERNLHLDETRSRSIPGNTLEIPMFA-APEVGNFARSQSSRNVTNGNLNSAS 409

Query:   393 NVXXXXXXXXXXXVHPPSAP-TWVPHPNPYQYPRRF---SELIRRXXXXXXXXXXXXXXX 448
             +V             PPS+   W  + N   Y RR    SEL RR               
Sbjct:   410 SVSRTGSTTSVPPPPPPSSNLAWTSYQNSPHYQRRRTERSELARRSLLSSLAADATNQRS 469

Query:   449 NQTPP-HSV--PLSPEEMVLSSGAGN-QRHHPSYPRSASRLERQ-DGVLGFPHPLRALAA 503
                P   S+  P S + +VL  G  N Q H+ +Y R+    +RQ D V+G PHPLRALAA
Sbjct:   470 GDHPTLRSLAPPASSDGLVLQPGGDNSQMHNRAYSRAGPLFDRQGDSVVGIPHPLRALAA 529

Query:   504 VGEGRNRVLVSEIRNVLDLMRR---GEGLQFEDVMILDQSVFFGVADINDRHRDMRLDVD 560
                GR+R++VS+++NVLD+MRR      L+ EDVM+L+ SV F  A  +DR+RDMRLDVD
Sbjct:   530 ASRGRSRLMVSQMQNVLDVMRRDANNNNLRLEDVMLLNHSVLFDGATGHDRYRDMRLDVD 589

Query:   561 NMSYEELLALEERIGNVSTGLTEETIKNRLKQQKYSISLGSXXXXXXXXXXXXXYNDGED 620
             NMSYEELLALEERIG+V TG+ EETI NRLKQ+KY  +  S             Y +GED
Sbjct:   590 NMSYEELLALEERIGDVCTGVNEETISNRLKQRKYKSNTKSPQDAEPCCVCQEEYTEGED 649

Query:   621 TGILHCGHDFHTSCIKQWLMHKNLCPICKTTALSTS 656
              G L CGH+FH+ CIK+WL  KNLCPICKTT L+T+
Sbjct:   650 MGTLECGHEFHSQCIKEWLKQKNLCPICKTTGLNTA 685

GO:0008270 "zinc ion binding" evidence=IEA;ISS

TAIR\|locus:2028225 AT1G45180 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2124271 MBR2 "MED25 BINDING RING-H2 PROTEIN 2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2125284 AT4G31450 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2149378 AT5G24870 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2159634 AT5G10650 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2027804 AT1G73760 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2009660 AT1G53190 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2030933 AT1G17970 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2086305 AT3G15070 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		657
pfam13639		46	pfam13639, zf-RING_2, Ring finger domain	5e-17
cd00162		45	cd00162, RING, RING-finger (Really Interesting New	3e-14
smart00184		40	smart00184, RING, Ring finger	2e-12
pfam12678		73	pfam12678, zf-rbx1, RING-H2 zinc finger	1e-10
pfam13923		45	pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI	5e-10
pfam00097		40	pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING	3e-09
COG5540		374	COG5540, COG5540, RING-finger-containing ubiquitin	8e-07
COG5194		88	COG5194, APC11, Component of SCF ubiquitin ligase	2e-06
PHA02929		238	PHA02929, PHA02929, N1R/p28-like protein; Provisio	2e-06
pfam13920		49	pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI	3e-06
pfam12861		85	pfam12861, zf-Apc11, Anaphase-promoting complex su	1e-05
COG5243		491	COG5243, HRD1, HRD ubiquitin ligase complex, ER me	1e-04
smart00744		49	smart00744, RINGv, The RING-variant domain is a C4	3e-04
pfam00628		51	pfam00628, PHD, PHD-finger	0.001

>gnl\|CDD\|222279 pfam13639, zf-RING_2, Ring finger domain	Back alignment and domain information

 Score = 74.7 bits (184), Expect = 5e-17
 Identities = 19/43 (44%), Positives = 27/43 (62%)

Query: 608 CCICQEEYNDGEDTGILHCGHDFHTSCIKQWLMHKNLCPICKT 650
           C IC +E+  GE+  +L CGH FH  C+ +WL   N CP+C+ 
Sbjct: 3   CPICLDEFEPGEEVVVLPCGHVFHKECLDKWLRSSNTCPLCRA 45

Length = 46

>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)

Back alignment and domain information

>gnl\|CDD\|214546 smart00184, RING, Ring finger	Back alignment and domain information

>gnl\|CDD\|221705 pfam12678, zf-rbx1, RING-H2 zinc finger	Back alignment and domain information

>gnl\|CDD\|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger)	Back alignment and domain information

>gnl\|CDD\|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger)	Back alignment and domain information

>gnl\|CDD\|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|227521 COG5194, APC11, Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional	Back alignment and domain information

>gnl\|CDD\|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger)	Back alignment and domain information

>gnl\|CDD\|193335 pfam12861, zf-Apc11, Anaphase-promoting complex subunit 11 RING-H2 finger	Back alignment and domain information

>gnl\|CDD\|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|128983 smart00744, RINGv, The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins	Back alignment and domain information

>gnl\|CDD\|201356 pfam00628, PHD, PHD-finger	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		657
KOG4628		348	consensus Predicted E3 ubiquitin ligase [Posttrans	99.44
PF13639		44	zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C	99.35
PF12678		73	zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766	99.14
COG5540		374	RING-finger-containing ubiquitin ligase [Posttrans	99.1
COG5243		491	HRD1 HRD ubiquitin ligase complex, ER membrane com	99.05
PHA02929		238	N1R/p28-like protein; Provisional	99.05
KOG0317		293	consensus Predicted E3 ubiquitin ligase, integral	98.94
KOG0320		187	consensus Predicted E3 ubiquitin ligase [Posttrans	98.87
PLN03208		193	E3 ubiquitin-protein ligase RMA2; Provisional	98.86
KOG0823		230	consensus Predicted E3 ubiquitin ligase [Posttrans	98.79
cd00162		45	RING RING-finger (Really Interesting New Gene) dom	98.78
PF13920		50	zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger);	98.77
PF13923		39	zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger);	98.74
KOG0802		543	consensus E3 ubiquitin ligase [Posttranslational m	98.71
smart00504		63	Ubox Modified RING finger domain. Modified RING fi	98.65
PF14634		44	zf-RING_5: zinc-RING finger domain	98.62
PHA02926		242	zinc finger-like protein; Provisional	98.61
PF12861		85	zf-Apc11: Anaphase-promoting complex subunit 11 RI	98.61
PF15227		42	zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB:	98.6
PF00097		41	zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I	98.52
TIGR00599		397	rad18 DNA repair protein rad18. This family is bas	98.52
smart00184		39	RING Ring finger. E3 ubiquitin-protein ligase acti	98.52
COG5194		88	APC11 Component of SCF ubiquitin ligase and anapha	98.42
COG5574		271	PEX10 RING-finger-containing E3 ubiquitin ligase [	98.32
KOG0828		636	consensus Predicted E3 ubiquitin ligase [Posttrans	98.21
KOG2930		114	consensus SCF ubiquitin ligase, Rbx1 component [Po	98.21
KOG2164		513	consensus Predicted E3 ubiquitin ligase [Posttrans	98.2
KOG0287		442	consensus Postreplication repair protein RAD18 [Re	98.16
PF13445		43	zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A.	98.16
COG5432		391	RAD18 RING-finger-containing E3 ubiquitin ligase [	98.15
KOG1493		84	consensus Anaphase-promoting complex (APC), subuni	98.13
PF04564		73	U-box: U-box domain; InterPro: IPR003613 Quality c	98.1
KOG1734		328	consensus Predicted RING-containing E3 ubiquitin l	98.08
KOG2177		386	consensus Predicted E3 ubiquitin ligase [Posttrans	98.07
smart00744		49	RINGv The RING-variant domain is a C4HC3 zinc-fing	97.98
COG5219		1525	Uncharacterized conserved protein, contains RING Z	97.86
PF11793		70	FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A.	97.81
KOG4265		349	consensus Predicted E3 ubiquitin ligase [Posttrans	97.65
KOG4445		368	consensus Uncharacterized conserved protein, conta	97.57
KOG0978		698	consensus E3 ubiquitin ligase involved in syntaxin	97.57
KOG0825		1134	consensus PHD Zn-finger protein [General function	97.53
KOG4172		62	consensus Predicted E3 ubiquitin ligase [Posttrans	97.49
KOG1039		344	consensus Predicted E3 ubiquitin ligase [Posttrans	97.41
KOG0311		381	consensus Predicted E3 ubiquitin ligase [Posttrans	97.33
PF14835		65	zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM	97.3
KOG4159		398	consensus Predicted E3 ubiquitin ligase [Posttrans	97.19
KOG0804		493	consensus Cytoplasmic Zn-finger protein BRAP2 (BRC	97.06
KOG1785		563	consensus Tyrosine kinase negative regulator CBL [	97.02
KOG2660		331	consensus Locus-specific chromosome binding protei	96.9
KOG1428		3738	consensus Inhibitor of type V adenylyl cyclases/Ne	96.83
KOG2879		298	consensus Predicted E3 ubiquitin ligase [Posttrans	96.78
KOG0297		391	consensus TNF receptor-associated factor [Signal t	96.73
KOG4692		489	consensus Predicted E3 ubiquitin ligase [Posttrans	96.71
COG5152		259	Uncharacterized conserved protein, contains RING a	96.66
PF11789		57	zf-Nse: Zinc-finger of the MIZ type in Nse subunit	96.59
KOG1002		791	consensus Nucleotide excision repair protein RAD16	96.57
KOG1813		313	consensus Predicted E3 ubiquitin ligase [Posttrans	96.45
KOG1571		355	consensus Predicted E3 ubiquitin ligase [Posttrans	96.32
KOG1941		518	consensus Acetylcholine receptor-associated protei	96.31
KOG2114		933	consensus Vacuolar assembly/sorting protein PEP5/V	96.25
KOG4275		350	consensus Predicted E3 ubiquitin ligase [Posttrans	96.2
KOG3039		303	consensus Uncharacterized conserved protein [Funct	95.94
KOG2034		911	consensus Vacuolar sorting protein PEP3/VPS18 [Int	95.9
KOG1814		445	consensus Predicted E3 ubiquitin ligase [Posttrans	95.89
PHA02825		162	LAP/PHD finger-like protein; Provisional	95.67
PF05883		134	Baculo_RING: Baculovirus U-box/Ring-like domain; I	95.4
COG5236		493	Uncharacterized conserved protein, contains RING Z	95.33
PF10367		109	Vps39_2: Vacuolar sorting protein 39 domain 2; Int	95.28
KOG3970		299	consensus Predicted E3 ubiquitin ligase [Posttrans	95.21
PF04641		260	Rtf2: Rtf2 RING-finger	94.8
PHA03096		284	p28-like protein; Provisional	94.8
PF14570		48	zf-RING_4: RING/Ubox like zinc-binding domain; PDB	94.68
PHA02862		156	5L protein; Provisional	94.62
KOG0801		205	consensus Predicted E3 ubiquitin ligase [Posttrans	94.6
PF14447		55	Prok-RING_4: Prokaryotic RING finger family 4	94.5
COG5222		427	Uncharacterized conserved protein, contains RING Z	94.24
PF12906		47	RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A.	94.19
KOG0827		465	consensus Predicted E3 ubiquitin ligase [Posttrans	94.16
KOG1952		950	consensus Transcription factor NF-X1, contains NFX	94.09
KOG2932		389	consensus E3 ubiquitin ligase involved in ubiquiti	94.06
KOG3268		234	consensus Predicted E3 ubiquitin ligase [Posttrans	93.72
KOG1001		674	consensus Helicase-like transcription factor HLTF/	93.56
COG5183		1175	SSM4 Protein involved in mRNA turnover and stabili	93.39
KOG0826		357	consensus Predicted E3 ubiquitin ligase involved i	93.38
COG5175		480	MOT2 Transcriptional repressor [Transcription]	92.35
KOG1940		276	consensus Zn-finger protein [General function pred	92.06
PF03854		50	zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc	92.05
KOG0298		1394	consensus DEAD box-containing helicase-like transc	91.43
PF05290		140	Baculo_IE-1: Baculovirus immediate-early protein (	90.84
PF08746		43	zf-RING-like: RING-like domain; InterPro: IPR01485	90.12
KOG3002		299	consensus Zn finger protein [General function pred	90.05
KOG1812		384	consensus Predicted E3 ubiquitin ligase [Posttrans	89.21
COG5220		314	TFB3 Cdk activating kinase (CAK)/RNA polymerase II	88.92
KOG3161		861	consensus Predicted E3 ubiquitin ligase [Posttrans	88.34
PF10272		358	Tmpp129: Putative transmembrane protein precursor;	88.23
KOG1609		323	consensus Protein involved in mRNA turnover and st	87.99
KOG4362		684	consensus Transcriptional regulator BRCA1 [Replica	87.52
KOG0825		1134	consensus PHD Zn-finger protein [General function	87.21
KOG3053		293	consensus Uncharacterized conserved protein [Funct	87.05
KOG2817		394	consensus Predicted E3 ubiquitin ligase [Posttrans	85.91
KOG0309		1081	consensus Conserved WD40 repeat-containing protein	85.83
KOG1100		207	consensus Predicted E3 ubiquitin ligase [Posttrans	84.65
KOG1829		580	consensus Uncharacterized conserved protein, conta	84.05

>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

Probab=99.44  E-value=5.1e-14  Score=150.00  Aligned_cols=68  Identities=32%  Similarity=0.837  Sum_probs=54.5

Q ss_pred             HhhhhcccccccCCCCCCCccccccCCcCCCCceeEecCCChhcHHHHHHHHHcCCC-CCCCCCCcCCCC
Q 006188          588 NRLKQQKYSISLGSQQEQEPCCICQEEYNDGEDTGILHCGHDFHTSCIKQWLMHKNL-CPICKTTALSTS  656 (657)
Q Consensus       588 k~L~~~ky~~~~~~~~~~e~C~IClEef~d~d~v~~LpCGHiFH~~CI~qWL~~k~t-CPICRtsLl~tS  656 (657)
                      +.++...|....+.... ..|+||+|+|++++++++|||+|.||..||++||.+..+ ||+||+.+.+.+
T Consensus       213 ~~~p~~~f~~~~~~~~~-~~CaIClEdY~~GdklRiLPC~H~FH~~CIDpWL~~~r~~CPvCK~di~~~~  281 (348)
T KOG4628|consen  213 KKLPVRTFTKGDDEDAT-DTCAICLEDYEKGDKLRILPCSHKFHVNCIDPWLTQTRTFCPVCKRDIRTDS  281 (348)
T ss_pred             hhCCcEEeccccccCCC-ceEEEeecccccCCeeeEecCCCchhhccchhhHhhcCccCCCCCCcCCCCC
Confidence            44666666533222222 689999999999999999999999999999999997755 999999887653

>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A	Back alignment and domain information

>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PHA02929 N1R/p28-like protein; Provisional	Back alignment and domain information

>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional	Back alignment and domain information

>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)

Back alignment and domain information

>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A	Back alignment and domain information

>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A	Back alignment and domain information

>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>smart00504 Ubox Modified RING finger domain	Back alignment and domain information

>PF14634 zf-RING_5: zinc-RING finger domain	Back alignment and domain information

>PHA02926 zinc finger-like protein; Provisional	Back alignment and domain information

>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger	Back alignment and domain information

>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A	Back alignment and domain information

>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>TIGR00599 rad18 DNA repair protein rad18	Back alignment and domain information

>smart00184 RING Ring finger	Back alignment and domain information

>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning]	Back alignment and domain information

>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair]	Back alignment and domain information

>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A	Back alignment and domain information

>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms]	Back alignment and domain information

>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis	Back alignment and domain information

>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins	Back alignment and domain information

>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A	Back alignment and domain information

>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown]	Back alignment and domain information

>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0825 consensus PHD Zn-finger protein [General function prediction only]	Back alignment and domain information

>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B	Back alignment and domain information

>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only]	Back alignment and domain information

>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms]	Back alignment and domain information

>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown]	Back alignment and domain information

>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms]	Back alignment and domain information

>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]	Back alignment and domain information

>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C	Back alignment and domain information

>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair]	Back alignment and domain information

>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures]	Back alignment and domain information

>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3039 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PHA02825 LAP/PHD finger-like protein; Provisional	Back alignment and domain information

>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length	Back alignment and domain information

>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1	Back alignment and domain information

>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF04641 Rtf2: Rtf2 RING-finger	Back alignment and domain information

>PHA03096 p28-like protein; Provisional	Back alignment and domain information

>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B	Back alignment and domain information

>PHA02862 5L protein; Provisional	Back alignment and domain information

>KOG0801 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF14447 Prok-RING_4: Prokaryotic RING finger family 4	Back alignment and domain information

>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A	Back alignment and domain information

>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription]	Back alignment and domain information

>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair]	Back alignment and domain information

>COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification]	Back alignment and domain information

>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5175 MOT2 Transcriptional repressor [Transcription]	Back alignment and domain information

>KOG1940 consensus Zn-finger protein [General function prediction only]	Back alignment and domain information

>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair]	Back alignment and domain information

>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0	Back alignment and domain information

>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO)	Back alignment and domain information

>KOG3002 consensus Zn finger protein [General function prediction only]	Back alignment and domain information

>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans	Back alignment and domain information

>KOG1609 consensus Protein involved in mRNA turnover and stability [RNA processing and modification]	Back alignment and domain information

>KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription]	Back alignment and domain information

>KOG0825 consensus PHD Zn-finger protein [General function prediction only]	Back alignment and domain information

>KOG3053 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1829 consensus Uncharacterized conserved protein, contains C1, PH and RUN domains [Signal transduction mechanisms]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		657
1iym_A		55	Ring-H2 Finger Domain Of El5 Length = 55		3e-04
2kiz_A		69	Solution Structure Of Arkadia Ring-H2 Finger Domain		4e-04

>pdb|1IYM|A Chain A, Ring-H2 Finger Domain Of El5 Length = 55

Back alignment and structure

Iteration: 1
 Score = 43.9 bits (102), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 1/38 (2%)
Query: 617 DGEDTGIL-HCGHDFHTSCIKQWLMHKNLCPICKTTAL 653
           DGE+   L  CGH FH  C+  WL   + CP+C+ T +
Sbjct: 17  DGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTVV 54

PyMOL of 1iym

>pdb|2KIZ|A Chain A, Solution Structure Of Arkadia Ring-H2 Finger Domain Length = 69

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		657
2ep4_A		74	Ring finger protein 24; zinc binding, ubiquitin, E	3e-19
2l0b_A		91	E3 ubiquitin-protein ligase praja-1; zinc finger,	5e-17
2kiz_A		69	E3 ubiquitin-protein ligase arkadia; ring-H2 finge	3e-16
1x4j_A		75	Ring finger protein 38; structural genomics, NPPSF	4e-16
1chc_A		68	Equine herpes virus-1 ring domain; viral protein;	5e-16
2ecm_A		55	Ring finger and CHY zinc finger domain- containing	4e-15
2ea6_A		69	Ring finger protein 4; RNF4, RES4-26, ring domain,	8e-15
2xeu_A		64	Ring finger protein 4; transcription, zinc-finger,	2e-14
3ng2_A		71	RNF4, snurf, ring finger protein 4; ring domain, E	2e-14
2ecn_A		70	Ring finger protein 141; RNF141, ring domain, zinc	2e-14
2ect_A		78	Ring finger protein 126; metal binding protein, st	6e-14
2ecl_A		81	Ring-box protein 2; RNF7, ring domian, zinc-bindin	1e-12
1iym_A		55	EL5; ring-H2 finger, ubiquitin ligase, DNA binding	4e-12
2csy_A		81	Zinc finger protein 183-like 1; ring finger protei	3e-11
2djb_A		72	Polycomb group ring finger protein 6; PCGF6, ring	3e-11
2d8t_A		71	Dactylidin, ring finger protein 146; RNF146, ring	7e-11
4ap4_A		133	E3 ubiquitin ligase RNF4; ligase-signalling protei	3e-10
4ap4_A		133	E3 ubiquitin ligase RNF4; ligase-signalling protei	4e-06
2ckl_A		108	Polycomb group ring finger protein 4; BMI1, RING1B	4e-10
3lrq_A		100	E3 ubiquitin-protein ligase TRIM37; structural gen	5e-10
3dpl_R		106	Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST	1e-09
4epo_C		149	E3 ubiquitin-protein ligase RNF8; coiled-coil, E3	2e-09
2y1n_A		389	E3 ubiquitin-protein ligase; ligase-transferase co	3e-09
1v87_A		114	Deltex protein 2; ring-H2 domain, zinc-binding dom	4e-09
4a0k_B		117	E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi	6e-09
2ct0_A		74	Non-SMC element 1 homolog; ring domain, structural	1e-08
2y43_A		99	E3 ubiquitin-protein ligase RAD18; DNA repair, met	1e-08
3k1l_B		381	Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A	7e-07
3nw0_A		238	Non-structural maintenance of chromosomes element	8e-07
1wim_A		94	KIAA0161 protein; ring finger domain, UBCM4-intera	9e-07
3fl2_A		124	E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA	1e-06
1vyx_A		60	ORF K3, K3RING; zinc-binding protein, ring domain,	1e-06
2ct2_A		88	Tripartite motif protein 32; zinc-finger protein H	2e-06
2d8s_A		80	Cellular modulator of immune recognition; C-MIR, m	3e-06
2ecy_A		66	TNF receptor-associated factor 3; metal binding pr	6e-06
1jm7_B		117	BARD1, BRCA1-associated ring domain protein 1; rin	2e-05
2vje_B		63	MDM4 protein; proto-oncogene, phosphorylation, alt	2e-05
1rmd_A		116	RAG1; V(D)J recombination, antibody, MAD, ring fin	4e-05
3hcs_A		170	TNF receptor-associated factor 6; cross-brace, bet	4e-05
1e4u_A		78	Transcriptional repressor NOT4; gene regulation, t	4e-05
3l11_A		115	E3 ubiquitin-protein ligase RNF168; E3 ligase, rin	9e-05
1jm7_A		112	BRCA1, breast cancer type 1 susceptibility protein	1e-04
2vje_A		64	E3 ubiquitin-protein ligase MDM2; proto-oncogene,	1e-04
1z6u_A		150	NP95-like ring finger protein isoform B; structura	1e-04
1bor_A		56	Transcription factor PML; proto-oncogene, nuclear	1e-04
1g25_A		65	CDK-activating kinase assembly factor MAT1; ring f	2e-04
3hct_A		118	TNF receptor-associated factor 6; cross-brace, bet	2e-04
2yur_A		74	Retinoblastoma-binding protein 6; P53-associated c	2e-04
1we9_A		64	PHD finger family protein; structural genomics, PH	2e-04
2ckl_B		165	Ubiquitin ligase protein RING2; BMI1, RING1B, poly	3e-04
2ysl_A		73	Tripartite motif-containing protein 31; ring-type	3e-04
3ztg_A		92	E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR	4e-04
2ecj_A		58	Tripartite motif-containing protein 39; TRIM39, ri	7e-04

>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74	Back alignment and structure

 Score = 81.4 bits (201), Expect = 3e-19
 Identities = 17/55 (30%), Positives = 28/55 (50%)

Query: 603 QEQEPCCICQEEYNDGEDTGILHCGHDFHTSCIKQWLMHKNLCPICKTTALSTSS 657
              E C +C E++   ++ GI  C H FH  C+ +WL  + +CP+C    L  + 
Sbjct: 13  NLHELCAVCLEDFKPRDELGICPCKHAFHRKCLIKWLEVRKVCPLCNMPVLQLAQ 67

PyMOL of 2ep4

>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91	Back alignment and structure

>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69	Back alignment and structure

>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75	Back alignment and structure

>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68	Back alignment and structure

>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55	Back alignment and structure

>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69	Back alignment and structure

>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64	Back alignment and structure

>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71	Back alignment and structure

>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70	Back alignment and structure

>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78	Back alignment and structure

>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81	Back alignment and structure

>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55	Back alignment and structure

>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81	Back alignment and structure

>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72	Back alignment and structure

>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71	Back alignment and structure

>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133	Back alignment and structure

>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133	Back alignment and structure

>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108	Back alignment and structure

>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100	Back alignment and structure

>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Length = 106	Back alignment and structure

>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149	Back alignment and structure

>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389	Back alignment and structure

>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114	Back alignment and structure

>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Length = 117	Back alignment and structure

>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74	Back alignment and structure

>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99	Back alignment and structure

>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381	Back alignment and structure

>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238	Back alignment and structure

>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 94	Back alignment and structure

>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124	Back alignment and structure

>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Length = 60	Back alignment and structure

>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88	Back alignment and structure

>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80	Back alignment and structure

>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66	Back alignment and structure

>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117	Back alignment and structure

>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63	Back alignment and structure

>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116	Back alignment and structure

>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170	Back alignment and structure

>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78	Back alignment and structure

>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115	Back alignment and structure

>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112	Back alignment and structure

>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64	Back alignment and structure

>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150	Back alignment and structure

>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56	Back alignment and structure

>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65	Back alignment and structure

>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118	Back alignment and structure

>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74	Back alignment and structure

>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 64	Back alignment and structure

>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165	Back alignment and structure

>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73	Back alignment and structure

>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92	Back alignment and structure

>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		657
2l0b_A		91	E3 ubiquitin-protein ligase praja-1; zinc finger,	99.51
1x4j_A		75	Ring finger protein 38; structural genomics, NPPSF	99.41
2ep4_A		74	Ring finger protein 24; zinc binding, ubiquitin, E	99.41
2kiz_A		69	E3 ubiquitin-protein ligase arkadia; ring-H2 finge	99.39
2ect_A		78	Ring finger protein 126; metal binding protein, st	99.38
1iym_A		55	EL5; ring-H2 finger, ubiquitin ligase, DNA binding	99.37
1v87_A		114	Deltex protein 2; ring-H2 domain, zinc-binding dom	99.32
2ecm_A		55	Ring finger and CHY zinc finger domain- containing	99.28
2ecl_A		81	Ring-box protein 2; RNF7, ring domian, zinc-bindin	99.26
3ng2_A		71	RNF4, snurf, ring finger protein 4; ring domain, E	99.25
2ea6_A		69	Ring finger protein 4; RNF4, RES4-26, ring domain,	99.25
3dpl_R		106	Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST	99.24
2d8t_A		71	Dactylidin, ring finger protein 146; RNF146, ring	99.2
2xeu_A		64	Ring finger protein 4; transcription, zinc-finger,	99.2
2djb_A		72	Polycomb group ring finger protein 6; PCGF6, ring	99.19
2ct2_A		88	Tripartite motif protein 32; zinc-finger protein H	99.17
2csy_A		81	Zinc finger protein 183-like 1; ring finger protei	99.15
1chc_A		68	Equine herpes virus-1 ring domain; viral protein;	99.15
2d8s_A		80	Cellular modulator of immune recognition; C-MIR, m	99.14
2ecn_A		70	Ring finger protein 141; RNF141, ring domain, zinc	99.13
2yur_A		74	Retinoblastoma-binding protein 6; P53-associated c	99.13
2ysl_A		73	Tripartite motif-containing protein 31; ring-type	99.12
2ecy_A		66	TNF receptor-associated factor 3; metal binding pr	99.11
4ayc_A		138	E3 ubiquitin-protein ligase RNF8; DNA damage, K63	99.11
4a0k_B		117	E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi	99.1
2ecw_A		85	Tripartite motif-containing protein 30; metal bind	99.09
1t1h_A		78	Gspef-atpub14, armadillo repeat containing protein	99.09
2ecv_A		85	Tripartite motif-containing protein 5; metal bindi	99.06
2ysj_A		63	Tripartite motif-containing protein 31; ring-type	99.05
3lrq_A		100	E3 ubiquitin-protein ligase TRIM37; structural gen	99.04
2egp_A		79	Tripartite motif-containing protein 34; ZF-C3HC4 d	99.03
3ztg_A		92	E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR	99.01
2ckl_A		108	Polycomb group ring finger protein 4; BMI1, RING1B	99.01
1jm7_A		112	BRCA1, breast cancer type 1 susceptibility protein	99.01
4ap4_A		133	E3 ubiquitin ligase RNF4; ligase-signalling protei	99.0
2y43_A		99	E3 ubiquitin-protein ligase RAD18; DNA repair, met	99.0
2ecj_A		58	Tripartite motif-containing protein 39; TRIM39, ri	99.0
3fl2_A		124	E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA	98.97
2ckl_B		165	Ubiquitin ligase protein RING2; BMI1, RING1B, poly	98.92
1g25_A		65	CDK-activating kinase assembly factor MAT1; ring f	98.9
1z6u_A		150	NP95-like ring finger protein isoform B; structura	98.9
2ct0_A		74	Non-SMC element 1 homolog; ring domain, structural	98.9
2kr4_A		85	Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri	98.88
3hct_A		118	TNF receptor-associated factor 6; cross-brace, bet	98.86
3l11_A		115	E3 ubiquitin-protein ligase RNF168; E3 ligase, rin	98.85
4ap4_A		133	E3 ubiquitin ligase RNF4; ligase-signalling protei	98.85
2kre_A		100	Ubiquitin conjugation factor E4 B; U-box domain, E	98.84
1wgm_A		98	Ubiquitin conjugation factor E4A; ubiquitinating e	98.83
1rmd_A		116	RAG1; V(D)J recombination, antibody, MAD, ring fin	98.79
2c2l_A		281	CHIP, carboxy terminus of HSP70-interacting protei	98.78
2vje_A		64	E3 ubiquitin-protein ligase MDM2; proto-oncogene,	98.77
2y1n_A		389	E3 ubiquitin-protein ligase; ligase-transferase co	98.74
1bor_A		56	Transcription factor PML; proto-oncogene, nuclear	98.72
2vje_B		63	MDM4 protein; proto-oncogene, phosphorylation, alt	98.72
1e4u_A		78	Transcriptional repressor NOT4; gene regulation, t	98.7
3knv_A		141	TNF receptor-associated factor 2; cross-brace, alt	98.7
1jm7_B		117	BARD1, BRCA1-associated ring domain protein 1; rin	98.68
2yu4_A		94	E3 SUMO-protein ligase NSE2; SP-ring domain, struc	98.66
4ic3_A		74	E3 ubiquitin-protein ligase XIAP; ring domain, zin	98.62
2f42_A		179	STIP1 homology and U-box containing protein 1; cha	98.58
3hcs_A		170	TNF receptor-associated factor 6; cross-brace, bet	98.54
2ecg_A		75	Baculoviral IAP repeat-containing protein 4; BIRC4	98.46
3k1l_B		381	Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A	98.42
2ea5_A		68	Cell growth regulator with ring finger domain prot	98.4
1wim_A		94	KIAA0161 protein; ring finger domain, UBCM4-intera	98.38
2bay_A		61	PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l	98.35
1vyx_A		60	ORF K3, K3RING; zinc-binding protein, ring domain,	98.3
3htk_C		267	E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-	98.26
2yho_A		79	E3 ubiquitin-protein ligase mylip; ligase, E2 liga	98.26
3t6p_A		345	Baculoviral IAP repeat-containing protein 2; ring,	98.17
3vk6_A		101	E3 ubiquitin-protein ligase hakai; HYB, phosphotyr	97.69
3nw0_A		238	Non-structural maintenance of chromosomes element	97.35
2ko5_A		99	Ring finger protein Z; lassa fever virus-Z, negati	95.61
2jun_A		101	Midline-1; B-BOX, TRIM, ring finger, alternative s	93.6
2lri_C		66	Autoimmune regulator; Zn binding protein domain, a	89.17
3m62_A		968	Ubiquitin conjugation factor E4; armadillo-like re	89.13
1wil_A		89	KIAA1045 protein; ring finger domain, structural g	87.68
3i2d_A		371	E3 SUMO-protein ligase SIZ1; signal transduction,	86.81
4fo9_A		360	E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom	82.11
2l5u_A		61	Chromodomain-helicase-DNA-binding protein 4; CHD4,	80.52
1we9_A		64	PHD finger family protein; structural genomics, PH	80.25

>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens}	Back alignment and structure

Probab=99.51  E-value=1.2e-14  Score=125.57  Aligned_cols=77  Identities=27%  Similarity=0.590  Sum_probs=62.6

Q ss_pred             CCCCCCHHHHHHhhhhcccccccCCCCCCCccccccCCcCCCCceeEecCCChhcHHHHHHHHHcCCCCCCCCCCcCC
Q 006188          577 VSTGLTEETIKNRLKQQKYSISLGSQQEQEPCCICQEEYNDGEDTGILHCGHDFHTSCIKQWLMHKNLCPICKTTALS  654 (657)
Q Consensus       577 vstgLsee~I~k~L~~~ky~~~~~~~~~~e~C~IClEef~d~d~v~~LpCGHiFH~~CI~qWL~~k~tCPICRtsLl~  654 (657)
                      ...+++++.+. .++..++.........+..|+||+++|..++.+..++|||.||..||.+||+.+.+||+||+.+.+
T Consensus        13 ~~~~~s~~~i~-~lp~~~~~~~~~~~~~~~~C~IC~~~~~~~~~~~~l~C~H~Fh~~Ci~~wl~~~~~CP~Cr~~~~~   89 (91)
T 2l0b_A           13 ANPPASKESID-ALPEILVTEDHGAVGQEMCCPICCSEYVKGDVATELPCHHYFHKPCVSIWLQKSGTCPVCRCMFPP   89 (91)
T ss_dssp             CCCCCCHHHHH-TSCEEECCTTCSSSSSCSEETTTTEECCTTCEEEEETTTEEEEHHHHHHHHTTTCBCTTTCCBSSC
T ss_pred             CCCCCCHHHHH-hCCCeeecccccccCCCCCCcccChhhcCCCcEEecCCCChHHHHHHHHHHHcCCcCcCcCccCCC
Confidence            34566666664 466666654444556678899999999998888889999999999999999999999999998865

PyMOL of 2l0b

>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens}	Back alignment and structure

>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}	Back alignment and structure

>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1	Back alignment and structure

>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1	Back alignment and structure

>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A	Back alignment and structure

>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus}	Back alignment and structure

>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A	Back alignment and structure

>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens}	Back alignment and structure

>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1	Back alignment and structure

>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens}	Back alignment and structure

>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C	Back alignment and structure

>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus}	Back alignment and structure

>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2	Back alignment and structure

>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens}	Back alignment and structure

>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens}	Back alignment and structure

>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens}	Back alignment and structure

>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A	Back alignment and structure

>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus}	Back alignment and structure

>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens}	Back alignment and structure

>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens}	Back alignment and structure

>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B	Back alignment and structure

>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens}	Back alignment and structure

>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus}	Back alignment and structure

>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A	Back alignment and structure

>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens}	Back alignment and structure

>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus}	Back alignment and structure

>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B	Back alignment and structure

>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2	Back alignment and structure

>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1	Back alignment and structure

>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2	Back alignment and structure

>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A	Back alignment and structure

>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A*	Back alignment and structure

>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B*	Back alignment and structure

>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B	Back alignment and structure

>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens}	Back alignment and structure

>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A	Back alignment and structure

>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C	Back alignment and structure

>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens}	Back alignment and structure

>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster}	Back alignment and structure

>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A	Back alignment and structure

>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3	Back alignment and structure

>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae}	Back alignment and structure

>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A	Back alignment and structure

>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B	Back alignment and structure

>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus}	Back alignment and structure

>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens}	Back alignment and structure

>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens}	Back alignment and structure

>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens}	Back alignment and structure

>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A	Back alignment and structure

>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3	Back alignment and structure

>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B	Back alignment and structure

>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens}	Back alignment and structure

>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		657
d1iyma_		55	g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati	4e-17
d1chca_		68	g.44.1.1 (A:) Immediate early protein, IEEHV {Equi	5e-15
d1fbva4		79	g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta	1e-13
d3dplr1		88	g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S	6e-13
d1g25a_		65	g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi	1e-11
d1vyxa_		60	g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do	2e-11
d1ur6b_		52	g.44.1.1 (B:) Not-4 N-terminal RING finger domain	3e-11
d1bora_		56	g.44.1.1 (A:) Acute promyelocytic leukaemia proto-	3e-10
d1jm7a_		103	g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie	2e-08
d1rmda2		86	g.44.1.1 (A:1-86) V(D)J recombination activating p	8e-08
d1wima_		94	g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016	1e-07
d1v87a_		114	g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou	3e-07
d1jm7b_		97	g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie	6e-06
d2baya1		56	g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {	1e-05
d1t1ha_		78	g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre	0.001
d1mm2a_		61	g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens	0.001
d1we9a_		64	g.50.1.2 (A:) PHD finger protein At5g26210 {Thale	0.001
d1wesa_		71	g.50.1.2 (A:) PHD Inhibitor of growth protein 2, I	0.001
d2c2la2		80	g.44.1.2 (A:225-304) STIP1 homology and U box-cont	0.002

>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55	Back information, alignment and structure


class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]

 Score = 73.4 bits (180), Expect = 4e-17
 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 1/51 (1%)

Query: 604 EQEPCCICQEEYNDGEDTGIL-HCGHDFHTSCIKQWLMHKNLCPICKTTAL 653
           +   C +C  E  DGE+   L  CGH FH  C+  WL   + CP+C+ T +
Sbjct: 4   DGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTVV 54

PyMOL of d1iyma_

>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68	Back information, alignment and structure

>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79	Back information, alignment and structure

>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88	Back information, alignment and structure

>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65	Back information, alignment and structure

>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60	Back information, alignment and structure

>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52	Back information, alignment and structure

>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56	Back information, alignment and structure

>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103	Back information, alignment and structure

>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86	Back information, alignment and structure

>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94	Back information, alignment and structure

>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114	Back information, alignment and structure

>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97	Back information, alignment and structure

>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56	Back information, alignment and structure

>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78	Back information, alignment and structure

>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61	Back information, alignment and structure

>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64	Back information, alignment and structure

>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 71	Back information, alignment and structure

>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		657
d1iyma_		55	EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45	99.5
d1chca_		68	Immediate early protein, IEEHV {Equine herpesvirus	99.3
d1v87a_		114	Deltex protein 2 RING-H2 domain {Mouse (Mus muscul	99.3
d3dplr1		88	RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase	99.26
d1fbva4		79	CBL {Human (Homo sapiens) [TaxId: 9606]}	99.21
d1ur6b_		52	Not-4 N-terminal RING finger domain {Human (Homo s	99.19
d1g25a_		65	TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9	99.14
d2baya1		56	Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac	99.07
d1jm7a_		103	brca1 RING domain {Human (Homo sapiens) [TaxId: 96	99.03
d1rmda2		86	V(D)J recombination activating protein 1 (RAG1), d	99.0
d1bora_		56	Acute promyelocytic leukaemia proto-oncoprotein PM	98.98
d1vyxa_		60	IE1B protein (ORF K3), N-terminal domain {Kaposi's	98.83
d1t1ha_		78	E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi	98.82
d2c2la2		80	STIP1 homology and U box-containing protein 1, STU	98.81
d1jm7b_		97	bard1 RING domain {Human (Homo sapiens) [TaxId: 96	98.76
d1wgma_		98	Ubiquitin conjugation factor E4A {Human (Homo sapi	98.61
d1wima_		94	UbcM4-interacting protein 4 (KIAA0161) {Human (Hom	98.27
d1f62a_		51	Williams-Beuren syndrome transcription factor, WST	88.15
d1we9a_		64	PHD finger protein At5g26210 {Thale cress (Arabido	82.73
d1wema_		76	Death associated transcription factor 1, Datf1 (DI	80.01

>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]}	Back information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]

Probab=99.50  E-value=3.3e-15  Score=117.28  Aligned_cols=51  Identities=37%  Similarity=1.035  Sum_probs=46.1

Q ss_pred             CCCCccccccCCcCCCCceeEe-cCCChhcHHHHHHHHHcCCCCCCCCCCcC
Q 006188          603 QEQEPCCICQEEYNDGEDTGIL-HCGHDFHTSCIKQWLMHKNLCPICKTTAL  653 (657)
Q Consensus       603 ~~~e~C~IClEef~d~d~v~~L-pCGHiFH~~CI~qWL~~k~tCPICRtsLl  653 (657)
                      +++.+|+||+++|.+++.+..+ .|+|.||..||.+||+.+.+||+||+.++
T Consensus         3 ed~~~C~ICl~~~~~~~~~~~l~~C~H~Fh~~Ci~~Wl~~~~~CP~CR~~i~   54 (55)
T d1iyma_           3 DDGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTVV   54 (55)
T ss_dssp             CCSCCCTTTCCCCCTTSCCEECSSSCCEECTTHHHHTTTTCCSCSSSCCCSC
T ss_pred             CCCCCCeEECccccCCCEEEEeCCCCCcccHHHHHHHHHhCCcCCCCCCEeE
Confidence            4556799999999999888777 59999999999999999999999999875

PyMOL of d1iyma_

>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]}	Back information, alignment and structure

>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]}	Back information, alignment and structure

>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure